WorldWideScience

Sample records for gossypii glover homoptera

  1. Tanggap fungsional Menochilus sexmaculatus Fabricius (Coleoptera: Coccinellidae terhadap Aphis gossypii (Glover (Homoptera: Aphididae pada umur tanaman cabai berbeda

    Directory of Open Access Journals (Sweden)

    Novri Nelly

    2015-09-01

    Full Text Available The lady beetle, Menochilus sexmaculatus is one of the biological control agents that can be used to control aphids. Presently, there is a lack of information about the effectiveness of this beetle to control aphids. The objective of this research was to study the functional response of M. sexmaculatus on Aphis gossypii at different ages of plants. All preys were exposed to one M. sexmaculatus adult for an hour at five different densities of aphids (10, 20, 30, 40, and 50 individuals is four different ages of chilli plants (2,4,6, and 8 weeks. Data were analyzed by ANOVA and logistic regression to determine the type of functional response. The results showed that the ability of M. sexmaculatus to prey was not significant at 2 to 4 and 6 to 8 weeks old chilli plants. At 2 week old chilli plants M. sexmaculatus showed type I of functional response, while at 4, 6 and 8 weeks the functional response were type III.

  2. Respon Fungsional Menochilus sexmaculatus Fabricius terhadap Aphis Gossypii Glover

    Directory of Open Access Journals (Sweden)

    F. X. Wagiman

    1996-12-01

    Full Text Available Laboratory and field-cage experiments were conducted at the Universiti Pertanian Malaysia. Objective of the study was to determine the functional response of Menochilus sexmaculatus Fabricius (Coleoptera: Coccinellidae predating on chilli aphid Aphis gossypii Glover (Homoptera: Aphididae. The larvae and adults of the predaceous coccinellid exhibited the Hulling's Type II functional response. A first instar of the coccinellid predating on single first instar of the aphid within 24.6 minutes in the laboratory and 16.8 minutes in the field. While a fourth instar and an adult of the coccinellid predating on single fourth instar of the aphid within 4.2 and 1.5 minutes respectively.

  3. Biological parameters of the non-target pest Aphis gossypii Glover ...

    African Journals Online (AJOL)

    Thiago Mota

    2013-04-17

    Apr 17, 2013 ... Development and commercial use of Bollgard cotton in the USA nearly promises versus today reality. Plant. J. 27:489-501. Pessoa LGA, Souza B, Carvalho CF, Silva M (2004). Aspectos da biologia de Aphis gossypii Glover, 1877 (Hemiptera: Aphididae) em quatro cultivares de Algodoeiro, em Laboratório.

  4. A laboratory and field condition comparison of life table parameters of Aphis gossypii Glover (Hemiptera: Aphididae

    Directory of Open Access Journals (Sweden)

    Hosseini-Tabesh Behnaz

    2015-01-01

    Full Text Available Life table studies are essential tools for understanding population dynamics. The life table parameters of Aphis gossypii Glover (Hemiptera: Aphididae feeding on the host plant, Hibiscus syriacus L. were studied under laboratory (25±1°C and relative humidity of 65±5% and a photoperiod of 16L : 8D h and field conditions (23-43°C, and relative humidity of 27-95%. The data were analysed using the age-stage, two-sex life table theory. The life table studies were started with 50 and 40 nymphs in laboratory and field conditions, respectively. Under laboratory conditions, A. gossypii reared on H. syriacus had a higher survival rate, fecundity, and longevity than those reared under field conditions. When reared under field conditions, A. gossypii had a longer nymphal developmental time, shorter adult longevity, and lower fecundity than those reared under laboratory conditions. The intrinsic rate of increase (r, net reproductive rate (R0, and the finite rate of increase (λ under laboratory conditions, were higher than those obtained under field conditions. Nevertheless, there were no significant differences in the mean generation time T (days between field and laboratory conditions. In the present study, the results clearly showed that life table parameters of A. gossypii were significantly different under field and laboratory conditions. These results could help us to understand the A. gossypii population dynamics under field conditions. The results could also help us make better management decisions for economically important crops

  5. Biological control of cotton aphid (Aphis gossypii Glover) in cotton (inter)cropping systems in China : a simulation study

    NARCIS (Netherlands)

    Xia, J.

    1997-01-01

    Cotton aphid ( Aphis gossypii Glover) is the key insect pest of seedling cotton ( Gossypium hirsutum L. ) in China, particularly in the North China cotton region. The resulting annual losses amount to 10-15% of the attainable yield. Sole reliance on

  6. Hypersensitive response to Aphis gossypii Glover in melon genotypes carrying the Vat gene.

    Science.gov (United States)

    Villada, Emilio Sarria; González, Elisa Garzo; López-Sesé, Ana Isabel; Castiel, Alberto Fereres; Gómez-Guillamón, María Luisa

    2009-01-01

    Aphis gossypii Glover causes direct and indirect damage to Cucumis melo L. crops. To decrease the harmful effects of this pest, one of the most economically and environmentally acceptable options is to use genetically resistant melon varieties. To date, several sources of resistance carrying the Vat gene are used in melon breeding programmes that aim to prevent A. gossypii colonization and the subsequent aphid virus transmission. The results suggest that the resistance conferred by this gene is associated with a microscopic hypersensitive response specific against A. gossypii. Soon after aphid infestation, phenol synthesis, deposits of callose and lignin in the cell walls, damage to the plasmalemma, and a micro-oxidative burst were detected in genotypes carrying the Vat gene. According to electrical penetration graph experiments, this response seems to occur after aphid stylets puncture the plant cells and not during intercellular stylet penetration. This type of plant tissue reaction was not detected in melon plants infested with Bemisia tabaci Gennadius nor Myzus persicae Sulzer.

  7. Duração e viabilidade das fases pré-imaginais de Chrysoperla externa (Hagen alimentadas com Aphis gossypii Glover e Sitotroga cerealella (Olivier Duration and viability of Chrysoperla externa (Hagen pre-imago phases, fed with Aphis gossypii (Glover and Sitotroga cerealella (Olivier

    Directory of Open Access Journals (Sweden)

    Luciano Pacelli Medeiros Macedo

    2002-05-01

    Full Text Available Estudou-se a duração e a viabilidade das fases imaturas de Chrysoperla externa (Hagen (Neuroptera, Chrysopidae alimentadas com o pulgão do algodoeiro, Aphis gossypii Glover (Homoptera, Aphididae, e com a traça do milho, Sitotroga cerealella (Olivier (Lepidoptera: Gelechiidae. A pesquisa foi conduzida no Laboratório de Entomologia da Embrapa - CNPA, em Campina Grande, Paraíba, em 1998/99 em condições controladas sob temperatura de 25±2ºC, 70±10% UR e fotofase de 12 horas. O desenvolvimento pré-imaginal de C. externa decorreu normalmente: fase larval com três ínstares, pré-pupa e pupa. De acordo com os resultados, pode-se concluir que as larvas de C. externa alimentadas com A. gossypii apresentam uma duração significativamente maior para o primeiro e terceiro ínstares, que às alimentadas com S. cerealella. Entretanto, não há efeito dessas presas na viabilidade das fases desse predador, exceto para a de pré-pupa. C. externa pode ser criado em A. gossypii ou S. cerealella sem risco de perda de viabilidade, embora algumas fases possam ser mais longas.This work was carried out at the Laboratório de Entomologia da Embrapa - CNPA, in Campina Grande, state of Paraíba, Brazil, in 1998/99, to study the duration and viability of Chrysoperla externa (Hagen (Neuroptera, Chrysopidae larvae, fed with Aphis gossypii (Homoptera, Aphididae and Sitotroga cerealella (Lepidoptera: Gelechiidae, under controlled conditions. The temperature was 25+-2º C, 70+-10% UR and 12-hour photophase. The C. externa pre-imaginal development was normal: larval phase with three instars, pre-pupa and pupa. The results showed that C. externa larvae fed on A. gossypii had a first and third instar longer than the ones fed with S. cerealella. However, no effect was observed in the phases' viability, excepting the pre-pupa. C. externa can feed on both preys without viability loss, although this may enhance some phases' duration.

  8. First record of larvae of Allograpta exotica Wiedemann (Diptera, Syrphidae preying on Aphis gossypii Glover (Hemiptera, Aphididae in watermelon in Brazil

    Directory of Open Access Journals (Sweden)

    Vinícius Soares Sturza

    2011-06-01

    Full Text Available First record of larvae of Allograpta exotica Wiedemann (Diptera, Syrphidae preying on Aphis gossypii Glover (Hemiptera, Aphididae in watermelon in Brazil. Brazil is one of the largest world producers of watermelon (Citrullus lanatus Thumb. Mansf. and Aphis gossypii Glover, 1877 (Hemiptera, Aphididae is among the most important pest on this crop. Larvae of Allograpta exotica Wiedemann, 1830 (Diptera, Syrphidae were found preying on A. gossypii in watermelon crop, in Santa Maria, Rio Grande do Sul State, what represents the first report of this tritrophic association in Brazil.

  9. Effectiveness of Lysiphlebus testaceïpes Cresson as biocontrol agent of Aphis gossypii Glover infesting pepper plants

    Directory of Open Access Journals (Sweden)

    M. Ben Halima Kamel

    2011-12-01

    Full Text Available In Tunisia, greenhouse crops are damaged by Aphis gossypii Glover and Myzus persicae Sulzer (Ben Halima Kamel 1991; Ben Halima Kamel and Ben Hamouda 1993, 1998. These aphids are considered to be the most dangerous pests of pepper because of their biology and biotic potential (Ben Halima Kamel 1991; Blackman and Eastop 2000. There are several ways of controlling these pests with chemical control being the most widely used. This method has more disadvantages than benefits (Gibson et al. 1982. The use of natural enemies to control aphids is an effective way of improving the yield and quality of protected crops. There are many studies on the following naturally occurring enemies of A. gossypii: Aphidius matricariae Haliday, Lysiphlebus fabarum Marshall, Aphidoletes aphidimyza (Rondani, Episyrphus balteatus (De Geer (Ben Halima Kamel and Ben Hamouda 1998 and Lysiphlebus testaceipes (Cresson (Ben Halima Kamel, unpublished data, 1999. It is now important to evaluate the effectiveness of L. testaceipes as a biocontrol agent of A. gossypii. This parasitoďd was introduced into the Mediterranean area (Carver and Franzmann 2001 and is thought to be an important parasite of A. gossypii (Lopes et al. 2007. The aim of this mainly laboratory study was to determine the factors affecting the establishment and success of a biological control agent, in particular the number of L. testaceďpes relative to the initial density of A. gossypii, needed to control the aphid. In addition, the effect of the L. testaceďpes on structure of A. gossypii populations was evaluated. Furthermore, the effectiveness of L. testaceipes in controlling A. gossypii infesting a protected crop of pepper plants and the subsequent effect on the growth of the pepper plants was also evaluated.

  10. Keefektifan fosfin formulasi cair terhadap Aphis gossypii Glover dan Macrosiphoniella sanborni Gillette (Hemiptera: Aphididae pada bunga potong krisan

    Directory of Open Access Journals (Sweden)

    Nur Rachman

    2016-09-01

    Full Text Available Cut flower of chrysanthemum has high aesthetic and economic values. Export volume of chrysanthemums from Indonesia are lower than other countries, due to the impact of insect pest. Insect pests, Aphis gossypii Glover and Macrosiphoniella sanborni Gillette are currently associated with cut flowers  especially chrysanthemum. One control measures usually taken in quarantine is fumigation. Alternative fumigant, liquified phosphine formulations may potentially be applied for quarantine treatment. The objectives of this study were to determine the concentration and exposure time of liquified phosphine against these species and to evaluate the effect of fumigant on the physical quality of cut flowers. The experiment was conducted in four steps: (1 identification and mass rearing of A. gossypii and M. sanborni; (2 preliminary tests on adult and third instar nymphs; (3 determination of liquified phosphine with various concentration and exposure time against adult and third instar nymphs of A. gosspypii and M. sanborni and; (4 validation test of effective concentration of fumigant and exposure time and the effect on quality of cut flowers. The results of study showed concentration of fumigant causing 100% mortality A. gossypii and M. sanborni  ere 500 ppm and 700 ppm, respectively with exposure time 12 hours. Concentrations of 700 ppm and exposure time up to 18 hours did not cause negative impact to the quality of chrysanthemum cut flowers.

  11. Biological parameters of the non-target pest Aphis gossypii Glover ...

    African Journals Online (AJOL)

    In the present work, we aimed to evaluate: 1) the influence of the Cry1Ac protein expressed by the genetically modified cotton variety (Bt) NuOpal, on the biological parameters of a non-target pest, Aphis gossypii, reared under laboratory conditions; 2) the influence of plant age on aphid development. Cotton cultivars were ...

  12. Efeito repelente de azadiractina e óleos essenciais sobre Aphis gossypii Glover (Hemiptera: Aphididae em algodoeiro Repellent effect of azadirachtin and essential oils on Aphis gossypii Glover (Hemiptera: Aphididae in cotton plants

    Directory of Open Access Journals (Sweden)

    Lígia Helena de Andrade

    2013-09-01

    Full Text Available A repelência de inseticidas botânicos tem se destacado como uma tática promissora no controle alternativo de pragas agrícolas e urbanas, podendo ser um dos componentes do manejo integrado de pragas. Objetivou-se com este trabalho identificar a repelência de inseticidas botânicos sobre fêmeas ápteras de Aphis gossypii Glover. Testes com chance de escolha foram realizados com discos de folha de algodoeiro, imersos nas caldas dos inseticidas e testemunha (água destilada com DMSO a 2%. Utilizou-se azadirachtina (0,075% e os óleos essenciais de Piper hispidinervum CDC, P. aduncum L., Cymbopogon winterianus (L., C. citratus (D.C. Stapf, Foeniculum vulgare Mill, Syzygium aromaticum (L. Merrill e Perry, Cinnamomum zeylanicum Blume, Schinus terebinthifolius Raddi e Chenopodium ambrosioides L. na concentração de 0,05%. C. citratus, C. winterianus, P. aduncum, S. terebinthifolius, azadirachtina e C. zeylanicum apresentaram os maiores percentuais de repelência, 100; 84; 66,67; 64; 60,87 e 48% respectivamente e reduziram a produção de ninfas em 100; 92; 42,9; 87,5; 80,65 e 89,74%, apresentando resultados significativos pelo teste do χ2 ao nível de 10% de probabilidade. Nos testes com F. vulgare (χ2 = 3,66, P = 0,05 as fêmeas de A. gossypii foram atraídas significativamente para os discos tratados e ocorreu um aumento na produção de ninfas nos resultados obtidos para F. vulgare (χ2 = 5,87, P = 0,02 e C. ambrosioides (χ2 = 14,31, P = 0,001.The repellence of botanical insecticides has emerged as a promising technique in the alternative control of urban and agricultural pests, being seen as one component of integrated pest management. The aim of this work was to identify the repellence of botanical insecticides on apterous females of Aphis gossypii Glover. Random-choice tests were carried out with discs from the leaves of cotton plants immersed in insecticide solution and in a control (distilled water with 2% DMSO. Azadirachtin was used

  13. Effects of nitrogen fertilization in cotton crop on Aphis gossypii Glover (Hemiptera: Aphididae) biology

    International Nuclear Information System (INIS)

    Barros, Ricardo; Degrande, Paulo E.; Fernandes, Marcos G.; Nogueira, Rodrigo F.

    2007-01-01

    The cotton aphid, Aphis gossypii Glove, is one of the pests of cotton crop and its relation with the host seem to depend on the amount of nitrogen available to the plant. The biology of A. gossypii using different cotton nitrogen fertility regimes was studied under greenhouse conditions, in Dourados, MS. A completely randomized design with nine replications in a factorial scheme (2x4x2)+1 was used. Two nitrogen sources (sulphate of ammonium and urea), four doses of nitrogen (50, 100, 150 and 200 kg ha-1), two different times of nitrogen application and one additional treatment without nitrogen were taken as factors. The nymphal phases, the pre-reproductive, reproductive and pos-reproductive periods, longevity, the life cycle and fecundity of the cotton aphid were evaluated. The doses of nitrogen influenced the cotton aphid biology in both sources and times of application, favoring its development and fecundity. (author)

  14. [Pathogenicity of hyphomycet fungi to aphids Aphis gossypii Glover and Myzus persicae (Sulzer) (Hemiptera: Aphididae)].

    Science.gov (United States)

    Loureiro, Elisângela de S; oino, Alcides

    2006-01-01

    The aphids Aphis gossypii and Myzus persicae are cosmopolitan, poliphagous and damage cultivated plants. The effects of the entomopathogenic fungi Beauveria bassiana (isolate IBCB 66), Metarhizium anisopliae (isolate IBCB 121), Paecilomyces fumosoroseus (isolate IBCB 141) and Lecanicillium (= Verticillium) lecanii (isolate JAB 02) on third instar nymphs of A. gossypii and M. persicae were evaluated in the laboratory at 25 degrees C, 70 +/- 10% RH and 12h photophase. The aphids were transferred to petri dishes with a foliar disk (cotton or pepper) with a layer of 1 cm tick of agar-water. The fungi were applied in a suspension containing 1.0 x 106 to 1.0 x 108 conidia/ml. In the control treatment 1 ml of sterilized water was added to the foliar disks. The mortality of aphids was evaluated daily. B. bassiana and M. anisopliae caused 100% mortality at the seventh day after inoculation, for both species. L. lecanii was the fungus that provided mortality later in the aphids and M. persicae was more susceptible to both fungi than A. gossypii.

  15. Leaf endophytic fungi of chili (Capsicum annuum and their role in the protection against Aphis gossypii (Homoptera: Aphididae

    Directory of Open Access Journals (Sweden)

    HENY HERNAWATI

    2011-10-01

    Full Text Available Hernawati H, Wiyono S, Santoso S (2011 Leaf endophytic fungi of chili (Capsicum annuum and their role in the protection against Aphis gossypii (Homoptera: Aphididae. Biodiversitas 12: 187-191. The objectives of the research were to study the diversity of leaf endophytic fungi of chili, and investigate its potency in protecting host plants against Aphis gossypii Glov. Endophytic fungi were isolated from chili leaves with two categories: aphid infested plants and aphid-free plants, collected from farmer’s field in Bogor, West Java. Abundance of each fungal species from leave samples was determined by calculating frequency of isolation. The isolated fungi were tested on population growth of A. gossypii. The fungal isolates showed suppressing effect in population growth test, was further tested on biology attributes i.e. life cycle, fecundity and body length. Five species of leaf endophytic fungi of chili were found i.e. Aspergillus flavus, Nigrospora sp., Coniothyrium sp., and SH1 (sterile hypha 1, SH2 (sterile hypha 2. Eventhough the number of endophytic fungi species in aphid-free and aphid-infested plant was same, the abundance of each species was different. Nigrospora sp., sterile hyphae 1 and sterile hyphae 2 was more abundant in aphid-free plants, but there was no difference in dominance of Aspergillus flavus and Coniothyrium sp. Nigrospora sp., SH1 and SH2 treatment reduced significantly fecundity of A. gossypii. Only SH2 treatment significantly prolonged life cycle and suppress body length, therefore the fungus had the strongest suppressing effect on population growth among fungi tested. The abundance and dominance of endophytic fungal species has relation with the infestation of A. gossypii in the field.

  16. Effects on the non-target aphid Aphis Gossypii Glover (Homoptera ...

    African Journals Online (AJOL)

    bych76-zhjh77

    2012-05-22

    May 22, 2012 ... parasitoids and their honeydew is an important energy source for several arthropods. Analyses of the impact of transgenic plants expressing Cry toxins on aphids gave variable results ranging from minor negative effects on aphid survival and fecundity to significant beneficial effects on aphid populations ...

  17. Fertility life table of Lysiphlebus testaceipes (Cresson) (Hymenoptera, Braconidae, Aphidiinae) in Rhopalosiphum maidis (Fitch) and Aphis gossypii Glover (Hemiptera, Aphididae); Tabela de vida de fertilidade de Lysiphlebus testaceipes (Cresson) (Hymenoptera, Braconidae, Aphidiinae) em Rhopalosiphum maidis (Fitch) e Aphis gossypii Glover (Hemiptera, Aphididae)

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Robson Jose da; Bueno, Vanda Helena Paes; Silva, Diego Bastos [Universidade Federal de Lavras (UFLA), MG (Brazil). Dept. de Entomologia. Lab. de Controle Biologico], e-mail: ecosbio@yahoo.com.br, e-mail: vhpbueno@ufla.br; Sampaio, Marcus Vinicius [Universidade Federal de Uberlandia, Umuarama, MG (Brazil). Inst. de Ciencias Agrarias], e-mail: mvsampaio@iciag.ufu.br

    2008-07-01

    Fertility life table of Lysiphlebus testaceipes (Cresson) (Hymenoptera, Braconidae, Aphidiinae) in Rhopalosiphum maidis (Fitch) and Aphis gossypii Glover (Hemiptera, Aphididae). The evaluation of the growth potential of Lysiphlebus testaceipes (Cresson) is important for its use in biological control programs of aphids. This work aimed to evaluate the fertility life table of L. testaceipes in Rhopalosiphum maidis (Fitch) and Aphis gossypii Glover. To determine the immature mortality, development and the sex ratio of the parasitoid, 12 females parasitoid, and 480 nymphs of each aphids were used. To evaluate the longevity and fertility 15 female parasitoid were used. Nymphs of each aphid (3 day old) were offered for each parasitoid female daily, until the female died, being 300 (first day); 250 (second day); 200 (third day); 150 (fourth day) and 50 nymphs in the other days. L. testaceipes showed immature mortality rates of 5.6 % in R. maidis and 9.2 % in A. gossypii. The development time of L. testaceipes in R. maidis and A. gossypii was 10.2 and 10.1 days, and the sex ratio of 0.71 and 0.66, respectively. The female of L. testaceipes had a fecundity of 498.8 eggs in R. maidis and 327.8 eggs in A. gossypii. The growth parameters the L. testaceipes in R. maidis and A. gossypii were, respectively R{sub o}= 205.38 and 164.08 females; r{sub m}= 0.449 and 0.431 females/females/day; {lambda}= 1.57 and 1.54 females/day; T= 11.86 and 11.83 days and TD= 10.78 and 11.27 days. L. testaceipes showed great growth potential on both aphid hosts. R. maidis could be a suitable host for proposals of mass-rearing and open rearing system using L. testaceipes. (author)

  18. Fecundidade e longevidade de Aphis gossypii Glover, 1877 (Hemiptera, Aphididae em diferentes temperaturas e cultivares comerciais de crisântemo (Dendranthema grandiflora Tzvelev

    Directory of Open Access Journals (Sweden)

    Soglia Maria C. de M.

    2003-01-01

    Full Text Available Fecundity and longevity of Aphis gossypii Glover, 1877 (Hemiptera, Aphididae at different temperatures and commercial chrysanthemum cultivars (Dendranthema grandiflora Tzvelev. The aphid A. gossypii is one of the main pests in a number of crops both under field and protected conditions. The objective of the present study was to evaluate the fecundity and longevity of A. gossypii under different temperatures and commercial chrysanthemum cultivars (Yellow Snowdon, White Reagan and Dark Splendid Reagan with different trichomes densities (11.3; 16.6 and 21.6 trichome/mm² of the leaf, respectively The trials were carried out in climatic chambers, at four temperatures (15, 20, 25 and 30 ±1 °C, 70 ± 10% RH and photophase 10h. The reproductive period significantly decreased with increase of temperature in the three cultivars. In Yellow Snowdon cultivar average duration of the reproductive period was 14.3 days at 25 °C. The maximum fecundity was obtained at the temperature of 25 ºC with 3,1; 2,8 and 3,6 nymphs/female/day in the Yellow Snowdon, White Reagan and Dark S. Reagan cultivars, respectively. The total fecundity was reduced by extreme temperatures (15 and 30 °C, and was obtained at 25 °C with 35,9 nymphs/female. Females maintained in Yellow Snowdon cultivar significantly showed superiority (30,7 nymphs/female in total fecundity in relation to White Reagan (22,1 nymphs/female and Dark S. Reagan (22,9 nymphs/female. The Yellow Snowdon cultivar (with a lower trichome density had a significant influence in daily and total capacity of nymphs production, showing a higher fecundity of A. gossypii females. The aphid's longevity was affected by cultivars and temperature, and this longevity decreased whit increase of temperature. The results showed that there was an interaction between the temperature and host plant on reproductive parameters of A. gossypii.

  19. Effect of silicon and acibenzolar-s-methyl on colored cotton plants infested or not with Aphis gossypii Glover (Hemiptera, Aphididae

    Directory of Open Access Journals (Sweden)

    Eliana Alcantra

    2011-06-01

    Full Text Available Effect of silicon and acibenzolar-s-methyl on colored cotton plants infested or not with Aphis gossypii Glover (Hemiptera, Aphididae. The aphid Aphis gossypii is an insect pest that causes damage mainly at the beginning of the cotton plant development. The effect of resistance inductors silicon and acibenzolar-s-methyl (ASM on the development of colored cotton plants were researched in the presence and absence of A. gossypii. Three colored cotton cultivars were sown in pots and individually infested with 25 apterous aphids, 13 days after the application of the inductors. Fifteen days after plant emergence, the silicon was applied at a dosage equivalent to 3 t/ha and acibenzolar-s-methyl in 0.2% solution of the product BION 500®. After 21 days of infestation the following parameters were evaluated: plant height, stem diameter, dry matter of aerial part and root, and total number of aphids replaced. It was verified that the plant height was reduced in the presence of aphids and all variables were negatively affected by the application of ASM. However, silicon did not affect plant development.

  20. Effect of silicon and acibenzolar-s-methyl on colored cotton plants infested or not with Aphis gossypii Glover (Hemiptera, Aphididae

    Directory of Open Access Journals (Sweden)

    Eliana Alcantra

    2011-06-01

    Full Text Available Effect of silicon and acibenzolar-s-methyl on colored cotton plants infested or not with Aphis gossypii Glover (Hemiptera, Aphididae. The aphid Aphis gossypii is an insect pest that causes damage mainly at the beginning of the cotton plant development. The effect of resistance inductors silicon and acibenzolar-s-methyl (ASM on the development of colored cotton plants were researched in the presence and absence of A. gossypii. Three colored cotton cultivars were sown in pots and individually infested with 25 apterous aphids, 13 days after the application of the inductors. Fifteen days after plant emergence, the silicon was applied at a dosage equivalent to 3 t/ha and acibenzolar-s-methyl in 0.2% solution of the product BION 500®. After 21 days of infestation the following parameters were evaluated: plant height, stem diameter, dry matter of aerial part and root, and total number of aphids replaced. It was verified that the plant height was reduced in the presence of aphids and all variables were negatively affected by the application of ASM. However, silicon did not affect plant development.Efeito do silício e do acibenzolar-s-methyl em plantas de algodão colorido infestadas ou não com Aphis gossypii Glover (Hemiptera, Aphididae. O pulgão Aphis gossypii é um inseto-praga que causa danos principalmente no início do ciclo do algodoeiro. Foram pesquisados os efeitos dos indutores silício e acibenzolar-s-methyl (ASM no desenvolvimento de plantas de algodão colorido, na presença e ausência de A. gossypii. Três cultivares de algodão colorido foram semeadas em vasos e individualmente infestadas com 25 pulgões ápteros, 13 dias após a aplicação dos indutores. Quinze dias após emergência das plantas o silício foi aplicado na dosagem equivalente a 3 t/ha e o acibenzolar-s-methyl (ASM na solução 0,2% do produto BION 500®. Após 21 dias da infestação foram avaliados os seguintes parâmetros: altura da planta, diâmetro do caule

  1. Antibiosis and antixenosis to Aphis gossypii (Homoptera: Aphididac) in Colocasia esculenta.

    Science.gov (United States)

    Coleson, Jenifer L; Miller, Ross H

    2005-06-01

    Fifty cultivars of taro, Colocasia esculenta (L.) Schott (Araceae), collected from islands in Micronesia and Polynesia, eight cultivars from the University of Hawaii's taro germplasm collection, and a closely related aroid, Xanthosorna sagittifolium (L.) (Araceae), were screened for antibiosis and antixenosis to Aphis gossypii Clover. Life history data for A. gossypii were collected by assessing survivorship and fecundity of aphids caged on taro leaves in the field. Significant differences in aphid reproductive rate and longevity were observed among the taro cultivars, and cultivars were ranked from most resistant to most susceptible. Antixenosis was assayed in the laboratory in a multiround choice test where A. gossypii were offered four leaf discs excised from different taro cultivars. Additionally, field observations of aphid abundance on taro cultivars were made to corroborate clip cage studies and laboratory experiments. 'Iliuaua','Rumung Mary','Maria', 'Ketan 36', and'Agaga' were the most resistant in terms of reducing aphid fecundity and survivorship, whereas the Iliuana,'Purple', 'TC-83001', and 'Putih 24' were least preferred in aphid choice tests. X. sagittifolium consistently exhibited strong aphid resistance. Resistant cultivars identified in this study may form the basis of breeding programs seeking to combine aphid resistance with other desirable agronomic traits in taro.

  2. Effects of nitrogen fertilization in cotton crop on Aphis gossypii Glover (Hemiptera: Aphididae) biology; Efeitos da adubacao nitrogenada em algodoeiro sobre a biologia de Aphis gossypii Glover (Hemiptera: Aphididae)

    Energy Technology Data Exchange (ETDEWEB)

    Barros, Ricardo; Degrande, Paulo E.; Fernandes, Marcos G.; Nogueira, Rodrigo F. [Universidade Federal da Grande Dourados, MS (Brazil). Faculdade de Ciencias Agrarias]. E-mail: rbarrosufms@yahoo.com.br, degrande@ufgd.edu.br

    2007-09-15

    The cotton aphid, Aphis gossypii Glove, is one of the pests of cotton crop and its relation with the host seem to depend on the amount of nitrogen available to the plant. The biology of A. gossypii using different cotton nitrogen fertility regimes was studied under greenhouse conditions, in Dourados, MS. A completely randomized design with nine replications in a factorial scheme (2x4x2)+1 was used. Two nitrogen sources (sulphate of ammonium and urea), four doses of nitrogen (50, 100, 150 and 200 kg ha-1), two different times of nitrogen application and one additional treatment without nitrogen were taken as factors. The nymphal phases, the pre-reproductive, reproductive and pos-reproductive periods, longevity, the life cycle and fecundity of the cotton aphid were evaluated. The doses of nitrogen influenced the cotton aphid biology in both sources and times of application, favoring its development and fecundity. (author)

  3. Factors affecting colonization and abundance of Aphis gossypii glover (hemiptera: aphididae on okra plantations Fatores que afetam a colonização e abundância de Aphis gossypii glover (Hemiptera: Aphididae em plantações de quiabeiro

    Directory of Open Access Journals (Sweden)

    Germano Leão Demolin Leite

    2007-04-01

    Full Text Available The control of Aphis gossypii Glover (Hemiptera: Aphididae on okra Abelmoschus esculentus (L. (Malvaceae consist primarily in the use of insecticides, due to the lack of information on other mortality factors. The objective of this study was to determine the effects of predators and parasitoids, height of canopy, plant age, leaf areas, organic compounds leaves, levels of leaf nitrogen and potassium, density of leaf trichomes, total rainfall and median temperature on attack intensity of A. gossypii on two successive A. esculentus var. Santa Cruz plantations. Monthly number estimates of A. gossypii and natural enemies (visual inspection occurred on bottom, middle and apical parts of 30 plants/plantation (one leaf/plant. Plants senescence, leaf areas and natural enemies, mainly Adialytus spp., spiders and Coccinellidae, were some of the factors that most contributed to aphid reduction. A higher number of aphids was found on the bottom part than medium and apical parts of okra plants. Total rainfall can reduce the aphid population. Trichomes non-glandular or low density, organic compounds leaves and levels of N and K were not important for reducing aphid population.O controle de Aphis gossypii Glover (Hemiptera: Aphididae em quiabeiro Abelmoschus esculentus (L. (Malvaceae consiste principalmente no uso de inseticidas, em virtude da falta de informação sobre outros fatores de mortalidade. Objetivou-se com este estudo determinar os efeitos de predadores e parasitóides, altura de dossel, idade da planta, área foliar, compostos orgânicos foliares, níveis de nitrogênio e potássio, densidade de tricomas, pluviosidade e temperatura na intensidade de ataque de A. gossypii em dois cultivos sucessivos de Abelmoschus esculentus var. Santa Cruz. Estimou-se, mensalmente, o número de A. gossypii e de inimigos naturais (inspeção visual ocorridos nas folhas (uma folha/planta localizadas nas partes basal, mediana e apical de 30 plantas/plantação. Os

  4. Both point mutations and low expression levels of the nicotinic acetylcholine receptor β1 subunit are associated with imidacloprid resistance in an Aphis gossypii (Glover) population from a Bt cotton field in China.

    Science.gov (United States)

    Chen, Xuewei; Li, Fen; Chen, Anqi; Ma, Kangsheng; Liang, Pingzhuo; Liu, Ying; Song, Dunlun; Gao, Xiwu

    2017-09-01

    Aphis gossypii Glover is a destructive pest of numerous crops throughout the world. Although the expansion of Bt cotton cultivation has helped to control some insect pests, the damage from cotton aphids has not been mitigated. The evolution of aphid resistance to imidacloprid has made its chemical control more difficult since its introduction in 1991. Field populations of A. gossypii that were collected from different transgenic (Bt) cotton planting areas of China in 2014 developed different levels of resistance to imidacloprid. The IMI_R strain has developed high resistance to imidacloprid with the resistance ratio >1200-fold. Compared with the susceptible IMI_S strain, the IMI_R strain also developed a high level cross resistance to sulfoxaflor and acetamiprid. The limited synergism with either PBO or DEF suggests that resistance may be due to the site mutation of molecular target rather than to enhanced detoxification. Three target-site mutations within the nicotinic acetylcholine receptor (nAChR) β1 subunit were detected in the IMI_R strain. The R81T mutation has been reported to be responsible for imidacloprid resistance in A. gossypii and M. persicae. Both V62I and K264E were first detected in A. gossypii. These point mutations are also present in field populations, suggesting that they play a role in the resistance to imidacloprid. Furthermore, the expression level of transcripts encoding β1 subunit was decreased significantly in the IMI_R strain compared with the IMI_S strain, suggesting that both point mutations and the down-regulation of nAChR β1 subunit expression may be involved in the resistance mechanism for imidacloprid in A. gossypii. These results should be useful for the management of imidacloprid-resistant cotton aphids in Bt cotton fields in China. Copyright © 2016 Elsevier B.V. All rights reserved.

  5. Molecular and morphological differentiation between Aphis gossypii Glover (Hemiptera, Aphididae) and related species, with particular reference to the North American Midwest

    OpenAIRE

    Lagos-Kutz,Doris; Favret,Colin; Giordano,Rosanna; Voegtlin,David

    2014-01-01

    Abstract The cotton aphid, Aphis gossypii , is one of the most biologically diverse species of aphids; a polyphagous species in a family where most are host specialists. It is economically important and belongs to a group of closely related species that has challenged aphid taxonomy. The research presented here seeks to clarify the taxonomic relationships and status of species within the Aphid gossypii group in the North American Midwest. Sequences of the mitochondrial cytochrome oxidase 1 (C...

  6. Distribuição espacial de Aphis gossypii (Glover (Hemiptera, Aphididae e Bemisia tabaci (Gennadius biótipo B (Hemiptera, Aleyrodidae em algodoeiro Bt e não-Bt Spatial distribution of Aphis gossypii (Glover (Hemiptera, Aphididae and Bemisia tabaci (Gennadius biotype B (Hemiptera, Aleyrodidae on Bt and non-Bt cotton

    Directory of Open Access Journals (Sweden)

    Tatiana Rojas Rodrigues

    2010-03-01

    Full Text Available Distribuição espacial de Aphis gossypii (Glover (Hemiptera, Aphididae e Bemisia tabaci (Gennadius biótipo B (Hemiptera, Aleyrodidae em algodoeiro Bt e não-Bt. O estudo da distribuição espacial de adultos de Bemisia tabaci e de Aphis gossypii nas culturas do algodoeiro Bt e não-Bt é fundamental para a otimização de técnicas de amostragens, além de revelar diferenças de comportamento de espécies não-alvo dessa tecnologia Bt entre as duas cultivares. Nesse sentido, o experimento buscou investigar o padrão da distribuição espacial dessas espécies de insetos no algodoeiro convencional não-Bt e no cultivar Bt. As avaliações ocorreram em dois campos de 5.000 m² cada, nos quais se realizou 14 avaliações com contagem de adultos da mosca-branca e colônias de pulgões. Foram calculados os índices de agregação (razão variância/média, índice de Morisita e Expoente k da Distribuição Binomial Negativa e realizados os testes ajustes das classes numéricas de indivíduos encontradas e esperadas às distribuições teóricas de freqüência (Poisson, Binomial Negativa e Binomial Positiva. Todas as análises mostraram que, em ambas as cultivares, a distribuição espacial de B. tabaci ajustou-se a distribuição binomial negativa durante todo o período analisado, indicando que a cultivar transgênica não influenciou o padrão de distribuição agregada desse inseto. Já com relação às análises para A. gossypii, os índices de agregação apontaram distribuição agregada nas duas cultivares, mas as distribuições de freqüência permitiram concluir a ocorrência de distribuição agregada apenas no algodoeiro convencional, pois não houve nenhum ajuste para os dados na cultivar Bt. Isso indica que o algodão Bt alterou o padrão normal de dispersão dos pulgões no cultivo.The study of spatial distribution of the adults of Bemisia tabaci and the colonies of Aphis gossypii on Bt and non-Bt cotton crop is fundamental for

  7. The Joint Action of Destruxins and Botanical Insecticides (Rotenone, Azadirachtin and Paeonolum Against the Cotton Aphid, Aphis gossypii Glover

    Directory of Open Access Journals (Sweden)

    Meiying Hu

    2012-06-01

    Full Text Available The joint action of destruxins and three botanical insecticides, rotenone (Rot, azadirachtin (Aza and paeonolum (Pae against the cotton aphid, Aphis gossypii, was bioassayed. In laboratory experiment, several synergistic groups of destruxins with botanical insecticides were found by means of Sun’s Co-toxicity Coefficients (CTC and Finney’s Synergistic Coefficient (SC. The best synergistic effect was discovered in the ratio group Des/Rot 1/9 with the CTC or SC and LC50 values of 479.93 or 4.8 and 0.06 μg/mL, respectively. The second and third synergistic effects were recorded in the ratio groups Des/Rot 7/3 and 9/1. Although the ratio groups Des/Aza 6/4, Des/Pae 4/6, 3/7 and 2/8 indicated synergism by Sun’s CTC, they were determined as additive actions by Finney’s SC. Additive actions were also found in most of the ratio groups, but antagonism were recorded only in three ratio groups: Des/Pae 9/1, 7/3 and 6/4. In greenhouse tests, the highest mortality was 98.9% with the treatment Des/Rot 1/9 at 0.60 μg/mL, meanwhile, the treatments Des/Pae 4/6 and Des/Aza 6/4 had approximately 88% mortality.

  8. Host Races of the Cotton Aphid, Aphis gossypii, in Asexual Populations from Wild Plants of Taro and Brinjal

    Science.gov (United States)

    Agarwala, B.K.; Choudhury, Parichita Ray

    2013-01-01

    Worldwide, several studies have shown that adaptation to different host plants in phytophagous insects can promote speciation. The cotton aphid, Aphis gossypii Glover (Homoptera: Aphididae: Aphidini), is a highly polyphagous species, but its populations increase by parthenogenetic reproduction alone in Indian subcontinent. This study showed that genotypes living in wild plants of taro, Colocasia esculenta var. esculenta (L.) Schott (Alismatales: Araceae), and brinjal, Solanum torvum Swartz (Solanales: Solanaceae), behave as distinct host races. Success rates of colonization after reciprocal host transfers were very poor. Clones of A. gossypii from wild taro partly survived in the first generation when transferred to wild brinjal, but nymph mortality was 100% in the second generation. In contrast, brinjal clones, when transferred to taro, could not survive even in the first generation. Significant differences between the clones from two host species were also recorded in development time, generation time, fecundity, intrinsic rate of increase, net reproductive rate, and mean relative growth rate. Morphologically, aphids of wild taro clones possessed longer proboscis and fore-femora than the aphids of the brinjal clones. The results showed that A. gossypii exists as distinct host races with different abilities of colonizing host plants, and its populations appear to have more potential of sympatic evolution than previously regarded. PMID:23895554

  9. Host races of the cotton aphid, Aphis gossypii, in asexual populations from wild plants of taro and brinjal.

    Science.gov (United States)

    Agarwala, B K; Choudhury, Parichita Ray

    2013-01-01

    Worldwide, several studies have shown that adaptation to different host plants in phytophagous insects can promote speciation. The cotton aphid, Aphis gossypii Glover (Homoptera: Aphididae: Aphidini), is a highly polyphagous species, but its populations increase by parthenogenetic reproduction alone in Indian subcontinent. This study showed that genotypes living in wild plants of taro, Colocasia esculenta var. esculenta (L.) Schott (Alismatales: Araceae), and brinjal, Solanum torvum Swartz (Solanales: Solanaceae), behave as distinct host races. Success rates of colonization after reciprocal host transfers were very poor. Clones of A. gossypii from wild taro partly survived in the first generation when transferred to wild brinjal, but nymph mortality was 100% in the second generation. In contrast, brinjal clones, when transferred to taro, could not survive even in the first generation. Significant differences between the clones from two host species were also recorded in development time, generation time, fecundity, intrinsic rate of increase, net reproductive rate, and mean relative growth rate. Morphologically, aphids of wild taro clones possessed longer proboscis and fore-femora than the aphids of the brinjal clones. The results showed that A. gossypii exists as distinct host races with different abilities of colonizing host plants, and its populations appear to have more potential of sympatic evolution than previously regarded.

  10. Identification of semiochemicals released by cotton, Gossypium hirsutum, upon infestation by the cotton aphid, Aphis gossypii.

    Science.gov (United States)

    Hegde, Mahabaleshwar; Oliveira, Janser N; da Costa, Joao G; Bleicher, Ervino; Santana, Antonio E G; Bruce, Toby J A; Caulfield, John; Dewhirst, Sarah Y; Woodcock, Christine M; Pickett, John A; Birkett, Michael A

    2011-07-01

    The cotton aphid, Aphis gossypii (Homoptera: Aphididae), is increasing in importance as a pest worldwide since the introduction of Bt-cotton, which controls lepidopteran but not homopteran pests. The chemical ecology of interactions between cotton, Gossypium hirsutum (Malvaceae), A. gossypii, and the predatory lacewing Chrysoperla lucasina (Neuroptera: Chrysopidae), was investigated with a view to providing new pest management strategies. Behavioral tests using a four-arm (Pettersson) olfactometer showed that alate A. gossypii spent significantly more time in the presence of odor from uninfested cotton seedlings compared to clean air, but significantly less time in the presence of odor from A. gossypii infested plants. A. gossypii also spent significantly more time in the presence of headspace samples of volatile organic compounds (VOCs) obtained from uninfested cotton seedlings, but significantly less time with those from A. gossypii infested plants. VOCs from uninfested and A. gossypii infested cotton seedlings were analyzed by gas chromatography (GC) and coupled GC-mass spectrometry (GC-MS), leading to the identification of (Z)-3-hexenyl acetate, (E)-4,8-dimethyl-1,3,7-nonatriene (DMNT), methyl salicylate, and (E,E)-4,8,12-trimethyl-1,3,7,11-tridecatetraene (TMTT), which were produced in larger amounts from A. gossypii infested plants compared to uninfested plants. In behavioral tests, A. gossypii spent significantly more time in the control (solvent) arms when presented with a synthetic blend of these four compounds, with and without the presence of VOCs from uninfested cotton. Coupled GC-electroantennogram (EAG) recordings with the lacewing C. lucasina showed significant antennal responses to VOCs from A. gossypii infested cotton, suggesting they have a role in indirect defense and indicating a likely behavioral role for these compounds for the predator as well as the aphid.

  11. Status Of Cotton Aphid, Aphis gssypiiGlover (Homoptera ...

    African Journals Online (AJOL)

    They call for a strict national effort to regulate the influx of pesticides on the market, and ensure safe insecticide types and usage, as well as manage resistance in all concerned major insect pests. Les caractéristiques de répartition en groupes électrophorétiques et les analyses quantitatives de carboxylestérases de l'aphidé ...

  12. Evaluation du potentiel insecticide de l'huile essentielle de Ocimum ...

    African Journals Online (AJOL)

    Evaluation du potentiel insecticide de l'huile essentielle de Ocimum canum Sims sur Aphis gossypii Glover (Homoptera : Aphididae) au Togo. PK Akantetou, K Koba, AY Nenonene, WP Poutouli, C Raynaud, K Sanda ...

  13. Molecular characterization of the Aphis gossypii olfactory receptor gene families.

    Directory of Open Access Journals (Sweden)

    Depan Cao

    Full Text Available The cotton aphid, Aphis gossypii Glover, is a polyphagous pest that inflicts great damage to cotton yields worldwide. Antennal olfaction, which is extremely important for insect survival, mediates key behaviors such as host preference, mate choice, and oviposition site selection. In insects, odor detection is mediated by odorant receptors (ORs and ionotropic receptors (IRs, which ensure the specificity of the olfactory sensory neuron responses. In this study, our aim is to identify chemosensory receptors in the cotton aphid genome, as a means to uncover olfactory encoding of the polyphagous feeding habits as well as to aid the discovery of new targets for behavioral interference. We identified a total of 45 candidate ORs and 14 IRs in the cotton aphid genome. Among the candidate AgoORs, 9 are apparent pseudogenes, while 19 can be clustered with ORs from the pea aphid, forming 16 AgoOR/ApOR orthologous subgroups. Among the candidate IRs, we identified homologs of the two highly conserved co-receptors IR8a and IR25a; no AgoIR retain the complete glutamic acid binding domain, suggesting that putative AgoIRs bind different ligands. Our results provide the necessary information for functional characterization of the chemosensory receptors of A. gossypii, with potential for new or refined applications of semiochemicals-based control of this pest insect.

  14. Performance of the Natural Mortality Factors of Aphis gossypii (Hemiptera: Aphididae) as a Function of Cotton Plant Variety and Phenology.

    Science.gov (United States)

    Chamuene, António; Araújo, Tamíris Alves; Silva, Gerson; Costa, Thiago Leandro; Berger, Paulo Geraldo; Picanço, Marcelo Coutinho

    2018-02-07

    Natural mortality factors are responsible for regulating pest populations in the field. However, plant attributes such as the variety and phenological stage can influence the performance of these factors. Therefore, we investigated the performance of the natural mortality factors of Aphis gossypii (Glover; Hemiptera: Aphididae) as a function of the plant variety and phenology. To investigate the performance of these factors, we evaluated the mortality of A. gossypii caused by natural mortality factors for 2 yr in field conditions in transgenic (Bacillus thuringiensis/Roundup Ready) and non-transgenic cotton crops during vegetative, flowering, and fruiting stages. The natural mortality factors were affected similarly between the transgenic and non-transgenic plants; however, differences were observed in their performance, depending on the phenological stage of the cotton plant. Compared with other stages, predation was higher in the flowering stage, whereas the mortality caused by rainfall was higher in the vegetative stage. Coccinellid beetles were primarily responsible for the predation on A. gossypii. These findings highlight that the performance of the natural mortality factors of A. gossypii varied more as a function of the phenological stage of cotton than of the variety. © The Author(s) 2018. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  15. Resistance of squash cultivars to Aphis gossypii Resistência de cultivares de abobrinha italiana a Aphis gossypii

    Directory of Open Access Journals (Sweden)

    Edson LL Baldin

    2009-09-01

    Full Text Available The Cucurbitaceae plants are damaged by attack of a wide spectrum of insects and microorganisms. Among the sucker insects causing damages on squash Cucurbita pepo (L., the aphid Aphis gossypii (Glover (Hemiptera: Aphididae is pointed as one of the most important, once their nymphs and adults suck the sap of the leaves continuously, besides being potential vector of virus. The present research evaluated different cultivars, aiming to identify the resistance against this aphid. The cultivars Novita, Sandy, Caserta Cac Melhorada, Novita Plus, Samira, AF-2858 and Caserta TS were used in laboratory assays (T= 25±2ºC; RH= 70±10% and fotophase= 12 h. In the immature phase the duration of nymphal instars was evaluated, the total duration and their viability, confining individuals on leaf disks from cultivars. In the adult phase the duration of reproductive period, the fecundity and the biological cycle were observed. The cultivar 'Sandy' expressed high level of antibiosis and feeding non-preference against A. gossypii, increasing the nymphal stage and causing mortality near to 70%. Besides, this cultivar reduced the production of nymphs and the longevity of the insects. The 'Novita Plus' cultivar also induced significant nymphal mortality, however in lower levels than those verified in 'Sandy', indicating a moderate resistance.As plantas da família Cucurbitaceae são prejudicadas pelo ataque de um amplo espectro de insetos e microrganismos. Dentre os insetos sugadores que atacam a abobrinha Cucurbita pepo (L., o pulgão Aphis gossypii (Glover (Hemiptera: Aphididae merece destaque, uma vez que suas ninfas e adultos sugam a seiva das folhas constantemente, além de ser potencial vetor de vírus. A presente pesquisa foi realizada com o objetivo de avaliar diferetes cultivares de abobrinha italiana quanto à resistência a esse pulgão. Utilizaram-se as cultivares Novita, Sandy, Caserta Cac Melhorada, Novita Plus, Samira, AF-2858 e Caserta TS em ensaios

  16. 2018-02-20T22:04:06Z https://www.ajol.info/index.php/all/oai oai:ojs ...

    African Journals Online (AJOL)

    article/75931 2018-02-20T22:04:06Z ijbcs:ART Evaluation du potentiel insecticide de l'huile essentielle de Ocimum canum Sims sur Aphis gossypii Glover (Homoptera : Aphididae) au Togo Akantetou, PK Koba, K Nenonene, AY Poutouli, WP ...

  17. Separate and Combined Effects of Mentha piperata and Mentha pulegium Essential Oils and a Pathogenic Fungus Lecanicillium muscarium Against Aphis gossypii (Hemiptera: Aphididae).

    Science.gov (United States)

    Ebadollahi, Asgar; Davari, Mahdi; Razmjou, Jabrael; Naseri, Bahram

    2017-06-01

    In the present study, the toxicity of essential oils of Mentha piperata L. and Mentha pulegium L. and pathogenicity of Lecanicillium muscarium (Zare & Gams) were studied in the melon aphid, Aphis gossypii Glover. Analyses of the essential oils by GC-MS indicated limonene (27.28%), menthol (24.71%), menthone (14.01%), and carvol (8.46%) in the M. piperata essential oil and pulegone (73.44%), piperitenone (5.49%), decane (4.99%), and limonene (3.07%) in the essential oil of M. pulegium as the main components. Both essential oils and the pathogenic fungus had useful toxicity against A. gossypii. Probit analysis indicated LC50 values (lethal concentrations to kill 50% of population; 95% confidence limits in parentheses) of M. piperata and M. pulegium essential oils as 15.25 (12.25-19.56) and 23.13 (19.27-28.42) µl/liter air, respectively. Susceptibility to the pathogenic fungus increased with exposure time. Aphid mortality also increased when the essential oils were combined with L. muscarium, although the phenomena was additive rather than synergistic. Mycelial growth inhibition of L. muscarium exposed to the essential oils was also very low. Based on our results, M. piperata and M. pulegium essential oils and the pathogenic fungus L. muscarium have some potential for management of A. gossypii. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  18. The R81T mutation in the nicotinic acetylcholine receptor of Aphis gossypii is associated with neonicotinoid insecticide resistance with differential effects for cyano- and nitro-substituted neonicotinoids.

    Science.gov (United States)

    Hirata, Koichi; Jouraku, Akiya; Kuwazaki, Seigo; Kanazawa, Jun; Iwasa, Takao

    2017-11-01

    The cotton aphid, Aphis gossypii Glover, is one of the most agriculturally important insect pests. Neonicotinoid insecticides and sulfoxaflor have generally shown excellent control of A. gossypii, but these aphids have recently developed resistance against neonicotinoid insecticides. We previously characterized a field-collected A. gossypii Kushima clone that showed higher resistance to nitro-substituted neonicotinoids, such as imidacloprid, than to cyano-substituted neonicotinoids, such as acetamiprid. This Kushima clone harbors the R81T mutation in the nicotinic acetylcholine receptor (nAChR) β1 subunit; this mutation is the source of neonicotinoid insecticide resistance. In the present study, electrophysiological analyses and molecular modeling were employed to investigate the differential effects of the R81T mutation on cyano- and nitro-substituted neonicotinoids and sulfoxaflor. We isolated full-length coding sequences of A. gossypii nAChR α1, α2, and β1 subunits. When co-expressed in Xenopus laevis oocytes with chicken β2 nAChR, A. gossypii α1 evoked inward currents in a concentration-dependent manner in response to acetylcholine (ACh) and showed sensitivity to neonicotinoid and sulfoxaflor. Additionally, the chicken β2 T77R+E79V (equivalent double mutant of R81T) mutation resulted in a lower effect to cyano-substituted neonicotinoids and sulfoxaflor than to nitro-substituted neonicotinoids. Electrophysiological data and nAChR homology modeling analysis suggested that the Kushima clone exhibited different levels of resistance to cyano- and nitro-substituted neonicotinoid insecticides. Copyright © 2017 Elsevier Inc. All rights reserved.

  19. Susceptibilities of two populations of Aphis gossiper Glover to ...

    African Journals Online (AJOL)

    user

    2011-01-24

    Jan 24, 2011 ... Two populations of Aphis gossypii were collected from cotton and melon crops treated with insecticides to control this aphid species. The susceptibility of both aphid populations to pymetrozine,. Pirimicarb, Oxydemeton-methyl and Imidacloprid was evaluated using leaf deep bioassays in. Laboratory which ...

  20. Susceptibilities of two populations of Aphis gossiper Glover to ...

    African Journals Online (AJOL)

    Two populations of Aphis gossypii were collected from cotton and melon crops treated with insecticides to control this aphid species. The susceptibility of both aphid populations to pymetrozine, Pirimicarb, Oxydemeton-methyl and Imidacloprid was evaluated using leaf deep bioassays in Laboratory which were commonly ...

  1. Spread of the spiraling white fly Aleurodicus dispersus (Homoptera ...

    African Journals Online (AJOL)

    Spread of the spiraling white fly Aleurodicus dispersus (Homoptera: Aleyrodidae) and its parasitoids Encarcia species (Hymenoptera: Aphelinidae) on horticultural plants in Northwest and Central Nigeria.

  2. Interspecific Associations between Cycloneda sanguinea and Two Aphid Species (Aphis gossypii and Hyadaphis foeniculi) in Sole-Crop and Fennel-Cotton Intercropping Systems.

    Science.gov (United States)

    Fernandes, Francisco S; Ramalho, Francisco S; Malaquias, José B; Godoy, Wesley A C; Santos, Bárbara Davis B

    2015-01-01

    Aphids cause significant damage to crop plants. Studies regarding predator-prey relationships in fennel (Foeniculum vulgare Mill.) and cotton (Gossypium hirsutum L.) crops are important for understanding essential ecological interactions in the context of intercropping and for establishing pest management programs for aphids. This study evaluated the association among Hyadaphis foeniculi (Passerini) (Hemiptera: Aphididae), Aphis gossypii Glover (Hemiptera: Aphididae) and Cycloneda sanguinea (L.) (Coleoptera: Coccinellidae) in cotton with coloured fibres, fennel and cotton intercropped with fennel. Association analysis was used to investigate whether the presence or absence of prey and predator species can indicate possible interactions between aphids and ladybugs. Significant associations among both apterous and alate H. foeniculi and C. sanguinea were observed in both the fennel and fennel-cotton intercropping systems. The similarity analysis showed that the presence of aphids and ladybugs in the same system is significantly dependent on the type of crop. A substantial amount of evidence indicates that the presence of the ladybug C. sanguinea, is associated with apterous or alate A. gossypii and H. foeniculi in fennel-cotton intercropping system. We recommend that future research vising integrated aphid management taking into account these associations for take decisions.

  3. Molecular Mechanisms Regulating Sporulation in the Filamentous Fungus Ashbya gossypii

    DEFF Research Database (Denmark)

    Wasserstrom, Lisa

    , which is regulated by the pheromone response pathway. Most ascomycetes have been reported to produce meiotic spores, however, a sexual cycle has not yet been identified in the filamentous fungus Ashbya gossypii. The main focus of my doctoral thesis has therefore been to understand the mechanisms behind...... sporulation in this fungus.  The lifecycle of A. gossypii starting with a haploid spore that matures into spore-containing mycelia can be completed without the need for a mating partner. Spores in A. gossypii are thought to be derived sexually like all other Saccharomycetaceae species, but the sexual cycle...... suggesting that other proteins generate DSBs in this fungus. In summary, this work has led to better understanding of the components regulating sporulation in A. gossypii and their hierarchical organization....

  4. Demography and Mass-Rearing Harmonia dimidiata (Coleoptera: Coccinellidae) Using Aphis gossypii (Hemiptera: Aphididae) and Eggs of Bactrocera dorsalis (Diptera: Tephritidae).

    Science.gov (United States)

    Yu, Jih-Zu; Chen, Bing Huei; Güncan, Ali; Atlihan, Remzi; Gökçe, Ayhan; Smith, Cecil L; Gümüs, Ebru; Chi, Hsin

    2018-04-02

    We compared rearing Harmonia dimidiata (F.) (Coleoptera: Coccinellidae) on four combinations of Aphis gossypii Glover (Hemiptera: Aphididae), and eggs of Bactrocera dorsalis Hendel (Diptera: Tephritidae), using the age-stage, two-sex life table. The four combinations were: both larvae and adults were reared on aphids; larvae were reared on aphids and adults were reared on fresh fruit fly eggs; larvae were reared on lyophilized fruit fly eggs and adults were reared on aphids; and larvae were reared on lyophilized eggs and adults were reared on fresh eggs. The highest intrinsic rate of increase (r = 0.1125 d-1) and net reproductive rate (R0 = 260.7 offspring) were observed when both larval and adult stages of H. dimidiata were reared on A. gossypii. When B. dorsalis eggs were used as rearing media for larvae, adults, or both, the values of r and R0 were significantly decreased. The lowest values (r = 0.0615 d-1 and R0 = 38.6 offspring) were observed when both larvae and adults were reared entirely on B. dorsalis eggs. Despite the lower r and R0 values, our results showed that B. dorsalis eggs could be considered as an adequate, less expensive alternative diet for rearing H. dimidiata because of the time and labor savings resulting from the ease of preparation and the ability to store the eggs for timely usage. The mass-rearing analysis showed that the most economical rearing system was to rear larvae on A. gossypii and adults on B. dorsalis eggs.

  5. Nano-formulation enhances insecticidal activity of natural pyrethrins against Aphis gossypii (Hemiptera: Aphididae) and retains their harmless effect to non-target predators.

    Science.gov (United States)

    Papanikolaou, Nikos E; Kalaitzaki, Argyro; Karamaouna, Filitsa; Michaelakis, Antonios; Papadimitriou, Vassiliki; Dourtoglou, Vassilis; Papachristos, Dimitrios P

    2018-04-01

    The insecticidal activity of a new nano-formulated natural pyrethrin was examined on the cotton aphid, Aphis gossypii Glover (Hemiptera: Aphididae), and the predators Coccinella septempunctata L. (Coleoptera: Coccinellidae) and Macrolophus pygmaeus Rambur (Hemiptera: Miridae), in respect with the nano-scale potential to create more effective and environmentally responsible pesticides. Pyrethrin was nano-formulated in two water-in-oil micro-emulsions based on safe biocompatible materials, i.e., lemon oil terpenes as dispersant, polysorbates as stabilizers, and mixtures of water with glycerol as the dispersed aqueous phase. Laboratory bioassays showed a superior insecticidal effect of the pyrethrin micro-emulsions compared to two commercial suspension concentrates of natural pyrethrins against the aphid. The nano-formulated pyrethrins were harmless, in terms of caused mortality and survival time, to L3 larvae and four-instar nymphs of the predators C. septempunctata and M. pygmaeus, respectively. We expect that these results can contribute to the application of nano-technology in optimization of pesticide formulation, with further opportunities in the development of effective plant protection products compatible with integrated pest management practices.

  6. Toxicity of pymetrozine and thiamethoxam to Aphelinus gossypii and Delphastus pusillus Toxicidade de pimetrozine e tiametoxam a Aphelinus gossypii e Delphastus pusillus

    OpenAIRE

    Jorge Braz Torres; Christian Sherley Araujo Silva-Torres; José Vargas de Oliveira

    2003-01-01

    The objective of this work was to study the toxicity of pymetrozine and thiamethoxam to the cotton aphid parasitoid Aphelinus gossypii Timberlake and to the whitefly predator Delphastus pusillus (LeConte). Cotton leaves containing mummies of the parasitoid A. gossypii were collected and treated with seven concentrations of both insecticides. Parasitoid emergence was not affected by pymetrozine and ranged from 59.9% to 75.0%, but decreased with the increase of thiamethoxam concentrations rangi...

  7. The Vat locus encodes for a CC-NBS-LRR protein that confers resistance to Aphis gossypii infestation and A. gossypii-mediated virus resistance.

    Science.gov (United States)

    Dogimont, Catherine; Chovelon, Veronique; Pauquet, Jerome; Boualem, Adnane; Bendahmane, Abdelhafid

    2014-12-01

    Aphis gossypii is a polyphagous sucking aphid and a vector for many viruses. In Cucumis melo, a dominant locus, Vat, confers a high level of resistance to Aphis gossypii infestation and to viruses transmitted by this vector. To investigate the mechanism underlying this double resistance, we first genetically dissected the Vat locus. We delimited the double resistance to a single gene that encodes for a coiled-coil-nucleotide-binding-site-leucine-rich repeat (CC-NBS-LRR) protein type. To validate the genetic data, transgenic lines expressing the Vat gene were generated and assessed for the double resistance. In this analysis, Vat-transgenic plants were resistant to A. gossypii infestation as well as A. gossypii-mediated virus transmission. When the plants were infected mechanically, virus infection occurred on both transgenic and non-transgenic control plants. These results confirmed that the cloned CC-NBS-LRR gene mediates both resistance to aphid infestation and virus infection using A. gossypii as a vector. This resistance also invokes a separate recognition and response phases in which the recognition phase involves the interaction of an elicitor molecule from the aphid and Vat from the plant. The response phase is not specific and blocks both aphid infestation and virus infection. Sequence analysis of Vat alleles suggests a major role of an unusual conserved LRR repeat in the recognition of A. gossypii. © 2014 The Authors The Plant Journal © 2014 John Wiley & Sons Ltd.

  8. Evolutionary aspects of acoustic communication in Ribautodelphax planthoppers (Homoptera, Delphacidae)

    NARCIS (Netherlands)

    Winter, de A.J.

    1994-01-01

    Delphacidae (Homoptera), commonly referred to as planthoppers, are herbivores, which usually feed on grasses and sedges. During sexual behaviour males and females communicate by exchanging low-frequency vibrational signals, which are transmitted through the substrate, normally the host

  9. Hábito de crescimento de Colletotrichum gossypii e C. gossypii var. Cephalosporioides em sementes de algodoeiro Growth habit of Colletotrichum gossypii and C. Gossypii var. Cephalosporioides on cotton seeds

    Directory of Open Access Journals (Sweden)

    Maria Aparecida de Souza Tanaka

    1996-01-01

    Full Text Available Observações sobre o hábito de crescimento de Colletotrichum gossypii e C. gossypii var. cephalosporioides em sementes de algodoeiro, inoculadas artificialmente e incubadas a 20-22°C durante cinco a sete dias, evidenciaram as seguintes características: (a em raízes: acérvulos isolados ou em grupos, massa conidial cor branco-suja, alaranjada ou salmão (mais freqüente, setas marrom-escuras, muitas vezes encobertas pela matriz gelatinosa; conídios produzidos também no micélio aéreo ou nas extremidades das setas, onde ficam aderidos, formando pequenos aglomerados; (b na superfície das sementes: conídios produzidos nos ápices de setas que emergem diretamente do tegumento, ficando aderidos uns aos outros, formando cachos, semelhantes a cadeias, que são vistos brilhantes sob a luz, em estereomicroscópio. As setas férteis são formadas também no micélio aéreo que recobre as sementes, geralmente após cinco dias de incubação. Os acérvulos com massa conidial raramente são visíveis, exceto em sementes danificadas ou mortas. Como característica de C. gossypii, observou-se que as sementes exibem, de modo geral, uma coloração rosada, em decorrência da abundante esporulação; a ausência ou escassez de micélio aéreo e as setas curtas resultam em um crescimento rente ao tegumento e aspecto compacto. Comparativamente, nas sementes com C. gossypii var. cephalosporioides, as setas são mais longas e menos densas; o micélio aéreo com setas férteis ocorre com mais freqüência, conferindo às sementes tonalidades acinzentadas e aspecto solto. A constatação de setas férteis em lesões foliares de ramulose evidencia que, no campo, essas estruturas podem funcionar como autênticos conidióforos, desempenhando um importante papel epidemiológico, ao possibilitar a disseminação dos esporos pelos ventos, a longas distâncias.The growth habit of Colletotrichum gossypii and C. gossypii var. cephalosporioides on artificially

  10. Molecular Mechanisms Regulating Sporulation in the Filamentous Fungus Ashbya gossypii

    DEFF Research Database (Denmark)

    Wasserstrom, Lisa

    , which is regulated by the pheromone response pathway. Most ascomycetes have been reported to produce meiotic spores, however, a sexual cycle has not yet been identified in the filamentous fungus Ashbya gossypii. The main focus of my doctoral thesis has therefore been to understand the mechanisms behind...... remains unidentified. In this thesis I provide a comprehensive functional analysis of genes important for sporulation in A. gossypii. Previous results, together with findings presented in this work show that the role of the pheromone response pathway in A. gossypii has been rewired to regulate sporulation...... recombination that allows cross-over between homologous chromosomes. In S. cerevisiae, this requires double strand break (DSB) formation and subsequent repair via the components Spo11 and Dmc1. The work in this thesis show that the A. gossypii Spo11 and Dmc1 homologs are not required for sporulation, thus...

  11. Toxicity of pymetrozine and thiamethoxam to Aphelinus gossypii and Delphastus pusillus

    OpenAIRE

    Torres,Jorge Braz; Silva-Torres,Christian Sherley Araujo; Oliveira,José Vargas de

    2003-01-01

    The objective of this work was to study the toxicity of pymetrozine and thiamethoxam to the cotton aphid parasitoid Aphelinus gossypii Timberlake and to the whitefly predator Delphastus pusillus (LeConte). Cotton leaves containing mummies of the parasitoid A. gossypii were collected and treated with seven concentrations of both insecticides. Parasitoid emergence was not affected by pymetrozine and ranged from 59.9% to 75.0%, but decreased with the increase of thiamethoxam concentrations rangi...

  12. Blockage of the pyrimidine biosynthetic pathway affects riboflavin production in Ashbya gossypii.

    Science.gov (United States)

    Silva, Rui; Aguiar, Tatiana Q; Domingues, Lucília

    2015-01-10

    The Ashbya gossypii riboflavin biosynthetic pathway and its connection with the purine pathway have been well studied. However, the outcome of genetic alterations in the pyrimidine pathway on riboflavin production by A. gossypii had not yet been assessed. Here, we report that the blockage of the de novo pyrimidine biosynthetic pathway in the recently generated A. gossypii Agura3 uridine/uracil auxotrophic strain led to improved riboflavin production on standard agar-solidified complex medium. When extra uridine/uracil was supplied, the production of riboflavin by this auxotroph was repressed. High concentrations of uracil hampered this (and the parent) strain growth, whereas excess uridine favored the A. gossypii Agura3 growth. Considering that the riboflavin and the pyrimidine pathways share the same precursors and that riboflavin overproduction may be triggered by nutritional stress, we suggest that overproduction of riboflavin by the A. gossypii Agura3 may occur as an outcome of a nutritional stress response and/or of an increased availability in precursors for riboflavin biosynthesis, due to their reduced consumption by the pyrimidine pathway. Copyright © 2014 Elsevier B.V. All rights reserved.

  13. INDUCING RESISTANCE IN COTTON AGAINST COLLETOTRICHUM GOSSYPII VAR. CEPHALOSPORIOIDES WITH ESSENTIAL OILS

    Directory of Open Access Journals (Sweden)

    B. T. Santos

    2016-11-01

    Full Text Available This study aimed to evaluate the potential of essential oils of rosemary (Rosmarinus officinalis, baccharis (Baccharis trimera, lemon grass (Cymbopogon citratus, basil (Ocimum basilicum and eucalyptus (Corymbia citriodora in inducing resistance in cotton plants against C. gossypii var. cephalosporioides. The inductive effect of the essential oils was evaluated in plants growing in pots in the environment, which were treated with 1% essential oil at 47 days of age. 24 hours after elicitor treatment the plants were inoculated with a suspension of 1.5 x 105 conidia mL-1 of C. gossypii var. cephalosporioides. Five evaluations were performed disease and calculated the area under the disease progress curve. All essential oils showed potential for inducing resistance against cotton C. gossypii var. cephalosporioides.

  14. Toxicity of pymetrozine and thiamethoxam to Aphelinus gossypii and Delphastus pusillus Toxicidade de pimetrozine e tiametoxam a Aphelinus gossypii e Delphastus pusillus

    Directory of Open Access Journals (Sweden)

    Jorge Braz Torres

    2003-04-01

    Full Text Available The objective of this work was to study the toxicity of pymetrozine and thiamethoxam to the cotton aphid parasitoid Aphelinus gossypii Timberlake and to the whitefly predator Delphastus pusillus (LeConte. Cotton leaves containing mummies of the parasitoid A. gossypii were collected and treated with seven concentrations of both insecticides. Parasitoid emergence was not affected by pymetrozine and ranged from 59.9% to 75.0%, but decreased with the increase of thiamethoxam concentrations ranging from 30.2% to 69.6%. Cotton leaves infested by whitefly and treated with recommended rates of both insecticides were collected three hours, three days and six days after spraying and colonized with larvae and adults of D. pusillus. Predators released on thiamethoxam-treated leaves experienced mortality from 70% to 100%, while those released on pymetrozine-treated leaves showed mortality from 0% to 20%. Topical toxicity from both insecticides was studied on larvae, pupae and adults of D. pusillus. The survival of predator after six days of exposure to 400, 600 and 800 mg/L of pymetrozine a.i. was higher than 69.6%, and to 25, 100 and 200 mg/L of thiamethoxam a.i. was lower than 8.7%. The toxicity data for A. gossypii and D. pusillus characterize the pymetrozine as harmless for both species, and thiamethoxam of low to moderate toxicity for A. gossypii treated mummies, and high toxicity for D. pusillus.O objetivo deste trabalho foi estudar a toxicidade de pimetrozine e tiametoxam ao parasitóide do pulgão-do-algodoeiro Aphelinus gossypii Timberlake e ao predador da mosca-branca Delphastus pusillus (LeConte. Folhas de algodoeiro contendo múmias do parasitóide A. gossypii foram coletadas e tratadas com sete concentrações de ambos inseticidas. A emergência do parasitóide não foi afetada pelo pimetrozine e variou de 59,9% a 75%, enquanto as múmias tratadas com tiametoxam produziram emergência de A. gossypii variando de 30,2% a 69,6%. Plantas infestadas

  15. National Plant Diagnostic Network, Taxonomic training videos: Aphids under the microscope - Aphis gossypii

    Science.gov (United States)

    Training is a critical part of aphid (Hemiptera: Aphididae) identification. This video provides provides training to identify the cotton aphid, Aphis gossypii, using a compound microscope and an electronic identification key called “LUCID.” The video demonstrates key morphological structures that ca...

  16. Metabolic engineering of riboflavin production in Ashbya gossypii through pathway optimization.

    Science.gov (United States)

    Ledesma-Amaro, Rodrigo; Serrano-Amatriain, Cristina; Jiménez, Alberto; Revuelta, José Luis

    2015-10-14

    The industrial production of riboflavin mostly relies on the microbial fermentation of flavinogenic microorganisms and Ashbya gossypii is the main industrial producer of the vitamin. Accordingly, bioengineering strategies aimed at increasing riboflavin production in A. gossypii are highly valuable for industry. We analyze the contribution of all the RIB genes to the production of riboflavin in A. gossypii. Two important metabolic rate-limiting steps that limit the overproduction of riboflavin have been found: first, low mRNA levels of the RIB genes hindered the overproduction of riboflavin; second, the competition of the AMP branch for purinogenic precursors also represents a limitation for riboflavin overproduction. Thus, overexpression of the RIB genes resulted in a significant increase in riboflavin yield. Moreover, both the inactivation and the underexpression of the ADE12 gene, which controls the first step of the AMP branch, also proved to have a positive effect on riboflavin production. Accordingly, a strain that combines both the overexpression of the RIB genes and the underexpression of the ADE12 gene was engineered. This strain produced 523 mg/L of riboflavin (5.4-fold higher than the wild-type), which is the highest titer of riboflavin obtained by metabolic engineering in A. gossypii so far. Riboflavin production in A. gossypii is limited by a low transcription activity of the RIB genes. Flux limitation towards AMP provides committed substrate GTP for riboflavin overproduction without detrimental effects on biomass formation. A multiple-engineered Ashbya strain that produces up to 523 mg/L of riboflavin was generated.

  17. Treehoppers (Homoptera, Membracidae in southeastern Brazil: use of host plants

    Directory of Open Access Journals (Sweden)

    Benedito C. Lopes

    1995-09-01

    Full Text Available A survey on the use of host plants by treehoppers in plants in cerrado (savanna vegetation at Moji-Guaçu (São Paulo, Southeastern Brazil was made. Fifty-two species of treehoppers were recorded in association with 40 host plant species from October 1980 to February 1982. The families Araliaceae, Asteraceae, Leguminosae, Malpighiaceae, Myrtaceae and Nyctaginaceae were the most commonly used for oviposition. Byrsonima intermedia A. Juss. (Malpighiaceae had the highest number of associated treehopper species (10 species. The abundance of treehopper individuals was related to the hot and rainy season (from October to February, while during the cold and dry season (from March to September there was a decrease in the number of these Homoptera. After the occurrence of a frost, few adults and nymphs were observed on the host plants for one to two months.

  18. Paraleyrodes minei Iaccarino 1990 (Homoptera: Aleyrodidae, new specie for Italy, on Citrus aurantium L., 1758

    Directory of Open Access Journals (Sweden)

    Fabio M. Iaccarino

    2011-04-01

    Full Text Available The nesting whitefly Paraleyrodes minei Iaccarino 1990 (Homoptera: Aleyrodidae was found on leaves of sour orange tree Citrus aurantium L., 1758, in the Gussone Park of the Faculty of Agriculture, of the U niversity of N aples “Federico II”, at Portici, Italy.

  19. Variabilidade genética entre isolados de Colletotrichum gossypii do algodoeiro Genetic variability among the isolates of Colletotrichum gossypii of cotton

    Directory of Open Access Journals (Sweden)

    Yeshwant R. Mehta

    2010-03-01

    Full Text Available O algodoeiro é atacado por Colletotrichum gossypii (CG e C. gossypii var. cephalosporioides (CGC. Ambos os patógenos são transmitidos pela semente e sua distinção morfológica é extremamente difícil e inconsistente. Tentativas foram feitas no presente trabalho para verificar a variabilidade genética entre CG e CGC através de RAPD-PCR, ERIC- e REP-PCR e PCR-RFLP da região ITS rDNA. Foram utilizados 53 isolados coletados de sementes e folhas de plantas de diferentes cultivares nos estados do Paraná, São Paulo, Mato Grosso, Minas Gerais, e Paraiba, entre 1999 e 2003. Baseado em testes de patogenicidade, vinte e um isolados foram classificados como CG e 32 como CGC. Os resultados obtidos por RAPD-PCR, utilizando-se oito primers, revelaram dois grupos distintos sendo que o primeiro foi formado por 94% dos isolados de sementes e o segundo por 95% dos isolados de folhas. Na análise de ERIC- e REP-PCR, resultados semelhantes a RAPD foram obtidos, sendo que o primeiro grupo foi formado por 93% dos isolados provenientes das sementes e o segundo por 78% dos isolados provenientes das folhas. Quando o produto de amplificação da região ITS rDNA foi digerido com oito enzimas de restrição, um perfil de bandas semelhante para todos os isolados foi obtido. Resultados de RAPD, ERIC- e REP-PCR demonstraram que existem diferenças genéticas entre os isolados provenientes das sementes e aqueles provenientes de parte aérea, e esses dois grupos foram claramente distintos. Estudos futuros devem ser realizados utilizando outras técnicas moleculares para a obtenção de marcadores capazes de distinguir entre isolados de CG e CGC.Cotton is attacked by Colletotrichum gossypii (CG and C. gossypii var. cephalosporioides (CGC. Both the pathogens are transmitted by seed and their morphological distinction is extremely difficult and inconsistent. In the present study, attempts were made to verify the genetic variability among 53 isolates of CG and CGC using

  20. Evaluation of antifungal metabolites activity from bacillus licheniformis OE-04 against Colletotrichum gossypii.

    Science.gov (United States)

    Nawaz, Hafiz Husnain; Nelly Rajaofera, M J; He, Qiguang; Anam, Usmani; Lin, Chunhua; Miao, Weiguo

    2018-04-01

    Anthracnose disease in the cotton plant caused by fungal pathogen Colletotrichum gossypii. It is supposed to be most critical diseases in the cotton crop as it causes infection and leads to complete damaging of the cotton crop by infecting the leaves, stems, and bolls in the field. The disease control is challenging due to the absence of an effective fungicide without damaging the farmer health and environment. So the series of experiments were designed to assess the antagonistic activity of biosurfactant released by strain Bacillus licheniformis OE-04 against the anthracnose causing agent in cotton and this strain was screened out from forty eight strain of rhizobacteria. We also estimated the heat stability and pH range and toxicity of biosurfactant produced by strain 0E-04. The results showed that biosurfactant has maximum antifungal activity against C. gossypii. In vitro study concluded that the biosurfactant can reduce fungal activity by inhibiting the spore germination of C. gossypii. Moreover, the biosurfactant also has wide pH and temperature range. We observed Antifungal activity of biosurfactant at 5 to 10 pH range and temperature range was also wide from room temperature to 100 °C. We also observed the toxicity of biosurfactant produced by Bacillus licheniformis against zebra fish (Danio rerio). We were noticed that biosurfactant have least harmful effect with maximum concentration. The study confirmed that biosurfactant of Bacillus licheniformis have high pH and heat stability range with least harmful effects so it can be a good replacement of chemical pesticides for cotton anthracnose control. Copyright © 2018 Elsevier Inc. All rights reserved.

  1. Relationships between benthic cover, current strength, herbivory, and a fisheries closure in Glovers Reef Atoll, Belize

    Science.gov (United States)

    McClanahan, T.; Karnauskas, M.

    2011-03-01

    Benthic cover, current strengths, and fish abundance and diversity were examined on 150 lagoonal patch reefs and mapped to determine their distribution, inter-relationships, and relationship to the fisheries closure in Glovers Reef Atoll. Current strength was highest at both the northern and southern ends of the atoll and largely controlled by local wind and weakly by tidal forcing. Benthic functional group distributions varied throughout the atoll and had distinct areas of dominance. In contrast, dominance of coral species was weaker, reflecting the lost cover and zonation of Acropora, Porites, and Montastraea that were reported in the 1970s. Hard and soft corals dominated the windward rim, while the central and leeward lagoon had lower current strengths and sea grass and fleshy green algae were relatively more abundant. Brown erect algae were relatively more common in the north and calcifying green and red algae the southern ends of the atoll. Only Montastraea- Agaricia agaricites distributions were similar to reports from the 1970s with high relative dominance in the southern and northeast atoll. The central-northern zone, which was described as an Acropora zone in the 1970s, was not recognizable, and Porites porites, P. astreoides, Millepora alcicornis, and Favia fragum were the most abundant species during this survey . Hard and soft coral cover abundance declined away from the reef rim and tidal channels and was associated with fast seawater turnover and high surgeonfish abundance. Consequently, the windward rim area has retained the most original and persistent hard-soft coral and surgeonfish community and is considered a priority for future management, if the goal is to protect coral from fishing impacts.

  2. An Attractant of the Aphidophagous Gall Midge Aphidoletes aphidimyza From Honeydew of Aphis gossypii.

    Science.gov (United States)

    Watanabe, Hiroshi; Yano, Eizi; Higashida, Keita; Hasegawa, Syouichi; Takabayashi, Junji; Ozawa, Rika

    2016-02-01

    Many natural enemies of insects use honeydew as a volatile cue to locate hosts or prey, as an oviposition stimulant, and as an arrestant for foraging. The aphidophagous gall midge Aphidoletes aphidimyza (Rondani) (Diptera: Cecidomyiidae) has predacious larval stages and can be used to control aphid populations, especially in greenhouses. Previous studies have shown that the honeydew, excreted by the aphid Myzus persicae, attracts A. aphidimyza, but the crucial attractants have not been identified. Using an olfactometer, we studied behavioral responses of female A. aphidimyza to volatiles emitted from honeydew excreted by the aphid Aphis gossypii on eggplants. The volatiles attracted female midges and induced oviposition. Moreover, using gas chromatography coupled with mass spectrometry (GC/MS), we identified phenylacetaldehyde as the attractant compound in the honeydew, although it did not induce oviposition in olfactometer experiments.

  3. A mutant with riboflavin productivity obtained from non-riboflavin-producing ashbya gossypii by γ-induction

    International Nuclear Information System (INIS)

    Yang Suhong; Ge Zhongliang

    1993-01-01

    60 Co γ-ray was used to irradiate Ashbya gossypii, which does not produce riboflavin originally, and mutants were obtained with colonial colour changing from white into yellow. Mutant ratio was high at the absorption dose of 90 Gy. Results of reverse phase-HPLC, high performance-TLC and fluoroscopic analysis proved that riboflavin is produced by the mutant fermentation. The mutant remained after generations of culture, indicating that the induced new properties are stably inheritable

  4. Cotton resistance to ramulose and variability of Colletotrichum gossypii f. sp. cephalosporioides Resistência do algodoeiro a ramulose e variabilidade de Colletotrichum gossypii f. sp. cephalosporioides

    Directory of Open Access Journals (Sweden)

    Jefferson Fernandes do Nascimento

    2006-03-01

    Full Text Available Four cultivars and 21 lines of cotton were evaluated for resistance to ramulose (Colletotrichum gossypii f. sp. cephalosporioides in a field where the disease is endemic. The seeds of each genotype were planted in 5 x 5 m plots with three replications. The lines CNPA 94-101 and 'CNPA Precoce 2'were used as standard susceptible and resistant references, respectively. The disease incidence (DI was calculated from the proportion of diseased plants in the plot. The disease index (DIn was calculated from the disease severity using a 1 to 9 scale, and was evaluated at weekly intervals starting 107 days after emergence. The data collected was used to calculate the area under disease progress curve (AUDPC. In general, the DIn increased linearly with time and varied from 20.0 to 57.1 and AUDPC from 567 to 1627 among the genotypes which could be clustered in to two distinct groups. The susceptible group contained two cultivars and nine lines and the resistant group contained one cultivar and 12 lines. The relationship between disease index and evaluation times was linear for the 25 genotypes tested. The line CNPA 94-101, used as susceptible standard, was the most susceptible with an average DI = 83.4, DIn = 57.1 and AUDPC = 1627.7. The line CNPA 96-08 with DI = 37.8, DIn = 20.0 and AUDPC = 567.7 was the most resistant one. Among the commercial cultivars 'IAC 22' was the most susceptible and 'CNPA Precoce 2', used as resistant standard was the most resistant. The variability in virulence of the pathogen was studied by spray inoculating nine genotypes with conidial suspensions (10(5/mL of either of the 10 isolates. The disease severity was evaluated 30 days later using a scale of 1 to 5. The virulence of the isolate was expressed by DIn. All the isolates were highly virulent but their virulence avaried for several genotypes and could be clustered in two distinct groups of less and more virulent isolates. The isolate MTRM 14 from Mato Grosso was the least

  5. KELIMPAHAN DAN KEANEKARAGAMAN SPESIES SERANGGA PREDATOR DAN PARASITOID Aphis gossypii DI SUMATERA SELATAN

    Directory of Open Access Journals (Sweden)

    . Riyanto

    2011-11-01

    Full Text Available This study was aimed to analysis abundance and species diversity of predatory insects and parasitoid of Aphis gossypii from lowland and highland areas of South Sumatra.    Survey of was conducted in 11 vegetable centers of  South Sumatra.  The results showed that 20 species of predatory insects and 3 species of parasitoids were found from the survey. The predatory insects consisted of 15 species of coccinellid beetles, two species of syrphids, and  one species of chamaemyiid, mantid and staphylinid.  Parasitoid found were 2 species of Aphidiidae (Diaretiella rapae and Aphidius sp. and a species of Aphelinidae (Aphelinus sp..  The highest abundance of the predator was found in Soak (42.61 larvae and adults and the highest abundance of the parasitoid was found in Talang Buruk (25.99 adults.  The highest species diversity of the predator and the parasitoid were found in Soak (15 species and H’= 0.94 and in Talang Buruk (2 species and H’ = 0.27, respectively.  Abundance and species diversity of the predators and parasitoids were higher in the dry season than those in rainy season. Thus, the abundance and species diversity of the predators and parasiotids were higher in the lowland than highland areas in South Sumatra, while the seasons affected the abundance and species diversity of the predators and parasitoids.

  6. SEPARATION OF THE MINOR FLAVONOLS FROM FLOS GOSSYPII BY HIGH-SPEED COUNTERCURRENT CHROMATOGRAPHY

    Science.gov (United States)

    Yang, Yi; Zhao, Yongxin; Gu, Dongyu; Ayupbek, Amatjan; Huang, Yun; Dou, Jun; Ito, Yoichiro; Zhang, Tianyou; Aisa, Haji Akber

    2010-01-01

    An effective high-speed countercurrent chromatography (HSCCC) method was established for further separation and purification of four minor flavonols in addition to five major flavonols which were reported by our previous study from extracts of Flos Gossypii. HSCCC was performed with three two-phase solvent systems composed of n-hexane-ethyl acetate-methanol-water (7.5:15:6:7, v/v), (2.5:15:2:7, v/v) and (0:1:0:1, v/v). The separation was repeated 3 times, and 3.8 mg of 8-methoxyl-kaempferol-7-O-β-D-rhamnoside (HPLC purity 98.27%), 6.7 mg of astragalin (HPLC purity 94.18%), 3.3 mg of 4′-methoxyl-quercetin-7-O-β-D-glucoside (HPLC purity 94.30%) and 8.2 mg of hyperoside (HPLC purity 93.48%) were separated from 150 mg of the crude sample. The chemical structures of the flavonols were confirmed by MS, 1H NMR and 13C NMR. Meanwhile, the results indicated that the target compound with smaller K value (HSCCC. And four separation rules of flavonols according to the present study and references were summarized, which can be used as a useful guide for separation of flavonols by HSCCC. PMID:21494318

  7. Molecular screening of insecticides with sigma glutathione S-transferases (GST) in cotton aphid Aphis gossypii using docking.

    Science.gov (United States)

    Gawande, Nilesh Dinkar; Subashini, Swaminathan; Murugan, Marimuthu; Subbarayalu, Mohankumar

    2014-01-01

    Glutathione S-transferases (GSTs) are one of the major families of detoxifying enzymes that detoxifies different chemical compounds including insecticides in different insect species. Among the GST subclasses, sigma GSTs are found to be the most abundant and conserved among different insect orders. These GSTs are found to play an important role in lipid peroxidation as well as detoxification. Cotton aphid, Aphis gossypii is the most damaging sucking pest with a wide range of hosts and vector of more than 50 plant viruses. Resistance to insecticides in A. gossypii is reported in India and in other countries. Glutathione S transferases (GSTs), an oxidative enzyme is understood to have a role in insecticide resistance and plant resistance breakdown. In relation to this, we have focused on the sigma 1 (GenBank Accession No: JN989964.1) and sigma 2 (GenBank Accession No: JN989965.1) GSTs of A. gossypii and their interaction with plant natural compounds and insecticides. Molecular screening of different insecticides (Chlorphinamidine, Mevinphos, Nitenpyrum, Piperonyl butoxide, Tetrachlorovinphos, Pyrethrins, Resmetrin, Pirimicarb and Dinotefuran) and known plant derived natural compounds (Catechin, Gossypol, Myrcene, Kaempferol, P-coumaric acid, Quercetin, Tannins, α-mangostin, Capsaicin, Cinnamic acid, Citronellal, Curcumin, Dicumarol, Ellagic acid, Eugenol, Geriniol, Isoeugenol, Juglone, Menadione, Methyl jasmonate, Morin, Myricetin, Myristicin, Piperine, Plumbagin, Tangitinin C, Thymol, Vanillin, Alpha pipene, α-terpineol Apigenin and β-Caryophyllene) with sigma 1 and sigma 2 GST protein models was completed using Maestro 9.3 (Schrodinger, USA). This exercise showed the binding of piperonyl butoxide with sigma 1 GST and tannin with sigma 2 GST for further consideration.

  8. Homoptera: Aphididae

    African Journals Online (AJOL)

    Blackman and Eastop, ... types (i.e., red soil, brown soil, and black soil) in the area. Although all crops are attacked by a wide range ..... Sharp, J.C and Andrade, M. (1994). An investigation of the behavior of the pea aphid, Acyrthosiphon pisum.

  9. Homoptera, Cicadidae

    African Journals Online (AJOL)

    1988-10-24

    Oct 24, 1988 ... There are also morphological differences between the two taxa which parallel the differences in their .... Female 5 31,0 29,9--32,2 9 26,8 25,3-28,7 -8,11 0,0001. • Student's t test. [. 1mm. A. B. Figure 2 Male genitalia (pygophore and urite). A, P. stridula; ... mainly on trees, all of which were exotics, e.g. Port.

  10. Homoptera: Cicadidae

    African Journals Online (AJOL)

    1988-10-24

    dwelling bugs which make .... dimorphic, the males possessing a white band across the base of the abdomen which is lacking in the ... than 1,2 m, and the trees are at least 10 m in height, and also large stands of oak, pine, gum and.

  11. Taxonomic notes on some Polyglyptini: descriptions of new genus and new species (Homoptera, Membracidae, Smiliinae

    Directory of Open Access Journals (Sweden)

    Albino M. Sakakibara

    1996-01-01

    Full Text Available Taxonomic notes on some Polyglyptini; descriptions of new genus and new species (Homoptera, Membracidae, Smiliinae. The genera Hemiptycha Germar, Metheisa Fowler, Maturnaria Metcalf, Aphetea Fowler, Dioclophara Kirkaldy, and Phormophora Stål, are redescribed; Creonus, gen.n. (type species: Maturna lloydi Funkhouser, 1914, and Aphetea robustula, sp.n. (from Bolivia, are described. Some nomenclatural changes are introduced, as follow: - Hemiptycha Germar, 1833 = Polyrhyssa Stål, 1869, syn.n.: - Hemiptycha cultrata (Coquebert, 1801, comb.n., = Polyglyptodes flavocostatus Haviland, 1925, syn.n., = Polyrhyssa cultrata maculata Fonseca, 1942, syn.n. - Hemiptycha obtecta (Fabricius, 1803 = Hille herbicola Haviland, 1925, syn.n. - Maturnaria ephippigera (Fairmaire, 1846 = Publilia tumulata Buckton, 1903, syn.n., = Metheisa fowleri Funkhouser, 1927, syn.n. - Creonus lloydi (Funkhouser, 1914, comb.n. - Aphetea parvula (Fabricius, 1803, comb.n., = Aphetea affinis Haviland, 1925, syn.n. - Dioclophara Kirkaldy, 1904 = lncolea Goding, 1926, syn.n. - Dioclophara viridula (Fairmaire, 1846 = Maturna multilineata Fonseca, 1942, syn.n. - Dioclophara variegata (Goding, 1926, comb.n. = lncolea viridis Goding, 1926, syn.n. - Phormophora maura (Fabricius, 1803 = Darnis dorsata Fabricius, 1803, syn.n.

  12. Imidacloprid susceptibility survey and selection risk assessment in field populations of Nilaparvata lugens (Homoptera: Delphacidae).

    Science.gov (United States)

    Wang, Yan Hua; Gao, Cong Fen; Zhu, Yu Cheng; Chen, Jin; Li, Wen Hong; Zhuang, Yong Lin; Dai, De Jiang; Zhou, Wei Jun; Yong, Chong; Shen, Jin Liang

    2008-04-01

    Imidacloprid has been used for many years to control planthopper Nilaparvata lugens (Stål) (Homoptera: Delphacidae) in China. To provide resistance assessment for the national insecticide resistance management program, we collected a total of 42 samples of the planthoppers from 27 locations covering eight provinces to monitor their dose responses and susceptibility changes to imidacloprid over an 11-yr period (1996-2006). Results showed that most field populations maintained susceptibility from 1996 to 2003 except for a population from Guilin, Guangxi, in 1997, which showed a low level of resistance to imidacloprid. However, surveys conducted in 2005 indicated that 16 populations from six provinces quickly developed resistance with resistance ratios ranging from 79 to 811. The data collected in 2006 revealed that the resistance levels in 12 populations collected from seven different provinces decreased slightly (RR = 107-316), except the Tongzhou population (Jiangsu Province), which developed 625-fold resistance. Dominant and intensive use of imidacloprid in a wide range of rice, Oryza savita L., growing areas might be a driving force for the resistance development. Migration of the insect also significantly boosted the resistance levels due to extensive and intensive use of imidacloprid in emigrating areas and continuous postmigration sprays of the chemical. In addition, laboratory resistance selection using imidacloprid showed that resistance ratio increased to 14-fold after 27 generations, suggesting that quick resistance development might be associated with more frequent applications of the insecticide in recent years.

  13. Responses of Nasonovia ribisnigri (Homoptera: Aphididae) to susceptible and resistant lettuce.

    Science.gov (United States)

    Liu, Yong-Biao; McCreight, James D

    2006-06-01

    Nymphs and alates of aphid Nasonovia ribisnigri (Mosley) (Homoptera: Aphididae) were tested on 10 lettuce cultivars with N. ribisnigri resistance gene Nr and 18 cultivars without the resistance gene in various bioassays. Bioassays used whole plants, leaf discs, or leaf cages to determine susceptibility of commercial lettuce cultivars to N. ribisnigri infestation and to evaluate screening methods for breeding lettuce resistance to N. ribisnigri. Resistant and susceptible plants were separated in 3 d when using whole plant bioassays. Long-term (> or =7 d) no-choice tests using leaf cages or whole plants resulted in no survival of N. ribisnigri on resistant plants, indicating great promise of the Nr gene for management of N. ribisnigri. Effective screening was achieved in both no-choice tests where resistant or susceptible intact plants were tested separately in groups or individually and in choice tests where susceptible and resistant plants were intermixed. Leaf discs bioassays were not suitable for resistance screening. All lettuce cultivars without the resistance gene were suitable hosts for N. ribisnigri, indicating the great importance of this pest to lettuce production and the urgency in developing resistant lettuce cultivars to manage N. ribisnigri.

  14. Distribution and population development of Nasonovia ribisnigri (Homoptera: Aphididae) in iceberg lettuce.

    Science.gov (United States)

    Liu, Yong-Biao

    2004-06-01

    A field study was conducted to determine the distribution and development of aphid Nasonovia ribisnigri (Mosley) (Homoptera: Aphididae) populations in iceberg lettuce, Lactuca sativa L. 'Salinas'. Lettuce plants were transplanted and caged individually in the field and inoculated with apterous N. ribisnigri at 0, 1, 2, 3, and 4 wk after transplanting in spring and fall 2002. Plants were harvested 15-50 d after inoculations; numbers of alates and apterous N. ribisnigri were counted or estimated on each leaf for each plant. Inoculations during all 5 wk of plant development resulted in successful colonization of lettuce heads. Results indicated that head formation did not reduce the risk of colonization by N. ribisnigri to iceberg lettuce; plants were susceptible to colonization by N. ribisnigri throughout their development. For later inoculations, N. ribisnigri populations were relatively smaller, and aphids were found mostly within the heads. For earlier inoculations, N. ribisnigri populations were larger, and within-plant distributions shifted toward frame leaves. The shift of population distributions toward frame leaves correlated significantly with increases in N. ribisnigri population density. For most inoculations, more aphids were present on wrapper leaves than on other leaves. The proportion of alates did not vary significantly with population density. Population development of N ribisnigri also correlated significantly with heat unit accumulation. Yellow sticky cards were used to monitor alates in each cage. Catches of N. ribisnigri alates on yellow sticky cards were significantly correlated with total numbers of alates as well as with total population sizes on individual lettuce plants.

  15. Characteristics of suspended and streambed sediment within constructed chutes and the main channel at Upper Hamburg and Glovers Point Bends, Missouri River, Nebraska, 2008

    Science.gov (United States)

    Woodward, Brenda K.; Rus, David L.

    2011-01-01

    The U.S. Army Corps of Engineers, Omaha District, as part of the Missouri River Bank Stabilization and Navigation Mitigation Project, has constructed 17 off-channel chutes along the channelized Missouri River, downstream from Sioux City, Iowa, to increase habitat diversity. To better understand characteristics of suspended and streambed sediment within these constructed chutes, the U.S. Geological Survey investigated specific aspects of chute design and function in relation to sediment characteristics including: (1) effects of inlet structures; (2) changes occurring between the inlet and the outlet of a chute; (3) effects of chutes on sediment characteristics in the main channel; and (4) differences in chute dynamics between sampled chutes. Two chutes differing in design, location, and dynamics were studied, Upper Hamburg Bend near Nebraska City, Nebr., and Glovers Point Bend near Winnebago, Nebr. Each site was characterized using five or more sampling transects (two in the chute and three to four in the main channel) designed to bracket sediment exchanges between chutes and the main channel. A sixth transect was included at the Upper Hamburg Bend study site to account for the effects of a nontarget chute having its inlet midway between the inlet and outlet of the primary chute. Representative samples of suspended and streambed sediment were collected at each transect, along with measurements of turbidity and streamflow, between June and November 2008. Four sets of samples were collected at the Glovers Point Bend study site and five sample sets were collected from the Upper Hamburg Bend study site. Results from paired t-tests and standard t-tests indicated that the inlet structure design, passing inflow only from the top of the main-channel water column, reduced the supply of coarse-grained suspended sediment entering the chutes. Statistical comparisons did not indicate differences between the inlet and outlet of either chute; however, anecdotal evidence of recent

  16. The behavior of Aphis gossypii and Aphis craccivora (Hemiptera: Aphididae and of their predator Cycloneda sanguinea (Coleoptera: Coccinellidae in cotton-cowpea intercropping systems

    Directory of Open Access Journals (Sweden)

    FRANCISCO S. FERNANDES

    2018-02-01

    Full Text Available ABSTRACT The intercropping is an important cultural practice commonly used in pest management. It is based on the principle that increased plant diversity in the agro-ecosystem can lead to reductions of pest populations in the crop. The current study aimed to assess the impact the colored fiber cotton-cowpea intercropped systems on Aphis gossypii and Aphis craccivora and on their predator Cycloneda sanguinea and the losses and the dispersion behavior of these aphids and their predator in these cropping systems. The experiment had a randomized block experimental design with two bioassays and four treatments. The number of apterous and alate aphids (A. gossypii per cotton plant was 1.46 and 1.73 or 1.97 and 2.19 times highest in the solid cotton system than that found in the cotton-cowpea intercropped systems (S1 and (S2, respectively. On the other hand, the cotton-cowpea intercropped systems (S1 and S2 reduced, respectively, in 43% and 31% the number of apterousA. gossypiiper cotton plant compared to the control. Implementing cotton-cowpea intercropped system in the S1 scheme reduced A. gossypii infestation, favored the multiplication of C. sanguinea, and allowed obtaining heavier open bolls.

  17. The behavior of Aphis gossypii and Aphis craccivora (Hemiptera: Aphididae) and of their predator Cycloneda sanguinea (Coleoptera: Coccinellidae) in cotton-cowpea intercropping systems.

    Science.gov (United States)

    Fernandes, Francisco S; Godoy, Wesley A C; Ramalho, Francisco S; Malaquias, José B; Santos, Bárbara D B

    2018-02-01

    The intercropping is an important cultural practice commonly used in pest management. It is based on the principle that increased plant diversity in the agro-ecosystem can lead to reductions of pest populations in the crop. The current study aimed to assess the impact the colored fiber cotton-cowpea intercropped systems on Aphis gossypii and Aphis craccivora and on their predator Cycloneda sanguinea and the losses and the dispersion behavior of these aphids and their predator in these cropping systems. The experiment had a randomized block experimental design with two bioassays and four treatments. The number of apterous and alate aphids (A. gossypii) per cotton plant was 1.46 and 1.73 or 1.97 and 2.19 times highest in the solid cotton system than that found in the cotton-cowpea intercropped systems (S1) and (S2), respectively. On the other hand, the cotton-cowpea intercropped systems (S1 and S2) reduced, respectively, in 43% and 31% the number of apterousA. gossypiiper cotton plant compared to the control. Implementing cotton-cowpea intercropped system in the S1 scheme reduced A. gossypii infestation, favored the multiplication of C. sanguinea, and allowed obtaining heavier open bolls.

  18. COMPORTAMENTO DO FUNGO Colletotrichum gossypii South. var. cephalosporoides Costa EM SUBSTRATO COM DIFERENTES FONTES DE NITROGÊNIO THE BEHAVIOR OF THE FUNGUS Colletotrichum gossypii South Var. cephalosporoides Costa IN SUBSTRATE CONTAINING DIFFERENT SOURCES OF NITROGEN

    Directory of Open Access Journals (Sweden)

    Yvo de Carvalho

    2007-09-01

    Full Text Available

    Nesse trabalho procurou-se observar o efeito de diversas substâncias nitrogenadas sobre o crescimento miceliano, esporulação e aspectos morfológicos das colônias do fungo Colletotrichum gossypii South. var. cephalosporoides Costa em substrato sólido. Usou-se um substrato sintético como meio-básico e a este se adicionou peptona, metionina, asparagina, nitrato de sódio ou salicilato de amônia, conforme o tratamento. A testemunha não recebeu qualquer fonte de nitrogênio. Concluiu-se que a peptona foi o melhor tratamento para esporulação e crescimento miceliano, seguindo-se a asparagina que foi eficiente na indução da esporulação. O salicilato de amônia exerceu efeito inibidor do crescimento vegetativo e da esporulação do fungo. Para produção de inóculo, a curto prazo, recomenda-se o uso da peptona como fonte de nitrogênio. Foram observadas diferenças na pigmentação, bordos e densidade das colônias. A esporulação, embora abundante em substratos contendo peptona e asparagina, ocorreu em forma de verdadeiras massas localizadas de conídios na primeira, e como conídios dispersos na segunda.

    In this experiment, the effect of different nitrogenous substances on the mycelium growth, sporulation and morphological aspects of the colonies of the fungus Colletotrichum gossypii  South Var. cephalosporoides Costa planted in a solid substrate were observed. A synthetic substrate was used as a basic medium, and to this was added peptone metionine, asparagine, sodium nitrate or ammonium salicylate, according to the treatment. The control (group received no nitrogen whatsover. It was concluded that peptone was the best treatment for sporulation and mycelium growth, and that the next best was asparagine which was helpfull in inducing sporulation. Ammonium salicylate inhibited the vegetative growth

  19. Molecular systematics of aphids (Homoptera: Aphididae): new insights from the long-wavelength opsin gene.

    Science.gov (United States)

    Ortiz-Rivas, Benjamín; Moya, Andrés; Martínez-Torres, David

    2004-01-01

    Viviparous aphids (Aphididae) constitute a monophyletic group within the Homoptera with more than 4000 extant species worldwide but higher diversity in temperate regions. Several aspects of their biology account for attention paid to this group of insects. Their plant-sap-sucking way of feeding with many species transmitting viruses to crop plants has important implications on crop management strategies. Cyclical parthenogenesis associated in many groups to host alternation and elaborate polyphenisms is of special interests for evolutionists. Finally, the ancient association of most aphid species with intracellular endosymbiotic bacteria (Buchnera sp.) has also received much attention from evolutionists interested in mechanisms involved in the symbiotic process. Knowing the phylogenetic relationships among major aphid taxa is of special interest to evolutionists interested in the above issues. However, until recently, molecular approaches to aphid phylogeny were absent and discussions on the evolution of aphid life-cycles and on evolutionary aspects of their symbiotic association with Buchnera were framed by morphology-based phylogenies. Recently, two reports using molecular approaches attempted to address the yet unresolved phylogeny of Aphididae with limited although somehow different conclusions. In the present report we study the utility of the long-wave opsin gene in resolving phylogenetic relationships among seven subfamilies within the Aphididae. Our results corroborate some previously proposed relationships and suggest a revision of some others. In particular, our data support grouping the analysed aphid species into three main clades, being the subfamily Lachninae one of them, which contradicts its generally accepted sistership relationship with the subfamily Aphidinae. Moreover, our data also suggest a basal position of Lachninae which has implications on current discussions about the ancestrality of conifer-feeding in modern aphids.

  20. Level II scour analysis for Bridge 23 (GLOVTH00410023) on Town Highway 41, crossing Sherburne Brook, Glover, Vermont

    Science.gov (United States)

    Olson, Scott A.; Boehmler, Erick M.

    1997-01-01

    This report provides the results of a detailed Level II analysis of scour potential at structure GLOVTH00410023 on Town Highway 41 crossing Sherburne Brook, Glover, Vermont (figures 1–8). A Level II study is a basic engineering analysis of the site, including a quantitative analysis of stream stability and scour (U.S. Department of Transportation, 1993). Results of a Level I scour investigation also are included in Appendix E of this report. A Level I investigation provides a qualitative geomorphic characterization of the study site. Information on the bridge, gleaned from Vermont Agency of Transportation (VTAOT) files, was compiled prior to conducting Level I and Level II analyses and is found in Appendix D. The site is in the New England Upland section of the New England physiographic province in northern Vermont. The 2.57-mi2 drainage area is in a predominantly rural and forested basin. In the vicinity of the study site, the surface cover is primarily forest with small areas of lawn and a home on the right overbank and a gravel roadway along the upstream left bank. In the study area, Sherburne Brook has an incised, sinuous channel with a slope of approximately 0.03 ft/ft, an average channel top width of 33 ft and an average bank height of 6 ft. The channel bed material ranges from gravel to boulder with a median grain size (D50) of 57.3 mm (0.188 ft). The geomorphic assessment at the time of the Level I and Level II site visit on October 24, 1994, indicated that the reach was stable. The Town Highway 41 crossing of Sherburne Brook is a 24-ft-long, one-lane bridge consisting of one 21-foot steel-beam span with a timber deck (Vermont Agency of Transportation, written communication, August 4, 1994). The opening length of the structure parallel to the bridge face is 20.3 ft. The bridge is supported by vertical, granite block abutments. The channel is skewed approximately 55 degrees to the opening while the measured opening-skew-to-roadway is 30 degrees. One foot

  1. Comparative efficacy of some insecticides against cotton whitefly, bemisia tabaci (gennadius) (homoptera: aleyrodidae) under natural field conditions

    International Nuclear Information System (INIS)

    Nadeem, M.K.; Hasnain, M.; Ahmed, S.; Ashfaq, M.

    2011-01-01

    Comparative efficacy of five commonly used insecticides viz., acetamiprid, buprofezin, diafenthiuron, imidacloprid and endosulfan against nymph and adult population of cotton whitefly, Bemisia tabaci (Gennadius) (Homoptera: Aleyrodidae) under natural field conditions has been studied. Results showed that buprofezin was the most effective insecticide against nymph population of whitefly among the tested insecticides where nymphal population of B. tabaci was 0.2/leaf after 24h spray as compared to 1.9/leaf in control. Acetamiprid was the most effective against adult population of whitefly (0.3 to 1.3/leaf post 72 h spray, as compared to control with 6.9 to 8.2/leaf) followed by diafenthiuron and imidaclopirid. whereas, endosulfan was found to be the least effective on both populations as adult and nymph of whitefly. From the tested insecticides, acetamaprid gave effective control of both nymph and adult population of B. tabaci. (author)

  2. Pengaruh Jenis Perangkap Sintetis Untuk Mengendalikan Hama Kutu Putih (Bemisia tabaci Genn.) (Homoptera: Aleyrodidae) Pada Tanaman Tembakau Deli (Nicotiana tabacum L.)

    OpenAIRE

    Nasution, Maimunah R.

    2010-01-01

    Maimunah R. Nasution, 2010. ”The Effect of Kinds Sintetic Traps to Control Pest of White Fly (Bemisia tabaci Genn.) (Homoptera: Aleyrodidae) in Tobacco Plantation (Nicotiana tabacum L.)”. This Research has been done in BPTTD Sampali, Deli Serdang, approximately ± 25 m from the sea surface. The aim of this research was to know the effect of kinds sintetic traps to control pest white fly (Bemisia tabaci Genn.) in Tobacco Plantation (Nicotiana tabacum L.). The parameters which observed were amou...

  3. Pathogenicity of conidia-based preparations of entomopathogenic fungi against the greenhouse pest aphids Myzus persicae, Aphis gossypii, and Aulacorthum solani (Hemiptera: Aphididae).

    Science.gov (United States)

    Jandricic, S E; Filotas, M; Sanderson, J P; Wraight, S P

    2014-05-01

    Seeking new isolates of entomopathogenic fungi with greater virulence against greenhouse aphid pests than those currently registered in North America for control of these insects, single-dose screening assays of 44 selected fungal isolates and 4 commercially available strains were conducted against first-instar nymphs of Myzus persicae and Aphis gossypii. The assays identified a number of Beauveria and Metarhizium isolates with virulence equal to or greater than that of the commercial strains against the nymphal aphids, but none exhibited exceptionally high virulence. Virulence of Isaria isolates was unexpectedly low (1000conidia/mm(2)). In dose-response assays, Beauveria ARSEF 5493 proved most virulent against M. persicae and A. gossypii; however, LC50s of this isolate did not differ significantly from those of B. bassiana commercial strain JW-1. Dose-response assays were also conducted with Aulacorthum solani, the first reported evaluations of Beauveria and Metarhizium against this pest. The novel isolate Metarhizium 5471 showed virulence⩾that of Beauveria 5493 in terms of LC25 and LC50, but 5493 produced a steeper dose response (slope). Additional tests showed that adult aphids are more susceptible than nymphs to fungal infection but confirmed that infection has a limited pre-mortem effect on aphid reproduction. Effects of assay techniques and the potential of fungal pathogens as aphid-control agents are discussed. Copyright © 2014 Elsevier Inc. All rights reserved.

  4. HUBUNGAN KUTU DOMPOLAN DYSMICOCCUS BREVIPES (CKLL. (HOMOPTERA : PSEUDOCOCCIDAE DAN SEMUT API SOLENOPSIS SP. (HYMENOPTERA: FORMICIDAE PADA DUA CARA BERTANAM NENAS

    Directory of Open Access Journals (Sweden)

    Rosma Hasibuan .

    2012-02-01

    Full Text Available Association of mealybug, Dysmicoccus brevipes (Ckll. (Homoptera: Pseudococcidae and fire ant, Solenopsis sp. (Hymenoptera: Formicidae on two pineapple–planting patterns.  A pineapple mealybug, Dysmicoccus  brevipes (Ckll.  (Homoptera: Pseudococcidae is an important insect pest in major pineapple growing areas.  Its feeding activity causes damage on the pineapple plants and it can also transmit pineapple wilt virus.  The mealybugs are often found in association with fire ants, Solenopsis sp. (Hymenoptera: Formicidae that provide protection in exchange for the sweet honeydew liquid. The field study was conducted to determine the close association between  mealybugs and fire ants on  two plant row spacing (single and double row spacing four different plant stages (3, 7, 11, and 17 months after planting. The  results indicated  that there was a significant correlation between the mealybugs and the fire ant on two pineapple-planting patterns, particularly on late growth periods (11, and 17 months after planting. In this field study, population of mealybugs on double row spacing were more abundant  (ranging from 0 to 25.67 bugs/plant compared with that on single row spacing which ranged 0 to 3.67 bugs/plant. Moreover, general mean of population density of mealybugs (14.53 bugs/plant on double row was significantly higher  than that on single row spacing (1.83 bugs/plant. In  line with this mealybug-population development, mean numbers of fire ants caught on baited-sticky traps were ranged from 0 to 8.53 ants/trap on single row versus 0 to 23.57 ants/trap on double row spacing pattern. The general mean number of captured ants (12.73 ants/trap on double row was significantly higher compared with that on single row spacing (5.55 ants/trap. It appears that the patterns of population densities of mealybugs are closely related to that of fire ants that act as attendant species on two pineapple row spacing.

  5. Functional characteristics of a tiny but specialized olfactory system: olfactory receptor neurons of carrot psyllids (Homoptera: Triozidae).

    Science.gov (United States)

    Kristoffersen, Lina; Larsson, Mattias C; Anderbrant, Olle

    2008-11-01

    With only approximately 50 olfactory receptor neurons (ORNs), the carrot psyllid Trioza apicalis (Homoptera: Psylloidea) may have the smallest olfactory system described in adult Neopteran insects. Using single sensillum recordings (SSR) and gas chromatograph-linked SSR, we characterized 4 olfactory sensilla forming a distinct morphological type, which together house approximately 25% of all ORNs. We recorded responses to extracts and single constituents from Daucus carota ssp. sativus, from the conifers Picea abies, Pinus sylvestris, and Juniperus communis, as well as from male and female T. apicalis. Receptor neurons were highly selective; only 9 compounds in total elicited repeatable responses, and each neuron responded to at most 3 individual compounds. Chemical profiles of carrot and conifers showed significant overlap, with 4 out of 9 electrophysiologically active compounds occurring in more than one type of extract, but a carrot-specific compound elicited the most repeated responses. We identified 4 tentative neuron classes and found a rather high degree of neuronal redundancy, with 1 neuron class present in 3 and another present in all 4 of the sensilla, respectively.

  6. The Cuticle Protein Gene MPCP4 of Myzus persicae (Homoptera: Aphididae) Plays a Critical Role in Cucumber Mosaic Virus Acquisition.

    Science.gov (United States)

    Liang, Yan; Gao, Xi-Wu

    2017-06-01

    Myzus persicae (Sulzer) (Homoptera: Aphididae) is one of the most important agricultural pests worldwide. In addition to sucking phloem sap, M. persicae also transmits Cucumber mosaic virus (CMV) as a vector in a nonpersistent manner. At present, the infection mechanism remains unclear, especially the process of aphid virus acquisition. In this study, we isolated four M. persicae cuticle protein genes (MPCP1, MPCP2, MPCP4, and MPCP5) from M. persicae. The relative amount of the gene encoding Cucumber mosaic virus capsid protein (CMV CP) and the transcript levels of these four cuticle protein genes were investigated in aphid virus acquisition by feeding the tobacco preinfested by CMV. The relative expression of MPCP1, MPCP2, and MPCP4 were significantly higher than MPCP5 at 24 h after aphids feeding on virus-infested tobacco. Yeast two-hybrid assays demonstrated that the protein encoded by MPCP4 gene was closely associated with the CMV CP through the direct interaction. Moreover, the ability of M. persicae to acquire CMV was suppressed by RNA interference of MPCP4. All these lines of evidence indicate that MPCP4, as a viral putative receptor in the stylet of aphid, plays an important role in aphid acquisition of CMV. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  7. The effect of Chrysoperla carnea (Neuroptera: Chrysopidae) and Adalia bipunctata (Coleoptera: Coccinellidae) on the spread of cucumber mosaic virus (CMV) by Aphis gossypii (Hemiptera: Aphididae).

    Science.gov (United States)

    Garzón, A; Budia, F; Medina, P; Morales, I; Fereres, A; Viñuela, E

    2015-02-01

    The effects of two aphidophagous predators, the larvae of Chrysoperla carnea and adults of Adalia bipunctata, on the spread of cucumber mosaic virus (CMV) transmitted in a non-persistent manner by the cotton aphid Aphis gossypii were studied under semi-field conditions. Natural enemies and aphids were released inside insect-proof cages (1 m × 1 m × 1 m) with a central CMV-infected cucumber plant surrounded by 48 healthy cucumber seedlings, and the spatiotemporal dynamics of the virus and vector were evaluated in the short and long term (1 and 5 days) in the presence and absence of the natural enemy. The spatial analysis by distance indices methodology together with other indices measuring the dispersal around a single focus was used to assess the spatial pattern and the degree of association between the virus and its vector. Both natural enemies significantly reduced the number of aphids in the CMV-source plant after 5 days but not after 1 day. The CMV transmission rate was generally low, especially after 1 day, due to the limited movement of aphids from the central CMV-source plant, which increased slightly after 5 days. Infected plants were mainly located around the central virus-infected source plant, and the percentage of aphid occupation and CMV-infected plants did not differ significantly in absence and presence of natural enemies. The distribution patterns of A. gossypii and CMV were only coincident close to the central plant. The complexity of multitrophic interactions and the role of aphid predators in the spread of CMV are discussed.

  8. Densidades y frecuencias de liberación de Encarsia formosa (Hymenoptera: Aphelinidae) sobre Trialeurodes vaporariorum (Homoptera: Aleyrodidae) en tomate

    OpenAIRE

    Tello Paola; Cantor Fernando; Rodríguez Daniel; Cure José Ricardo

    2007-01-01

    La mosca blanca de los invernaderos, Trialeurodes vaporariorum (Westwood) (Homoptera: Aleyrodidae) es una de las plagas más importantes de cultivos de tomate bajo invernadero en la Sabana de Bogotá. Para su control tradicionalmente se acude a la aplicación de insecticidas. Sin embargo, también son contempladas liberaciones del parasitoide Encarsia formosa (Gahan) (Hymenoptera: Aphelinidae). Para estandarizar el proceso de cría mas...

  9. Ability of Aphis gossypii and Myzus persicae to Transmit Cucumber mosaic virus in Single and Mixed Infection with Two Potyviruses to Zucchini Squash Eficiência dos afídeos Aphis gossypii e Myzus persicae na transmissão do Cucumber mosaic virus em infecção simples e mista com dois Potyvirus para abobrinha de moita

    Directory of Open Access Journals (Sweden)

    Zayame Vegette Pinto

    2008-06-01

    Full Text Available The main objective of this work was to investigate the ability of Aphis gossypii and Myzus persicae to transmit Cucumber mosaic virus (CMV singly and mixed with two potyviruses (Papaya ringspot virus - type W, PRSV-W and Zucchini yellow mosaic virus, ZYMV, to zucchini squash plants (Cucurbita pepo. The results showed that the potyviruses in general were more efficiently transmitted by both species of aphids as compared to CMV. The transmission of PRSV-W, ZYMV and CMV separately was more efficient than in mixture.O objetivo desse trabalho foi estudar a eficiência de Aphis gossypii e Myzus persicae na transmissão do vírus do mosaico do pepino (Cucumber mosaic virus, CMV, isoladamente e em mistura com duas espécies de potyvirus (Vírus do mosaico do mamoeiro = Papaya ringspot virus - type W, PRSV-W e Vírus do mosaico amarelo da abobrinha = Zucchini yellow mosaic virus, ZYMV, para planta-testes de abobrinha de moita (Cucurbita pepo. Os dois potyvirus em geral foram transmitidos com mais eficiência pelas duas espécies de afídeos do que o CMV. A transmissão do PRSV-W, ZYMV e CMV, separadamente, foi mais eficiente do que em mistura.

  10. Aspectos biológicos de Coccidophilus citricola (Coleoptera, Coccinellidae sobre Aspidiotus nerii e Chrysomphalus aonidum (Homoptera, Diaspididae Biological studies of Coccidophilus citricola (Coleoptera, Coccinellidae on Aspidiotus nerii and Chrysomphalus aonidum (Homoptera, Diaspididae

    Directory of Open Access Journals (Sweden)

    Antonio Cesar dos Santos

    2005-02-01

    Full Text Available Aspectos biológicos de Coccidophilus citricola Brèthes (Coleoptera, Coccinellidae foram estudados sobre Chrysomphalus aonidum Linnaeus e Aspidiotus nerii Bouchè (Homoptera, Diaspididae criadas sobre abóbora. Observou-se a duraç��o (dias do período de ovo, dos quatro ínstares, pré-pupa, pupa, longevidade de adultos e a proporção machos: fêmeas de C. citricola. Determinou-se também verificar a eficiência de predação de adultos de C. citricola sobre A. nerii. C. aonidum e A. nerii são presas adequadas para C. citricola, com desenvolvimento semelhante do coccinelídeo sobre essas cochonilhas; o período de incubação do ovo foi de 7,9 e 8,1 dias com A. nerii e C. aonidum; a duração (dias de cada ínstar larval de C. citricola sobre A. nerii e C. aonidum foram respectivamente de: (I 2,7 e 2,9; (II 3,1 e 3,3; (III 3,0 e 3,3 e (IV 3,2 e 3,1 dias. A duração das fases de pré-pupa e pupa foi de 2,5 e 4,5 dias sobre A. nerii e 2,8 e 4,8 dias sobre C. aonidum e a viabilidade de ovo a adulto foi de 63,2% e 62,7% respectivamente para indivíduos criados sobre essas presas. A longevidade de adultos de C. citricola foi de 57,0 dias com A. nerii e de 62,0 dias com C. aonidum. A proporção macho: fêmea foi de 0,82:1,00. O consumo diário de C. citricola foi de 1,15 adultos ou 2,35 ninfas de 2o ínstar ou 3,16 ninfas de 1o ínstar de A. nerii por dia.Laboratory trials were carried out to study biological aspects of Coccidophilus citricola Brèthes (Coleoptera: Coccinellidae on Chrysomphalus aonidum Linnaeus and Aspidiotus nerii Bouché (Homoptera: Diaspididae. The scales were reared on squashes and then served as food source to the predator. The period of egg, larvae (four ínstars, pre-pupae, pupae, adults’ longevity and male: female ratio was observed. Predatory efficacy of C. citricola on A. nerii was also determined. The period of egg was 7.9 and 8.1 days on A. nerii and C. aonidum. The development (days of different stages of C

  11. Insectes ravageurs et propriétés biocides de Jatropha curcas L. (Euphorbiaceae : synthèse bibliographique

    Directory of Open Access Journals (Sweden)

    Abdoul Habou, Z.

    2013-01-01

    Full Text Available Insect pests and biocidal properties of Jatropha curcas L. (Euphorbiaceae. A review. Jatropha curcas is a Euphorbiaceae shrub widely distributed in many tropical countries. Its seeds are rich in oil that can be used as biofuel in modified diesel engines. Several insect species, mainly belonging to Hemiptera, Coleoptera and Orthoptera, have been referenced as insect pests of J. curcas. These insects attack the plant and cause damage to fruits, inflorescences and leaves. The most frequently observed pests belong to the genus Pachycoris (Heteroptera: Scutelleridae, which are widely distributed in Mexico, Australia, United States of America, Brazil and Nicaragua. Pachycoris spp. cause significant damage to the fruits, leading to the malformation of seeds and a reduction in their oil content. Although Jatropha shrubs are subjected to insect infestations, the oil has been shown to demonstrate biocidal activity, including insecticidal effects against several insect pests, including Busseola fusca (Fuller (Lepidoptera: Noctuidae, Sesamia calamistis Hampson (Lepidoptera: Noctuidae, Aphis gossypii Glover (Homoptera: Aphididae and Callosobruchus chinensis L. (Coleoptera: Bruchidae. In the present paper, we summarize the work carried out on inventories of J. curcas insect pests as well as on the biocidal activity of its oil.

  12. Analysis of the populations genetic variability of Tagosodes orizicolus (Homoptera: Delphacidae), virus vector of the rice white leaf

    International Nuclear Information System (INIS)

    Hernandez Alfaro, Myriam

    2006-01-01

    Tagosodes orizicolus (Homoptera: Delphacidae), is a monophagous insect of the rice and virus vector of the white leaf (RHBV). It is distributed in America Central, El Caribe, part of the America del Sur and in Costa Rica it is in all the producing zones of rice. The genetic variability was analyzed by means of RAPD-PCR of individuals from three populations of Costa Rica: Parrita, Guanacaste (Liberia) y San Carlos (Santa Clara), that they are found separated geographically. The technique consisted of amplifying regions at random of the genome of these insects utilizing five primers. A total of 72 polymorphic bands were obtained, that upon being analyzed statistically by means of the multivariate analysis program of numerical taxonomy could show a clear genetic distancing among said populations. The genetic distance observed in the molecular analysis can be explained for the climatic and/or geographical isolation of the populations or by the incident of Wolbachia, riquettsia that induces cytoplasmic sterility in insects. These symbionts are transmitted of generation in generation, of the mother to their offspring and they cause reproductive alterations as cytoplasmic incompatibility, parthenogenesis and feminization. The presence of Wolbachia was determined by means of transmission electronic microscopy being observed in the greasy and muscular weave of the abdomen of T. orizicolus. Rickettsias present pleomorphic morphology and form small groups, that are characterized for the presence of electrondense material semidetached to the cell wall with an interior electronlucent. Its size in transverse cuts ranged between 520 nm of length X 470 nm of width. In addition, its presence was detected by means of the amplification by PCR of the genomic DNA of the insects; a specific primer for the DNA ribosomal 16S of Wolbachia was utilized for it. A 86% of insects of the San Carlos population were positive, a 96% was determined for Guanacaste, a 37% for Parrita and a 100% for

  13. Climatic factors and populational dynamics of Mahanarva posticata (Stal-1855) (Homoptera-Cercopidae) as a contribution to a possible regional implantation of the sterile male technique

    International Nuclear Information System (INIS)

    Oliveira, M.L. de

    1981-01-01

    A field study on the population dynamics of M. posticata (STAL, 1855) (Homoptera-Cercopidae) was carried out from 1971 to 1978 under the ecological conditions prevailing in the Litoral-Mata-Sul Zone of Pernambuco, Brazil. The results indicated that maximal infestation of the sugar cane crops by the insect generally occured in June and in July, and it was dependent on rainfall, temperature and relative humidity. The population density of adults was decreased markedly during the months of January, February and March. Technical and economical viability of the insect control by the male-sterilization-techniques through radiation was also demonstrated. The technique is to be used isolated or with other conventional procedures in the combat of froghopper infestations in the sugar cane growing in Pernambuco, Brazil. (Author) [pt

  14. Actividad fagodisuasiva de las plantas Tithonia diversifolia y Montanoa hibiscifolia (Asteraceae sobre adultos del insecto plaga Bemisia tabaci (Homoptera: Aleyrodidae

    Directory of Open Access Journals (Sweden)

    Gina Bagnarello

    2009-12-01

    Full Text Available Bemisia tabaci (Gennadius (Homoptera: Aleyrodidae es una plaga polífaga, cosmopolita y de gran relevancia mundial, sobre todo como vector de virus en numerosos cultivos, por lo que sería deseable un enfoque preventivo para su manejo. En tal sentido, podría recurrirse a la utilización de sustancias repelentes o disuasivas, algunas de ellas presentes en plantas tropicales, lo cual contribuiría al aprovechamiento de la rica biodiversidad mesoamericana. Por tanto, se evaluó la posible actividad fagodisuasiva sobre los adultos de B. tabaci de dos especies silvestres de la familia Asteraceae: titonia (Tithonia diversifolia (Hemsl. A. Gray y tora (Montanoa hibiscifolia Benth.. Para ello, en condiciones de invernadero se evaluaron los extractos crudos y cuatro fracciones (hexano, diclorometano, acetato de etilo y metanol de ambas especies, a los cuales se les hizo un análisis fitoquímico (tamizaje el cual permitió determinar cuáles metabolitos presentes en T. diversifolia y M. hibiscifolia podrían causar fagodisuasión en B. tabaci. Se realizaron dos tipos de experimentos: de escogencia restringida y de escogencia irrestricta. En los primeros, cada fracción se evaluó a cuatro dosis (0.1, 0.5, 1.0 y 1.5% v/v, y se comparó con cuatro tratamientos testigo: aceite agrícola, endosulfán, un emulsificante (Citowett y un testigo absoluto (agua. Se asperjaron plantas de tomate colocadas dentro de jaulas de manga, donde se liberaron 50 adultos de B. tabaci. Para determinar si existía fagodisuasión se utilizó como criterio el número de adultos posados a las 48h. Para el experimento de escogencia irrestricta se utilizaron las dos concentraciones más altas (1.0 y 1.5% del extracto crudo de cada especie y se compararon con el aceite agrícola y agua. Los extractos crudos de titonia y tora causaron fagodisuasión, y para ambas especies la fracción de metanol fue la que más sobresalió. En conclusión, los resultados obtenidos en los bioensayos

  15. Diseño de planes de muestreo con niveles fijos de precisión del pulgón manchado de la alfalfa, Therioaphis trifolii Monell (Homoptera: Aphididae) en alfalfa (Medicago sativa L.)

    OpenAIRE

    Gyenge, Javier E.; Trumper, Eduardo V.; Edelstein, Julio D.

    1999-01-01

    El objetivo de este trabajo fue construir planes secuenciales de muestreo para el pulgón manchado de la alfalfa, Therioaphis trifolii Monell (Homoptera: Aphididae), con niveles fijos de precisión para estimar su densidad en función de toma de decisiones. El estudio de la disposición espacial basado en la Ley de Potencia de Taylor y regresión de Iwao, indicó que esta especie se distribuye de manera agregada en el cultivo de alfalfa, aunque con diferentes grados de agregación según el estado de...

  16. Phylogenetic position of the yeast-like symbiotes of Tagosodes orizicolus (Homoptera: Delphacidae based on 18S ribosomal DNA partial sequences

    Directory of Open Access Journals (Sweden)

    Ana M Xet-Mull

    2004-09-01

    Full Text Available Tagosodes orizicolus Muir (Homoptera: Delphacidae, the endemic delphacid species of tropical America carries yeast-like symbiotes (YLS in the abdominal fat bodies and the ovarial tissues, like other rice planthoppers of Asia. These YLS are obligate symbiotes, which are transmitted transovarially, and maintain a mutualistic relationship with the insect host. This characteristic has made in vitro culture and classification of YLS rather difficult using conventional methods. Nevertheless, microorganisms of similar characteristics have been successfully classified by using molecular taxonomy. In the present work, the YLS of Tagosodes orizicolus(YLSTo were purified on Percoll® gradients, and specific segments of 18S rDNA were amplified by PCR, cloned and sequenced. Sequences were aligned by means of the CLUSTAL V (DNASTAR program; phylogenetic trees were constructed with the Phylogeny Inference Package (PHYLIP, showing that YLSTo belong to the fungi class Pyrenomycetes, phylum Ascomycota. Similarities between 98% and 100% were observed among YLS of the rice delphacids Tagosodes orizicolus, Nilaparvata lugens, Laodelphax striatellus and Sogatella furcifera, and between 89.8% and 90.8% when comparing the above to YLS of the aphid Hamiltonaphis styraci. These comparisons revealed that delphacid YLS are a highly conserved monophyletic group within the Pyrenomycetes and are closely related to Hypomyces chrysospermus. Rev. Biol. Trop. 52(3: 777-785. Epub 2004 Dic 15.Tagosodes orizicolus Muir (Homoptera: Delphacidae es una especie endémica de América tropical que al igual que otros saltahojas de Asia, tiene simbiontes levaduriformes (YLS, por sus siglas en Inglés en los cuerpos grasos del abdomen y en los tejidos de los ovarios. Los YLS son simbiontes obligados que se transmiten transovarialmente y que mantienen relaciones mutualística con el insecto hospedero. Esta característica ha hecho muy difícil su cultivo in vitro y por ende su clasificaci

  17. Effect of insecticides on mealybug destroyer (Coleoptera: Coccinellidae) and parasitoid Leptomastix dactylopii (Hymenoptera: Encyrtidae), natural enemies of citrus mealybug (Homoptera: Pseudococcidae).

    Science.gov (United States)

    Cloyd, Raymond A; Dickinson, Amy

    2006-10-01

    In this study, we measured, under laboratory conditions, the direct and indirect effects of insecticides on mealybug destroyer, Cryptolaemus montrouzieri Mulsant (Coleoptera: Coccinellidae), and parasitoid Leptomastix dactylopii Howard (Hymenoptera: Encyrtidae), natural enemies of citrus mealybug, Planococcus citri (Risso) (Homoptera: Pseudococcidae). The adult stages of both natural enemies were exposed to sprays of the insecticides buprofezin, pyriproxyfen, flonicamid, acetamiprid, dinotefuran, and clothianidin at label-recommended rates to assess direct mortality after 24, 48, and 72 h, respectively. The effects of the insecticides on L. dactylopii parasitization rate and percentage of parasitoid emergence also were monitored using the label and 4x the recommended label rate. Dinotefuran was extremely detrimental to the adult parasitoid at the label rate with 100% mortality after 24 h. Buprofezin, pyriproxyfen, and flonicamid were not harmful to L. dactylopii when applied at the label rate. At 4x the recommended label rate, dinotefuran, acetamiprid, and clothianidin were all harmful to the parasitoid with 100% mortality 72 h after application. Both buprofezin and flonicamid were not toxic to L. dactylopii with 100% adult survival after 72 h. Pyriproxyfen and flonicamid, at both the label and 4x the recommended label rate, did not negatively affect L. dactylopii parasitization rate or percentage of parasitoid emergence. Acetamiprid, dinotefuran, and clothianidin were toxic to C. montrouzieri adults with 100% mortality after 48 h, whereas buprofezin, pyriproxyfen, and flonicamid demonstrated minimal (10-20% mortality after 48 h) harmful effects to the predator. Based on the results from our study, the indirect effects of the insect growth regulator (IGR) buprofezin were not decisive; however, the IGR pyriproxyfen and the insecticide flonicamid were not directly or indirectly harmful to the predator C. montrouzieri and parastioid L. dactylopii, indicating that

  18. Densidades y frecuencias de liberación de Encarsia formosa (Hymenoptera: Aphelinidae sobre Trialeurodes vaporariorum (Homoptera: Aleyrodidae en tomate

    Directory of Open Access Journals (Sweden)

    Tello Paola

    2007-12-01

    Full Text Available

    La mosca blanca de los invernaderos, Trialeurodes vaporariorum (Westwood (Homoptera: Aleyrodidae es una de las plagas más importantes de cultivos de tomate bajo invernadero en la Sabana de Bogotá. Para su control tradicionalmente se acude a la aplicación de insecticidas. Sin embargo, también son contempladas liberaciones del parasitoide Encarsia formosa (Gahan (Hymenoptera: Aphelinidae. Para estandarizar el proceso de cría masiva de E. formosa, se evaluaron tres densidades diferentes de liberación de las avispas (6, 12 y 18 avispas/planta en tres frecuencias de liberación (1, 2 y 3 veces/semana, sobre plantas de tomate de ocho semanas de edad con tres niveles de infestación (15, 30 y 45 ninfas de mosca blanca/hoja, susceptibles de ser parasitadas. El mayor porcentaje de parasitismo (70% en ninfas de tercer instar se logró cuando se liberaron seis avispas por planta, dosificadas en tres momentos diferentes en la misma semana. El menor porcentaje de parasitismo (50%, se obtuvo cuando se realizó una sola liberación de 6, 12 o 18 avispas. Los resultados anteriores permiten concluir que se puede lograr un porcentaje de parasitismo en torno a un 70% de la infestación de mosca blanca (hasta 45 ninfas/hoja en plantas de tomate con pocas avispas de E. formosa (seis cuando se liberan en tres momentos diferentes.

  19. Effets biocides des alcaloïdes, des saponines et des flavonoïdes extraits de Capsicum frutescens L. (Solanaceae sur Bemisia tabaci (Gennadius (Homoptera : Aleyrodidae

    Directory of Open Access Journals (Sweden)

    Blenzar A.

    2005-01-01

    Full Text Available Biocide effects of alkaloids, saponins and flavonoids extracted from Capsicum frutescens L. (Solanaceae on Bemisia tabaci (Gennadius (Homoptera: Aleyrodidae. In an attempt to elaborate a strategy of integrated pest management on vegetable crops in Morocco, insecticidal activities of alkaloids, saponins and flavonoids extracted from Capsicum frutescens L. fruits against eggs and adults of Bemisia tabaci infesting tomato plants, Lycopersicon esculentum Mill. var. Daniella, were carried out under controlled conditions. Alkaloids, saponins and flavonoids, dissolved in ethanol at 1%, were tested at 0, 5, 10 and 20 g.l-1. The three compounds affected egg and adult survival, significantly. The mortality of embryo and adult varied according to the compound considered and for each compound according to concentration and exposure duration. For eggs, the corrected mortality varied from 35 to 59% for alkaloids, 14 to 31% for saponins and 10 to 14% for flavonoids. In adults, the mortalities were spread from 29% to 86%, 14 to 48% and 6 to 29% with alkaloids, saponins and flavonoids, respectively. Significant correlation between egg and adult mortality, due to the compounds tested, were observed. However, eggs required higher concentrations than adults; the LC50 was 13.78 vs. 6.83 g.l-1 for alkaloids, 98.63 vs. 32.28 g.l-1 for saponins and nontoxic vs. 120.65 g.l-1 for the flavonoids. Therefore, alkaloids were shown more effective against B. tabaci than saponins or flavonoids. However, the LT50 estimated for compounds, killing more than 50% of the population studied, was sufficient for viruliferous adults to inoculate TYLCV to plants before they died. The use of these compounds in integrated pest management merit further study.

  20. Partial leaf chemical profiles of a desert watermelon species (Citrullus colocynthis) and heirloom watermelon cultivars (Citrullus lanatus var. lanatus)

    Science.gov (United States)

    Whiteflies [Bemisia tabaci (Gennadius)] and aphids [Aphis gossypii Glover and Myzus persicae (Sulzer)] are serious threats to watermelon by direct feeding and by transmitting viruses of important virus diseases. The desert watermelon Citrullus colocynthis (L.) has been shown to exhibit resistance t...

  1. The entomopathogenic fungal endophytes Purpureocillium lilacinum (formerly Paecilomyces lilacinus and Beauveria bassiana negatively affect cotton aphid reproduction under both greenhouse and field conditions.

    Directory of Open Access Journals (Sweden)

    Diana Castillo Lopez

    Full Text Available The effects of two entomopathogenic fungal endophytes, Beauveria bassiana and Purpureocillium lilacinum (formerly Paecilomyces lilacinus, were assessed on the reproduction of cotton aphid, Aphis gossypii Glover (Homoptera:Aphididae, through in planta feeding trials. In replicate greenhouse and field trials, cotton plants (Gossypium hirsutum were inoculated as seed treatments with two concentrations of B. bassiana or P. lilacinum conidia. Positive colonization of cotton by the endophytes was confirmed through potato dextrose agar (PDA media plating and PCR analysis. Inoculation and colonization of cotton by either B. bassiana or P. lilacinum negatively affected aphid reproduction over periods of seven and 14 days in a series of greenhouse trials. Field trials were conducted in the summers of 2012 and 2013 in which cotton plants inoculated as seed treatments with B. bassiana and P. lilacinum were exposed to cotton aphids for 14 days. There was a significant overall effect of endophyte treatment on the number of cotton aphids per plant. Plants inoculated with B. bassiana had significantly lower numbers of aphids across both years. The number of aphids on plants inoculated with P. lilacinum exhibited a similar, but non-significant, reduction in numbers relative to control plants. We also tested the pathogenicity of both P. lilacinum and B. bassiana strains used in the experiments against cotton aphids in a survival experiment where 60% and 57% of treated aphids, respectively, died from infection over seven days versus 10% mortality among control insects. Our results demonstrate (i the successful establishment of P. lilacinum and B. bassiana as endophytes in cotton via seed inoculation, (ii subsequent negative effects of the presence of both target endophytes on cotton aphid reproduction using whole plant assays, and (iii that the P. lilacinum strain used is both endophytic and pathogenic to cotton aphids. Our results illustrate the potential of

  2. EFEITOS DA TEMPERATURA DE INCUBAÇÃO SOBRE O FUNGO colletotrichum gossypii South. var. cephalosporioides EFFECT OF TEMPERATURE INCUBATION ON THE FUNGUS Colletotrichum gossypi SOUTH. Var. cephalosporioides COSTA

    Directory of Open Access Journals (Sweden)

    Yvo de Carvalho

    2007-09-01

    Full Text Available

    Estudou-se o efeito da temperatura de incubação sobre o crescimento vegetativo, esporulação e morfologia da colônia do fungo Colletotrichum gossypii South. var. cephalosporioides Costa, em substrato de batata + dextrose + agar, pH 5,6. O delineamento experimental usado foi o de blocos casualizados e as temperaturas variaram de 12 a 33°C, a intervalos de 3° C. Concluiu-se que a temperatura de incubação afeta notavelmente o crescimento vegetativo, a esporulação e a morfologia da colônia do fungo. Temperaturas acima da faixa ótima provocaram modificações mais acentuadas sobre o crescimento miceliano, esporulação e aspecto morfológico, do que temperaturas baixas. Conídios produzidos em temperaturas extremas, 12 a 33°C, mostraram-se mais curtos que os dos demais tratamentos. A incubação à temperatura de 27°C é a mais recomendável para produção de inóculos em quantidade.

    In this work, the effect of temperature of incubation on the vegetative growth, sporulation and morphology of the colony of the fungus colletotrichum gossypii South. var. cephalosporioides Costa in substrate containing potato + dextrose + agar pH 5.6, was studied. The experimental design used was that of randomized blocks, with temperatures varying from 12 to 33 degrees centigrades, at intervals of 3°C. It was concluded that the temperature of incubation notably affects the vegetative growth, sporulation and morphology of the colony of this fungus. Temperatures above the optimum range caused greater changes in mycelial, sporulation an morphology of the colony than temperatures below this range. Conidia produced at l2 and 33°C were shown to be shorter than those in other treatments. The temperature of incubation recommended for inocule production was 27°C.

  3. Population Growth of Rhopalosiphum padi L. (Homoptera: Aphididae on Different Cereal Crops from the Semiarid Pampas of Argentina under Laboratory Conditions Crecimiento Poblacional de Rhopalosiphum padi L. (Homoptera: Aphididae sobre Diferentes Cereales de la Pampas Semiárida de Argentina en Condiciones de Laboratorio

    Directory of Open Access Journals (Sweden)

    Lilian R Descamps

    2011-09-01

    Full Text Available The bird cherry-oat aphid Rhopalosiphum padi L. (Homoptera: Aphididae is one of the main pests in a number of crops in the semiarid Pampas of Argentina. In the present study, the effect of different host plants, including Triticum aestivum L., ×Triticosecale Wittm., Hordeum vulgare L., Hordeum distichum L., Avena sativa L., and Secale cereale L. on biological parameters of R. padi L. was studied in the laboratory at 24 ± 1 °C, 65 ± 10% RH and a 14:10 photoperiod. Longevity, intrinsic rate of natural increase (r m, net reproductive rate (R0, mean generation time (T, doubling time (DT, and finite rate of increase (λ of the bird cherry-oat aphid on the different cereal crops were estimated. Differences in fertility life table parameters of R. padi among host plants were analyzed using pseudo-values, which were produced by Jackknife re-sampling. Results indicated that beer barley might be the most suitable food for R. padi due to greater adult longevity (20.88 d, higher fecundity (41 nymphs female-1, higher intrinsic rate of natural increase (0.309 females female-1 d-1, lower doubling time (2.24, and lower nymphal mortality (22.2%. Therefore, it can be concluded from the present study that R. padi prefers beer barley for fast and healthy development over other cereal crops.El áfido Rhopalosiphum padi L. (Homoptera: Aphididae es una de las principales plagas de numerosos cultivos de la región semiárida pampeana de Argentina. En el presente trabajo se estudió el efecto de diferentes cereales incluidos Triticum aestivum L., ×Triticosecale Wittm., Hordeum vulgare L., Hordeum distichum L., Avena sativa L. and Secale cereale L. sobre los parámetros biológicos de R. padi en laboratorio. Se estimaron longevidad, tasa intrínseca de crecimiento natural (r m, tasa neta de reproducción (R0, tiempo generacional medio (T, tiempo de duplicación (TD, y tasa finita de incremento (λ del pulgón de la avena en diferentes cereales. Las diferencias de

  4. Presence of the Aphid, Chaetosiphon fragaefolii, on Strawberry in Argentina

    OpenAIRE

    C?dola, Claudia; Grecob, Nancy

    2010-01-01

    Seasonal abundance of the strawberry aphid complex under different agronomic practices in the outskirts of La Plata, Argentina was studied on strawberry, Fragaria x ananassa Duchesne (Rosales: Rosaceae). Aphid densities were low in strawberry fields in which insecticides and fungicides were used. In addition to Aphis gossypii, Aphis fabae, Mysus persicae and Macrosiphum euphorbiae, the aphid, Chaetosiphon fragaefolii (Cockerell) (Homoptera: Aphididae), was recorded for the first time in this ...

  5. Efeito de restritores hídricos sobre a germinação, comprimento da radícula e níveis de detecção de Colletotrichum gossypii var. cephalosporioides em sementes de algodão

    Directory of Open Access Journals (Sweden)

    Alderi Emídio de Araújo

    2012-03-01

    Full Text Available O fungo Colletotrichum gossypii var. cephalosporioides, agente causal da ramulose do algodoeiro, é transmitido pela semente que se constitui em uma das mais importantes fontes de inóculo inicial e de introdução da doença em áreas indenes. Para que se possa identificar sua presença em lotes de sementes, é importante que se empreguem métodos de detecção rápidos e seguros. O mais empregado é o do papel de filtro, que se baseia na avaliação de sinais do patógeno desenvolvidos sobre as sementes, seguida da sua identificação morfológica. O método apresenta a desvantagem do crescimento das plântulas no período de incubação das sementes que pode favorecer o desenvolvimento de outros fungos e prejudicar a caracterização do patógeno. Para minimizar este problema vem sendo empregada a técnica da restrição hídrica. O presente trabalho teve como objetivo avaliar o efeito de três solutos em dois potenciais osmóticos, comparados ao tratamento padrão de água destilada, ao congelamento e ao 2,4 D, sobre a germinação, comprimento da radícula e detecção do agente causal da ramulose, durante o teste de sanidade. Os solutos Manitol e NaCl foram mais eficientes em inibir a germinação e favorecer a incidência do patógeno no potencial osmótico de -0,8 MPa. O KCl mostrou-se eficiente em inibir a germinação nos dois potenciais osmóticos testados, -0,6 e -0,8 MPa, porém reduziu a incidência do patógeno no potencial de -0,8 MPa. Os solutos Manitol, nos potenciais osmóticos de -0,8 e -0,6 MPa e o NaCl no potencial osmótico de -0,8 foram eficientes em reduzir o comprimento da radícula, sem interferir negativamente nos níveis de detecção de C. gossypii var. cephalosporioides, podendo ser recomendados para uso em análises sanitárias de rotina.

  6. Ecology of black pineleaf scale (Homoptera: Diaspididae)

    Energy Technology Data Exchange (ETDEWEB)

    Edmunds, G.F. Jr.

    1973-10-01

    The ecology of black pineleaf scale which occurs on several species of pine and Douglas fir causing defoliation, discoloration of foliage, and reduced growth is reviewed. All known outbreaks of this scale have been caused by reduction in the population of Prosphaltella parasitoid that normally keeps the scale populations at very low densities. Abnormal mortality of Prosphaltella has been found to be caused either by the presence of sorptive dusts or by drift of insecticides. High population densities of scale have been found mainly in areas of high dust fall resulting from industrial sources and roadways. No known causal relationships have been found to exist between atmospheric fluorides and the black pineleaf scale population density. Environmental improvement to conserve the Prosphaltella parasitoids appears to be the most effective control measure.

  7. Acyrthosiphon pisum (Harris) (Homoptera: Aphididae) infestation ...

    African Journals Online (AJOL)

    Plant height, plant density per 0.25 m2, number of pea aphids and parasitoids per plant, ladybird beetles per plot, and finally grain yield per plot were recorded. Based on the results of the ANOVA, plant height was significantly different between treated and untreated plots especially after the vegetative stage. The density of ...

  8. Morfologia externa dos cicadellinae (homoptera, cicadellidae: comparação entre versigonalia ruficauda (walker (cicadellini e tretogonia cribrata melichar (proconiini, com notas sobre outras espécies e análise da terminologia External morphology of the cicadellinae (homoptera, cicadellidae: comparison between versigonalia ruficauda (walker (cicadellini and tretogonia cribrata melichar (proconiini, with notes on other species and an analysis of the structural terminology

    Directory of Open Access Journals (Sweden)

    Gabriel Mejdalani

    1998-01-01

    Full Text Available The external morphology of two cicadelline species, Versigonalia ruficauda (Walker, 1851 (Cicadellini and Tretogonia cribrata Melichar, 1926 (Proconiini, is analyzed. The head, axillary sclerites, wing venation, female genitalia, and tegumentary processes are described. Notes on other Cicadellini - Amblyscarlidia albofasciata (Walker, 1851, Tettisama quinquemacidata (Germar, 1821, Macugonalia lencomelas (Walker, 1851, and Diedrocephala variegata (Fabricius, 1775 - and Proconiini - Ciccus adspersus (Fabricius, 1803, Homoscarta superciliaris (Jacobi, 1905, Ichthyobelus sp., and Rhaphirrhinus phosphoreus (Linnaeus, 1758 - are added. A technique for dissecting the female genitalia is presented. The facial porlion of head in V. ruficauda, T. cribrata, and remaining species has a large sclerite (frons or postfrontofrons clearly defined by the frontogenal suture. Below the frons, and separated from it by the epistomal suture, a smaller sclerite is present (clypeus. The identification of these sclerites is based on comparisons with descriptions in the literature of a generalized Pterygota, a Psocoptera, a fossil Hemipteroidea, and other Homoptera. The conclusions about the identities of frons and clypeus corroborate the hypotheses of Hamilton (1981 on the homologies of cephalic areas in Rhynchota. The facial sclerites have modifications related with the xyleniomyzous diet. The frons is swollen, providing a larger area for attachmcnt of cibarial muscles. Other modifications increasing the area of frons are observed in the Proconiini. In C. adspersus its lateral margins are distinctly pronounced and its upper portion has a pair of lateral elevations. In Ichthyobelus sp. and R. phosphoreus the upper part of frons is greatly developed, occupying 4/5 of dorsal area of head on middle line. The vertex is limited to a small portion (1/5 of that area. The clypeus is also swollen, a fact related with the greater development of cibarium. This character is more

  9. Diversidade de afídeos na cultura do algodoeiro no município de Campo Verde (MT

    Directory of Open Access Journals (Sweden)

    Michelotto Marcos Doniseti

    2003-01-01

    Full Text Available O objetivo deste trabalho foi verificar a diversidade de afídeos (Hemiptera: Aphididae na cultura do algodoeiro (Gossypium hirsutum L. no município de Campo Verde (MT. Os afídeos foram amostrados diretamente nas plantas e através de armadilhas tipo Moericke. As amostragens foram realizadas a cada dois dias, até 60 dias após a germinação das plantas. A espécie Aphis gossypii Glover prevaleceu nas amostragens realizadas sobre as plantas. Formas aladas, de ocorrência acidental na cultura, tais como Aphis spiraecola Patch e Rhopalosiphum padi (Linnaeus também foram observadas. Com as armadilhas tipo Moericke foram capturados 2280 afídeos alados, pertencentes a 13 espécies: R. padi (52,6% do total, A. spiraecola (26,4%, A. gossypii (8,9%, Rhopalosiphum maidis (Fitch (5,3%, Geopemphigus floccosus (Moreira (3,1%, Uroleucon ambrosiae (Thomas (1,5%, Rhopalosiphum rufiabdominalis (Sasaki (1,3%, Myzus persicae (Sulzer (0,4%, Sipha flava (Forbes (0,3%, Pentalonia nigronervosa Coquerel, Tetraneura nigriabdominalis (Sasaki, Lizerius melanocallis (Quednau e Toxoptera citricidus (Kirkaldy (0,1% cada uma. Nas amostragens diretamente sobre as plantas foram observados ápteros e alados de A. gossypii e alados de A. spiraecola e R. padi. Nas armadilhas tipo Moericke, as principais espécies capturadas foram R. padi, A. spiraecola, A. gossypii e R. maidis.

  10. Effect of alternative prey on development and consumption of Orius insidiosus (Say) (Hemiptera, Anthocoridae) and oviposition behavior on chrysantemum cultivars

    International Nuclear Information System (INIS)

    Soglia, Maria da Conceicao M.; Bueno, Vanda Helena Paes; Carvalho, Livia Mendes

    2007-01-01

    This work aimed to evaluate the development time and the consumption of Orius insidiosus (Say, 1832) feeding on Aphis gossypii Glover, 1877 as well as its oviposition behavior on two chrysanthemum cut cultivars. The trials were conducted in climatic chamber at 25 ± 1 deg C, RH 70 ± 10% and 12h photo phase. Nymphs of the predator, less than 24h old, were kept individually in petri dishes (5cm) with 20 nymphs of A. gossypii (first, second and third instar) on leaf disc (4 cm) of each cultivar ('White Reagan' and 'Yellow Snowdon') in a layer of agar-water (1%). Petiole of each chrysanthemum cultivar as oviposition substrate was evaluated and the females were feeding on eggs of Anagasta kuehniella (Zeller, 1879). The predator complete its development feeding on A. gossypii kept in both cultivars. The duration of nymphal phase of O. insidiosus were 21.1 and 18.3 days on 'White Reagan' and 'Yellow Snowdon', respectively. The consumption of the females of O. insidiosus was higher (P<0.01) on A. gossypii in 'White Reagan' (2.63 nymphs) compared to the consumption in 'Yellow Snowdon' (0.7 nymphs). Females of O. insidiosus oviposited in petiole of both cultivars with 22.5 and 23.3 eggs/female on 'White Reagan' and 'Yellow Snowdon', respectively. Release of O. insidiosus on chrysanthemum crops could be important to decrease the A. gossypii population, as the predator completes its development having this aphid as prey, and the chrysanthemum cultivars offer conditions to colonization and establishment of O. insidiosus. (author)

  11. Effect of alternative prey on development and consumption of Orius insidiosus (Say) (Hemiptera, Anthocoridae) and oviposition behavior on chrysantemum cultivars; Efeito da presa alternativa no desenvolvimento e consumo de Orius insidiosus (Say) (Hemiptera, Anthocoridae) e comportamento de oviposicao em cultivares de crisantemo

    Energy Technology Data Exchange (ETDEWEB)

    Soglia, Maria da Conceicao M. [Universidade Federal da Bahia (UFBA), Cruz das Almas, BA (Brazil). Centro de Ciencias Agrarias e Ambientais], e-mail: mcsoglia@yahoo.com.br; Bueno, Vanda Helena Paes; Carvalho, Livia Mendes [Universidade Federal de Lavras (UFLA), MG (Brazil). Dept. de Entomologia], e-mail: vhpbueno@ufla.br

    2007-10-15

    This work aimed to evaluate the development time and the consumption of Orius insidiosus (Say, 1832) feeding on Aphis gossypii Glover, 1877 as well as its oviposition behavior on two chrysanthemum cut cultivars. The trials were conducted in climatic chamber at 25 {+-} 1 deg C, RH 70 {+-} 10% and 12h photo phase. Nymphs of the predator, less than 24h old, were kept individually in petri dishes (5cm) with 20 nymphs of A. gossypii (first, second and third instar) on leaf disc (4 cm) of each cultivar ('White Reagan' and 'Yellow Snowdon') in a layer of agar-water (1%). Petiole of each chrysanthemum cultivar as oviposition substrate was evaluated and the females were feeding on eggs of Anagasta kuehniella (Zeller, 1879). The predator complete its development feeding on A. gossypii kept in both cultivars. The duration of nymphal phase of O. insidiosus were 21.1 and 18.3 days on 'White Reagan' and 'Yellow Snowdon', respectively. The consumption of the females of O. insidiosus was higher (P<0.01) on A. gossypii in 'White Reagan' (2.63 nymphs) compared to the consumption in 'Yellow Snowdon' (0.7 nymphs). Females of O. insidiosus oviposited in petiole of both cultivars with 22.5 and 23.3 eggs/female on 'White Reagan' and 'Yellow Snowdon', respectively. Release of O. insidiosus on chrysanthemum crops could be important to decrease the A. gossypii population, as the predator completes its development having this aphid as prey, and the chrysanthemum cultivars offer conditions to colonization and establishment of O. insidiosus. (author)

  12. Efeito da presa alternativa no desenvolvimento e consumo de Orius insidiosus (Say (Hemiptera, Anthocoridae e comportamento de oviposição em cultivares de crisântemo Effect of alternative prey on development and consumption of Orius insidiosus (Say (Hemiptera, Anthocoridae and oviposition behavior on chrysantemum cultivars

    Directory of Open Access Journals (Sweden)

    Maria da Conceição M. Soglia

    2007-12-01

    Full Text Available Este trabalho teve como objetivo avaliar o desenvolvimento e o consumo de Orius insidiosus (Say, 1832 tendo Aphis gossypii Glover, 1877 como presa, bem como seu comportamento de oviposição em duas cultivares de crisântemo. O experimento foi conduzido em câmara climática a 25 ± 1ºC, UR 70 ± 10% e fotofase de 12 horas. Ninfas do predador com até 24 horas de idade foram colocadas individualmente em placas de petri (5 cm contendo 20 ninfas de A. gossypii (1º, 2º e 3º ínstares, as quais estavam posicionadas sobre disco foliar (4 cm de cada cultivar ('White Reagan' e'Yellow Snowdon' em camada de ágar-água . Na avaliação da oviposição foram utilizados pecíolos de cada cultivar como substrato de oviposição e ovos de Anagasta kuehniella (Zeller, 1879 como alimento. O predador completou seu desenvolvimento alimentando-se somente de A. gossypii presente em ambas as cultivares. A duração da fase ninfal de O. insidiosus foi de 21,1 e 18,3 dias, em 'White Reagan' e 'Yellow Snowdon', respectivamente. O consumo de A. gossypii por fêmeas foi maior (PThis work aimed to evaluate the development time and the consumption of Orius insidiosus (Say, 1832 feeding on Aphis gossypii Glover, 1877 as weel as its oviposition behavior on two crysanthemum cut cultivars. The trials were conducted in climatic chamber at 25±1ºC, RH 70±10% and 12h photophase. Nymphs of the predator, less than 24h old, were kept individualy in petri dishes (5cm with 20 nymphs of A. gossypii (1st, 2nd and 3rt instars on leaf disc (4cm of each cultivar ("White Reagan" and "Yellow Snowdon" in a layer of agar-water (1%. Petiole of each crysanthemum cultivar as oviposition substrate was evaluated and the females were feeding on eggs of Anagasta kuehniella (Zeller, 1879. The predador complete its development feeding on A. gossypii kept in both cultivars. The duration of nymphal phase of O. insidiosus were 21.1 and 18.3 days on "White Reagan" and "Yellow Snowdon", respectively

  13. Seed Treatment Combined with a Spot Application of Clothianidin Granules Prolongs the Efficacy of Controlling Piercing-Sucking Insect Pests in Cotton Fields.

    Science.gov (United States)

    Zhang, Zhengqun; Zhao, Yunhe; Wang, Yao; Li, Beixing; Lin, Jin; Zhang, Xuefeng; Mu, Wei

    2017-09-13

    Seed treatments can directly protect cotton from early season piercing-sucking insect Aphis gossypii Glover but hardly provide long-term protection against Apolygus lucorum (Meyer-Dür). Therefore, the efficacy of clothianidin seed treatments combined with spot applications of clothianidin granules at the bud stage of cotton was evaluated to control piercing-sucking pests during the entire cotton growing season. Clothianidin seed treatments (at the rate of 4 g ai/kg seed) combined with a clothianidin granular treatment (even at low rate of 0.9 kg ai/ha) at the bud stage can effectively suppress A. gossypii and A. lucorum infestations throughout the seedling and blooming stages after planting and can improve cotton yield. The spot application of clothianidin granules also reduced the population densities of Bemisia tabaci (Gennadius). The dynamic changes of clothianidin residues demonstrated that the control efficacy of clothianidin against A. gossypii and A. lucorum might be related to the residues of this neonicotinoid in cotton leaves. This pest management practice provided long-term protection against cotton piercing-sucking pests for the entire growing season of cotton plants and could supplement the short-term control efficiency of clothianidin used as a seed treatment.

  14. Hubungan Pemencaran Kutu Daun dengan Diseminasi Potato Virus Y (PVY pada Tanaman Kentang (Solanum tuberosum L.

    Directory of Open Access Journals (Sweden)

    Reymas M. R. Ruimassa

    2003-07-01

    Full Text Available Two aphid species, Myzus persicae (Sulzer, and Aphis gossypii (Glover and the five potato varieties (Alpha, Bintje, Berthaultii, Granola and Premiere were used in the experiments to study the relationship between insect vector dispersal and dissemination of disease caused by potato virus Y (PVY. The results showed that M. persicae could cause time for the appearance of first symptom two to four time faster than A. gossypii . Although statistical analysis (anova in general showed that disease incidence is not significantly different for each treatment. M. persicae caused higher disease incidence than A. gossypii on Bintje (56 and 74 days after planting. M. persicae seems to have better capability to disperse when the plant reach vegetative growth stadia which may result in higher efficiency of transmitting the virus. The relationship between aphid dispersal and dissemination of PVY can be grouped into four categories (1 plant with aphid and showing symptom; (2 plant without aphid but showing symptom; (3 plant with aphid but without symptom; (4 plant without aphid and without symptom.

  15. Presence of Native Prey Does Not Divert Predation on Exotic Pests by Harmonia axyridis in Its Indigenous Range.

    Directory of Open Access Journals (Sweden)

    Gui Fen Zhang

    Full Text Available In China, two invasive pests, Bemisia tabaci MEAM1 (Gennadius and Frankliniella occidentalis (Pergande, often co-occur with the native pest, Aphis gossypii (Glover, on plants of Malvaceae and Cucurbitaceae. All three are preyed on by the native ladybird, Harmonia axyridis (Pallas; however, the native predator might be expected to prefer native prey to the exotic ones due to a shared evolutionary past. In order to clarify whether the presence of native prey affected the consumption of these two invasive species by the native predator, field-cage experiments were conducted. A duplex qPCR was used to simultaneously detect both non-native pests within the gut of the predator. H. axyridis readily accepted both invasive prey species, but preferred B. tabaci. With all three prey species available, H. axyridis consumption of B. tabaci was 39.3±2.2% greater than consumption of F. occidentalis. The presence of A. gossypii reduced (by 59.9% on B. tabaci, and by 60.6% on F. occidentalis, but did not stop predation on the two exotic prey when all three were present. The consumption of B. tabaci was similar whether it was alone or together with A. gossypii. However, the presence of aphids reduced predation on the invasive thrips. Thus, some invasive prey may be incorporated into the prey range of a native generalist predator even in the presence of preferred native prey.

  16. Calling songs of some South African cicadas (Homoptera: Cicadidae)

    African Journals Online (AJOL)

    1987-07-13

    Jul 13, 1987 ... Tape recordings of calling males were made at various times of day, between October, 1984 and February, ... A sustained noise composed of evenly spaced double pulses. Narrow band sonagrams show a ..... the calls are strictly constrained by the physics of the sound-producing organs, while the temporal ...

  17. Strawberry resistance to the aphid Chaetosiphon fragaefolii Cockerell (Homoptera: Aphididae

    Directory of Open Access Journals (Sweden)

    Slobodan Milenković

    2014-12-01

    Full Text Available Cross-sections of leaf blades and petioles of different strawberry genotypes exhibiting different levels of resistance to Chaetosiphon fragaefolii were studied using the paraffin method, and staining with safranin, crystal violet and light green. Besides thicker cell walls of the cortex collenchyma in the more resistant genotypes, and a proportionally wider collenchyma than parenchyma in the cortex, their midribs are also encircled by a ring of more intensely stained lignified cells forming a physical ring. This stain reaction of cells to safranin and crystal violet occurs also in lateral vascular bundles, as well as in leaf palisade tissue. The tissue cross-sections of the sensitive genotypes revealed a predominance of green on the cellulose cell walls and protoplasts due to the reaction to light green SF, while stain reactions to safranin and crystal violet were not evidenced.

  18. A synopsis of the tribe Micrutalini Haupt (Homoptera, Membracidae, Smiliinae

    Directory of Open Access Journals (Sweden)

    Albino M. Sakakibara

    1999-01-01

    Full Text Available The tribe Micrutalini and its two genera, Trachytalis Fowler and Micrutalis Fowler, are redescribed. The following species are treated and, in some cases, nomenclatura! changes introduced: Trachytalis isabellina Fowler, 1895; T. distinguenda Fowler, 1895; T. retrofasciata (Lethierry, 1890, comb.n.; Micrutalis alrovena Goding, 1930; M. balteata (Fairmaire, 1846 = Aculalis lucidus Buckton, 1902, syn.n.; M. bella Goding, 1929; M. biguttula (Fairmaire, 1846, comb.n.; M. binaria (Fairmaire, 1846 = Acutalis flavivenlris Lethierry, 1890, syn.n.; M. callan-gensis Goding, 1930; M. calva (Say, 1830; M. discalis (Walker, 1858; M. dorsalis (Fitch, 1851; M. dubia Fowler, 1895 = M. zeteki Goding, 1928, syn.n.; M. flava Goding, 1929; M. flavozonala (Fairmaire, 1846, comb.n. = Acutalis geniculata Stál, 1862, syn.n. = Acutalis modesta Stál, 1862, syn.n.; M. godfreyi Sakakibara, 1976; M. incerla Sakakibara, 1976; M. lata Goding, 1930; M. litlerala (Fairmaire, 1846, comb.n.;M lugubrina(Stál, 1862;M malleiferaFovj]er, 1895 = M binariamutabilis Fowler, 1895, syn.n.; M. minutus Buckton, 1902; M. nigrolineata (Stál, 1864; M. nigromarginata Funkhouser, 1940; M. notalipennis Fowler, 1895; M. occidentalis (Goding, 1893; M. pollens Fowler, 1895; M. parva (Goding, 1893; M. plagíala (Stál, l&62 = AcutalisvariabiIisBerg, 1879,syn.n. =M. chapadensisGoding, 1930,syn.n.; M. punctifera (Walker, 1858; M. semialba (Stál, 1862; M. stipulipennis Buckton, 1902; M. tau Goding, 1930; M. trifurcala Goding, 1893; M. tripunctata (Fairmaire, 1846 = Acutalis moesta Stál, 1859, syn.n. = M. tartaredoides Goding, 1930, syn.n.. New species: Micrutalis diminuta sp.n. (Ecuador, Pichincha; Micrutalis divisa sp.n. (Brazil, Mato Grosso; Micrutalis henki sp.n. (Panama, Canal Zone; Micrutalis infúscala sp.n. (Venezuela, Portuguesa; Micrutalis margínala sp.n. (Brazil, Mato Grosso; Micrutalis meridana sp.n. (Venezuela, Mérida; Micrutalis mucuya sp.n. (Venezuela, Mérida; Micrutalis robustula sp.n. (Venezuela, Caracas; M. seminigra sp.n. (Brazil, Paraná; Micrutalis turriba sp.n. (Costa Rica, Turrialba. Lectotypes are designated for: Acutalis balteata Fairmaire, 1846, Aculalis binaria Fairmaire, 1846, Acutalis flavozonala Fairmaire, 1846, una Acutalis tripunctata Fairmaire, 1846. New taxonomic position: Micrutalis melanogramma (Petty, 1833 is transferred to Melu-sinella Metcalf, 1952 (Ceresini - Melusinella melanogramma (Petty, 1833, comb.n. = Melusinella nervosa (Fairmaire, 1846, syn.n.. Species incertae sedis: Tragopa ephippium Burmeister, 1836.

  19. Notes sur les Orgeriini d'Espagne (Homoptera)

    NARCIS (Netherlands)

    Blöte, H.C.

    1957-01-01

    Notre connaissance du groupe des Orgeriini est d'origine récente. La première espèce qu'on a fait la description est Bursinia hemiptera, qui provient d'Italie et qui est décrit comme Fulgora par O. G. Costa en 1840. En 1849 L. Dufour a décrit Dyctiophora longipes et D. genei, étant des espèces qu'on

  20. Range Expansion of Metcalfa pruinosa (Homoptera: Fulgoroidea in Southeastern Europe

    Directory of Open Access Journals (Sweden)

    Cristina Preda

    2011-07-01

    Full Text Available The citrus flatid planthopper Metcalfa pruinosa, a Nearctic species of Fulgoroidea: Flatidae, was accidentally introduced in Europe, first in Italy in the late 1970’s. In a few decades, Metcalfa pruinosa has spread over most of Europe, finally reaching the Black Sea coast in 2009. Hundreds of individuals of different life stages were observed for the first time in the southeastern part of Romania throughout the summer of 2009 on several host plants: Hibiscus syriacus, Ligustrum vulgare, Robinia pseudoacacia, Evonymus japonicus, Spirea x vanhouttei, Aesculus hippocastanum, Philadelphus coronarius, Ficus carica, Vitis vinifera, Fraxinus pennsylvanica. The number of individuals observed and the area covered increased dramatically in 2010 as well as the number of host plants (110 species in 49 families, suggesting the planthopper is in the expansion phase of the invasion process.

  1. Distributional patterns and possible origin of leafhoppers (Homoptera, Cicadellidae

    Directory of Open Access Journals (Sweden)

    Mervin W. Nielson

    2000-03-01

    Full Text Available The zoogeographical distribution of 42 cicadellid subfamilies and their assigned tribes and genera is compiled with distributional maps and proposed dispersal pathways of genera that are shared interzoogeographically. Possible origin of the subfamilies and tribes is proposed in an ancestral context from which the more modern extant groups evolved whereas origin of genera is in a more modern context. Notwithstanding their complex biogeography, the distributional data of the higher groups indicate that all of the cosmopolitan and near cosmopolitan subfamilies arose during early Cretaceous or possibly the late Jurassic period (140-116 m.y.a. when continental drift was in its early stages. Nearly all of the New World and some Old World subfamilies are considered of more recent origin (late Cretaceous-Tertiary. Ninety percent of the known genera (2,126 are endemic to their respective zoogeographical region and subregion, thus indicating relatively high host specificity and low rate of dispersal. The majority (76% of known extant genera are pantropical in origin, suggesting early or possible Gondwanaland origin of their ancestors. Dispersal pathways of genera shared by more than one zoogeographical region were generally south to north (Neotropical/Nearctic, Oriental/Palaearctic or west to east (Palaearctic/Nearctic, Oriental/Australian, from regions of high diversity to regions of low diversity and from warmer climates to cooler climates. The most diverse and richest leafhopper fauna are present in the Neotropical and Ethiopian regions although taxal affinities between them are poorest. The most depauperate fauna are in the Nearctic region and in Australia, reflecting the impact of isolating and ecological factors on distribution and radiation. Ecological barriers were more evident between the Ethiopian and Oriental fauna than between any other zoogeographical combination. Taxal affinities appeared to be correlated with close continental proximities. Vicariance (physical was the principal event that appealed to explain the distribution of many subfamilies and tribes whereas dispersal accounted for distribution of the majority of interzoogeographical genera.

  2. Migration, trapping and local dynamics of whiteflies (Homoptera: Aleyrodidae)

    DEFF Research Database (Denmark)

    Riis, Lisbeth; Nachman, Gösta

    2006-01-01

    1 The ability to quantify whitefly migration provides a tool that can contribute to an improved understanding of the epidemic development of whitefly-transmitted viruses. 2 In an attempt to develop a protocol for estimating whitefly immigration and emigration rates in an annual crop, new traps...... to population growth. 4 A model for changes in whitefly density during an entire bean (Phaseolus vulgaris L.) crop cycle, including an immigration parameter, was also developed. 5 Non-attractant window traps surrounding an annual field crop were assumed to intercept whiteflies immigrating into and emigrating...... away from the crop. Captures on these traps could not categorically be identified as immigrants or emigrants, but the cumulated captures nevertheless explained 66% of the variation in population density found within the field. Hence, window traps may be used as an efficient and reliable alternative...

  3. Calling songs of some South African cicadas (Homoptera: Cicadidae)

    African Journals Online (AJOL)

    1987-07-13

    Jul 13, 1987 ... Calling songs were recorded on high quality magnetic tape (Scotch. standard play) at a speed of 38 em/sec ..... by reinforcement. S. Afr. f. Sci. 74: 369-371. PATERSON, H.E. 1985. The recognition concept of species. In: Species and Speciation. Ed. E. Vrba. Transvaal Museum Monograph No.4, TraQsvaal ...

  4. Appearance of Neotoxoptera formosana (Homoptera: Aphididae) in The Netherlands

    NARCIS (Netherlands)

    Piron, P.G.M.

    2010-01-01

    Neotoxoptera formosana (Takahashi) is a pest of wild and cultivated Allium species, but never iwht disastrous consequences. In 1984, N. formosana was found in France. This was the first finding in Europe. Since then, N. formosana has been observed also in other European countries. The first record

  5. Influence Of Phytolyma lata (Homoptera: Psyllidae) On Seedling ...

    African Journals Online (AJOL)

    Milicia excelsa (Iroko) is a valuable timber species occurring naturally in the humid forests of Africa. The high quality and great demand of wood obtained from M. excelsa has resulted in its overexploitation. Attempts at establishing large scale plantations to ensure sustained production have been hampered by the gall ...

  6. Quality of different aphids as hosts of the parasitoid Lysiphlebus testaceipes (Cresson) (Hymenoptera: Braconidae, Aphidiinae); Qualidade de diferentes especies de pulgoes como hospedeiros do parasitoide Lysiphlebus testaceipes (Cresson) (Hymenoptera: Braconidae, Aphidiinae)

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Robson J.; Bueno, Vanda H.P. [Universidade Federal de Lavras, MG (Brazil). Dept. de Entomologia]. E-mail: vhpbueno@ufla.br; Sampaio, Marcus V.[Universidade Federal de Uberlandia (UFU), MG (Brazil). Inst. de Ciencias Agrarias]. E-mail: mvsampaio@iciag.ufu.br

    2008-03-15

    Lysiphlebus testaceipes (Cresson) has a broad aphid host range; however the quality of these preys may interfere in its biological feature. This study aimed to evaluate the quality of three Macrosiphini, Brevicoryne brassicae (L.), Lipaphis erysimi (Kaltenbach) and Myzus persicae (Sulzer), and three Aphidini Schizaphis graminum (Rondani) Rhopalosiphum maidis (Fitch) and Aphis gossypii Glover as hosts to L. testaceipes and to determine the relation possible of host preference, of size and quality of the host. The tests were carried out in climatic chamber at 25 {+-} 1 deg C, RH 70 {+-} 10% and 12h photophase. The parasitoid did not oviposite in B. brassicae and L. erysimi, while the other species were nutritionally suitable to the parasitoid. L. testaceipes showed preference for aphids from tribe Aphidini and these hosts presented better quality to the parasitoid when compared to Macrosiphini. Interactions among size, preference and quality between the Aphidini were found. L. testaceipes showed preference (parasitism rate 76.7%) for R. maidis, the bigger host (hind tibia with 0.281 mm). This host provided bigger size (hind tibia with 0.49 mm) and higher emergence rate (95.6%) to the parasitoid when compared to A. gossypii (parasitism rate of 55.7%). Also the smaller host A. gossypii (0.266 mm) provided smaller size hind tibia (0.45 mm) and higher mortality of the parasitoid (emergence rate 72.1%). However, the development time was shorter and the longevity was higher in A. gossypii (6.3 and 5.4 days, respectively) when compared to the host R. maidis (6.7 and 3.8 days, respectively), and not been related to host size. (author)

  7. Intercropping System for Protection the Potato Plant from Insect Infestation

    Directory of Open Access Journals (Sweden)

    Aziza Sharaby

    2015-06-01

    Full Text Available The use of intercropping system provides an option for insect control for organic farmers that are limited in their chemical use. Additionally, intercropping systems can be attractive to conventional growers as a cost-effective insect control solution. A study was carried out for two seasons 2011-2012 and 2012-2013 to evaluate the effect of intercropping of potato (Solanum tuberosum L. with onion (Allium cepa L. on whitefly (Bemicia tabasi Gennadius and aphids’ Myzus persicae Sulz. and Aphis gossypii Glover infestation in potato fields. Results indicated that intercropping significantly reduced potato plant infestation with whitefly by 42.7, 51.3% while it was 62.69% reduction with aphids during the two successive winter seasons than when potato plants were cultivated alone. Therefore, intercropping could be recommended as a protection method of reducing pest population in the fields.

  8. Análise Faunística de Insetos Associados à Cultura do Quiabeiro [Abelmoschus esculentus (L. Moench] em Plantio Comercial, no Município de Canindé de São Francisco, SE, Brasil

    Directory of Open Access Journals (Sweden)

    Daniele Cristina Silva

    2016-08-01

    Abstract. This research aims to study the entomofauna associated with the commercial cultivation of okra in municipality of Canindé do São Francisco, Sergipe State, Brazil, through faunal analysis. The species Bemisia tabaci (Gennadius biotype B, Aphis gossypii (Glover, Phenacoccus sp., Icerya purchasi (Maskell and Lagria villosa (Fabricius were the okra key pests. Diabrotica speciosa (Germar and Gryllus assimilis (Fabricius were plagues of secondary importance. And Leptoglossus zonatus (Dallas, Nezaraviridula L., Pachycoris torridus (Scopoli and Oxycarenus hyalinipennis (Costa were sporadic pests. Four species of predatory insects were found, a constant and dominant (Cycloneda sanguinea L. a dispersed, but constant (Eriopis connexa German and two rare (Hippodamia convergens Guérin-Méneville and Psyllobora confluens F..

  9. The influence of natural enemies on wing induction in Aphis fabae and Megoura viciae (Hemiptera: Aphididae).

    Science.gov (United States)

    Kunert, G; Schmoock-Ortlepp, K; Reissmann, U; Creutzburg, S; Weisser, W W

    2008-02-01

    Previous studies have shown that the aphid species, Aphis fabae Scopoli and Megoura viciae Buckton, do not produce winged offspring in the presence of natural enemies, in contrast to results for the pea aphid (Acyrthosiphon pisum (Harris)) and the cotton aphid (Aphis gossypii Glover); but these studies did not involve exposing aphids directly to natural enemies. We exposed colonies of both A. fabae and M. viciae to foraging lacewing (Chrysoperla carnea (Stephens)) larvae and found that the predators did not induce winged morphs among offspring compared to unexposed controls. Colonies of A. fabae responded to an increase in aphid density with increasing winged morph production, while such response was not found for M. viciae. We suggest that different aphid species differ in their susceptibility to natural enemy attack, as well as in their sensitivity to contact.

  10. EPIDEMIOLOGICAL ASPECTS OF COTTON RAMULOSIS (Colletotrichum gossypii SOUTH. Var. cephalosporioides COSTA ASPECTOS EPIDEMIOLÓGICOS DA RAMULOSE (Colletotrichum gossypii South. var. cephalosporioides Costa DO ALGODOEIRO (Gossypium hirsutum L.

    Directory of Open Access Journals (Sweden)

    Fuad Calil

    2007-09-01

    Full Text Available

    These experiments deal with the effects of outbreak of early, medium and late developing ramulosis on the IAC-13.l variety of cotton, which was seeded at three different intervals in Itauçu (Goiás—Brazil. The effects of the ramulosis on the height and weight of the plants, on the number of bolls, and on the weight of the cotton seeds and lints, were studied. The experiments were installed in a flat area of red latosoil. The experimental design was one of random blocks with six repetitions and the plants were classified, at the end of their vegetative growth, into the following categories: healthy, early ramulosis, medium ramulosis and late developing ramulosis. The early and medium ramulosis affected more significantly the studied parameters, and it was observed that varieties of cotton which were moderately resistant in relation to ramulosis, can be severely affected during growing seasons of heavy rains such as the 1975/76 season.

    Estudaram-se os efeitos da incidência precoce, mediana e tardia de ramulose sobre o peso e altura das plantas, número de capulhos, peso das sementes e da pluma de algodoeiro do cultivar IAC-l3.l em três épocas de semeadura (21/10/75, 21/11/75 e 23/12/75 no município de Itauçu (GO. O experimento foi instalado em região plana com latossolo vermelho. Foram utilizados blocos casualizados com seis repetições e plantas no final do ciclo vegetativo foram classificadas em quatro tipos: sadias, com ramulose precoce, com ramulose mediana ou com ramulose tardia. Concluiu-se que a forma precoce e também a mediana foram as que afetaram mais significativamente os parâmetros aferidos, e que cultivares tidos como de razoável comportamento em relação à ramulose, podem ser severamente afetados em anos agrícolas muito chuvosos como foi o de 1975/76.

  11. Synthesis and biological activity of pyridazine amides, hydrazones and hydrazides.

    Science.gov (United States)

    Buysse, Ann M; Yap, Maurice Ch; Hunter, Ricky; Babcock, Jonathan; Huang, Xinpei

    2017-04-01

    Optimization studies on compounds initially designed to be herbicides led to the discovery of a series of [6-(3-pyridyl)pyridazin-3-yl]amides exhibiting aphicidal properties. Systematic modifications of the amide moiety as well as the pyridine and pyridazine rings were carried out to determine if these changes could improve insecticidal potency. Structure-activity relationship (SAR) studies showed that changes to the pyridine and pyridazine rings generally resulted in a significant loss of insecticidal potency against green peach aphids [Myzus persicae (Sulzer)] and cotton aphids [(Aphis gossypii (Glover)]. However, replacement of the amide moiety with hydrazines, hydrazones, or hydrazides appeared to be tolerated, with small aliphatic substituents being especially potent. A series of aphicidal [6-(3-pyridyl)pyridazin-3-yl]amides were discovered as a result of random screening of compounds that were intially investigated as herbicides. Follow-up studies of the structure-activity relationship of these [6-(3-pyridyl)pyridazin-3-yl]amides showed that biosteric replacement of the amide moiety was widely tolerated suggesting that further opportunities for exploitation may exist for this new area of insecticidal chemistry. Insecticidal efficacy from the original hit, compound 1, to the efficacy of compound 14 produced greater than 10-fold potency improvement against Aphis gossypii and greater than 14-fold potency improvement against Myzus persicae. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

  12. Transgenic Bt Cotton Does Not Disrupt the Top-Down Forces Regulating the Cotton Aphid in Central China.

    Directory of Open Access Journals (Sweden)

    Yong-Sheng Yao

    Full Text Available Top-down force is referred to arthropod pest management delivered by the organisms from higher trophic levels. In the context of prevalent adoption of transgenic Bt crops that produce insecticidal Cry proteins derived from Bacillus thuringiensis (Bt, it still remains elusive whether the top-down forces are affected by the insect-resistant traits that introduced into the Bt crops. We explored how Bt cotton affect the strength of top-down forces via arthropod natural enemies in regulating a non-target pest species, the cotton aphid Aphis gossypii Glover, using a comparative approach (i.e. Bt cotton vs. conventional cotton under field conditions. To determine top-down forces, we manipulated predation/parasitism exposure of the aphid to their natural enemies using exclusion cages. We found that the aphid population growth was strongly suppressed by the dominant natural enemies including Coccinellids, spiders and Aphidiines parasitoids. Coccinellids, spiders and the assemblage of other arthropod natural enemies (mainly lacewings and Hemipteran bugs are similarly abundant in both plots, but with the parasitoid mummies less abundant in Bt cotton plots compared to the conventional cotton plots. However, the lower abundance of parasitoids in Bt cotton plots alone did not translate into differential top-down control on A. gossypii populations compared to conventional ones. Overall, the top-down forces were equally strong in both plots. We conclude that transgenic Bt cotton does not disrupt the top-down forces regulating the cotton aphid in central China.

  13. Evaluation and application of parasitoids for biological control of Aphis gossypii in glasshouse cucumber crops

    NARCIS (Netherlands)

    Steenis, van M.

    1995-01-01

    Introduction
    Aphids are an important problem in glasshouse vegetables. Already at low aphid densities fruits can get contaminated with honeydew, which decreases the economical value of the fruits. When aphids feed on the growing tips of the plants, the new shoots can get heavily

  14. Evaluation and application of parasitoids for biological control of Aphis gossypii in glasshouse cucumber crops

    NARCIS (Netherlands)

    Steenis, van M.

    1995-01-01

    Introduction
    Aphids are an important problem in glasshouse vegetables. Already at low aphid densities fruits can get contaminated with honeydew, which decreases the economical value of the fruits. When aphids feed on the growing tips of the plants, the new shoots can

  15. Results of Sediment Sampling and Elutriate Testing at the Proposed Glovers Point Shallow Water Habitat Project Site

    Science.gov (United States)

    2013-04-01

    hypoxia is primarily caused by excess nutrients – originating from cities, farms , and industries in the Mississippi River Basin – which cause extensive...the Missouri River because much of the topsoil portion of the sediment disposed of in the river has been heavily fertilized . The Nation Research...Total (mg/kg) (Arsenic, Cadmium, Chromium, Copper, Lead, Mercury, Nickel, Zinc)  Organochlorine Pesticide and PCB Scan (µg/kg

  16. Type of prey influences biology and consumption rate of Orius insidiosus (Say (Hemiptera, Anthocoridae

    Directory of Open Access Journals (Sweden)

    Simone M. Mendes

    2002-01-01

    Full Text Available Generalist predators are capable of consuming different types of prey, and as each prey may have distinct nutritional values, each may have a distinct impact on the biology of the predator. Therefore, the aim of this study was to determine how the consumption of different prey influences certain biological characteristics and the predatory capacity of Orius insidiosus (Say. The investigation was performed in climatic chamber at 25 ±1 ºC, RH 70 ± 10% and fotophase 12. Eggs of Anagasta kuehniella (Zeller, adults of Caliothrips phaseoli (Hood and nymphs of Aphis gossypii Glover were used as prey and were provided daily ad libitum for all the mobile stages of the predator. The results showed that biological parameters of O. insidiosus are affected differently depending on the type of prey ingested. The development time of the nymphal stage was 13.1, 11.23 and 10.25 days for O. insidiosus feeding on eggs of A. kuehniella, nymphs of A. gossypii and adults of C. phaseoli, respectively. Longevity was five times larger for adults fed on eggs of A. kuehniella (56.25 days compared to that of adults that preyed on nymphs of A. gossypii (11.44 days, and four times larger when the prey were adults of C. phaseoli (13.58 days. The consumption of eggs of A. kuehniella by predator females resulted in a shorter pre-oviposition period (3.2 days and a longer oviposition period (44.4 days when compared to the consumption of other types of prey. In addition, fecundity was increased with the consumption of eggs of A. kuehniella (195.25 eggs laid / female when compared to feeding on the other prey, C. phaseoli (70.00 eggs laid / female or A. gossypii (22.50 eggs laid / female. However, the consumption of aphids was larger (148.28 nymphs/ nymphal stage than that of thrips (74.10 thrips / nymphal stage or eggs of A. kuehniella (37.03 eggs /nymphal stage for all of the nymphal stages of the predator. The results indicate that the eggs of A. kuehniella are the type of

  17. Rapid detection of vip1-type genes from Bacillus cereus and characterization of a novel vip binary toxin gene.

    Science.gov (United States)

    Yu, Xiumei; Liu, Tao; Liang, Xiaoxing; Tang, Changqing; Zhu, Jun; Wang, Shiquan; Li, Shuangcheng; Deng, Qiming; Wang, Linxia; Zheng, Aiping; Li, Ping

    2011-12-01

    A PCR-restriction fragment length polymorphism (PCR-RFLP) method for identifying vegetative insecticidal protein (vip) 1-type genes from Bacillus cereus was developed by designing specific primers based on the conserved regions of the genes to amplify vip1-type gene fragments. PCR products were digested with endonuclease AciI, and four known vip1-type genes were identified. Vip1Ac and vip1Aa-type genes appeared in 17 of 26 B. cereus strains. A novel vip1-type gene, vip1Ac1, was identified from B. cereus strain HL12. The vip1Ac1 and vip2Ae3 genes were co-expressed in Escherichia coli strain BL21 by vector pCOLADuet-1. The binary toxin showed activity only against Aphis gossypii (Homoptera), but not for Coleptera (Tenebrio molitor, Holotrichia oblita), Lepidoptera (Spodoptera exigua, Helicoverpa armigera, and Chilo suppressalis), Diptera (Culex quinquefasciatus). The LC(50) of this binary toxin for A. gossypii is 87.5 (34.2-145.3) ng mL(-1) . This is probably only the second report that Vip1 and Vip2 binary toxin shows toxicity against homopteran pests. The PCR-RFLP method developed could be very useful for identifying novel Vip1-Vip2-type binary toxins, and the novel binary toxins, Vip1Ac1 and Vip2Ae3, identified in this study may have applications in biological control of insects, thus avoiding potential problems of resistance. © 2011 Federation of European Microbiological Societies. Published by Blackwell Publishing Ltd. All rights reserved.

  18. Toxic and Repellent effecto of Harmal (Peganum harmala L. Acetonic Extract on Several Aphids and Tribolium castaneum (Herbst Efecto Tóxico y Repelente del Extracto Acetónico de Harmal (Peganum harmala L. sobre varias especies de Áfidos y Tribolium castaneum (Herbst

    Directory of Open Access Journals (Sweden)

    Elham Salari

    2012-03-01

    Full Text Available To reduce the dependence on the sometimes unwise use of synthetic pesticides in fruit and vegetable plantations, the toxicity and repellence of Peganum harmala L. (Zygophyllaceae acetonic seed extract was assayed against several insect pests. For contact toxicity, 3- to 4-d-old individuals of Aphis fabae Scopoli, A. gossypii Glover, A. nerii Boyer de Fonscolombe, and Myzus persicae (Sulzer were included, as well as 1- to 7-d-old adult Tribolium castaneum (Herbst. Repellent effect experiments were conducted on adult, 1- to 2- and 3- to 4-d old M.persicae individuals. At 60 mg mL4, the topical bioassay mortality percentage was significantly higher in A. gossypii than in A. fabae and A. nerii after 12-72 h. Mortality of the treatments on M.persicae was 87.1% and 90.0% after 24 and 48 h, respectively, and significantly higher than A. fabae and A. nerii during this period. At 60 mg mL-1, the mortality of T. castaneum was much lower than that of the aphid species. The highest repellent index (over 72% was observed on 1- to 2-d-old M. persicae individuals.Para reducir la dependencia de los pesticidas sintéticos en plantaciones frutales y hortalizas, se realizó un ensayo para medir la toxicidad y repelencia de un extracto acetónico obtenido a partir de semillas de Peganum harmala L. (Zygophyllaceae contra diferentes especies de plagas. Para evaluar la toxicidad del extracto al contacto con los insectos, se incluyeron individuos de 3-4 d de edad de Aphis fabae Scopoli, Aphis gossypii Glover, Aphis nerii Boyer de Fonscolombe, y Myzus persicae (Sulzer, así como adultos 1-7 d de edad de Tribolium castaneum (Herbst. Experimentos para medir el efecto repelente se llevaron a cabo con individuos de 1-2 y 3-4 d de edad de M. persicae. En los resultados de los bioensayos tópicos el porcentaje de mortalidad fue significativamente mayor en la especie A. gossypii que en A. fabae y A. nerii, después de 12-72 h con una concentración de 60 mg mL-1. La mortalidad

  19. Caracterização da transmissão do vírus do mosaico-das-nervuras do algodoeiro pelo pulgão Aphis gossyphii com relação à persistência e ao tempo necessário para inoculação Characterization of cotton vein mosaic vírus by Aphis gossyphii transmission with relation to persistence and time necessary for inoculation

    Directory of Open Access Journals (Sweden)

    Marcos Doniseti Michelotto

    2007-01-01

    Full Text Available Na cultura do algodoeiro, Gossypium hirsutum L., o pulgão Aphis gossypii Glover, 1877 (Hemiptera: Aphididae destaca-se pela transmissão do vírus do mosaico-das-nervuras do algodoeiro. O objetivo deste trabalho foi avaliar a persistência da transmissão desse vírus por A. gossypii e determinar o período necessário para sua inoculação. No ensaio de persistência, 20 pulgões ápteros virulíferos foram individualizados e transferidos diariamente para plantas de algodoeiro sadias. O período necessário para inoculação foi determinado em adultos ápteros e alados virulíferos, que permaneceram confinados isoladamente em plantas sadias por períodos de 40 segundos, 45 minutos, 1,5 hora, 3, 6, 12, 24 e 48 horas. Observou-se que 35% dos pulgões transmitiram o vírus por mais de cinco plantas sucessivamente, no ensaio de persistência. Verificou-se transmissão por um período máximo de 12 dias após a aquisição, o que caracteriza a relação vírus-vetor como persistente. Os adultos ápteros transmitiram o vírus para maior percentual de plantas (75,0% quando o período de acesso à inoculação foi de 24 horas. Os alados transmitiram o vírus em todos os períodos de acesso à inoculação, com porcentagens variando de 5,0% (40 segundos a 60,0% (48 horas. A persistência da transmissão do vírus pelo pulgão e o aumento na eficiência de transmissão em função do aumento do período de acesso à inoculação revelam que a transmissão é do tipo circulativa.In cotton crops (Gossypium hirsutum L., the aphid Aphis gossypii Glover, 1877 (Hemiptera: Aphididae is a major sanitary factor due forts efficiency on transmission of cotton vein mosaic virus (CVMV. The objective of this work was to evaluate the persistence of CVMV on transmission by A. gossypii and to determine the necessary feeding period for inoculation. In the persistence assay, individual aphids wingless viruliferous were separately transferred daily to successive series of

  20. Distributional patterns and possible origins of the tribes and genera of Coelidiinae (Homoptera, Membracoidea, Cicadellidae

    Directory of Open Access Journals (Sweden)

    Mervin W Nielson

    2000-12-01

    Full Text Available Leafhoppers are well known biological indicators of zoogeographical regions owing, in part, to their phytodependency, high host plant specificity and relatively low vagility. In this connection, we discuss distributional patterns and possible zoogeographical origins of nine constituent tribes and their genera of the pantropical subfamily Coelidiinae. Among 118 known genera, only eight currently occupy more than one zoogeographical region, indicating an extremely high endemic profile which supports the proposed centers of origin and relatively low rate of intercontinental dispersal. The pantropical tribe Coelidiini is suggested as the basal group of the subfamily which is believed to have arisen prior to continental drift (late Jurassic-early Cretaceous because there appears to be no other evidence at the present time to explain its near cosmopolitan distribution. Possible origins of three Old World tribes, Hikangiini (Ethiopian, Thagriini (Oriental and Thanini (Australian and four New World -(Neotropical tribes, Teruliini, Tinobregmini, Gabritini and Sandersellini are elucidated. The tribe Youngolidiini occupies the Neotropical and Ethiopian realms but its origin is problematical. There appears to be ample evidence that origin/dispersal patterns are related to the geological history of the areas occupied by its faunal members.

  1. Comparative biology of three Scymnus lady beetles (Coleoptera: Coccinellidae): predators of Adelges tsugae (Homoptera: Adelgidae)

    Science.gov (United States)

    Wenhua Lu; Michael E. Montgomery

    2000-01-01

    Scymnus (Neopullus) sinuanodulus Yu et Yao, S. (N.) camptodromusYu et Liu, and Scymnus (Neopullus) n. sp. (in press) were collected in the People's Republic of China from hemlocks infested with the hemlock woolly adelgid, Adelges tsugae Annand. To date, 3 of the 14 provinces in China where...

  2. Life Table and Population Parameters of Nasonovia ribisnigri (Homoptera: Aphididae) at different Constant Temperatures

    OpenAIRE

    Díaz Desani, Beatriz M.; Fereres, Alberto

    2005-01-01

    Age-specific life tables of the lettuce aphid, Nasonovia ribisnigri (Mosley), feeding on lettuce were determined at different constant temperatures under controlled conditions. Our results showed that the proportion of alates increased with increasing temperatures, remaining below 7% at 16°C and increasing to 40–57% at a temperature above 20°C. The longest developmental time of apterous aphids was obtained at 8°C (31.5 d), and the shortest was at 26°C (6.2 d), whereas the developmental time o...

  3. Identification of Russian wheat aphid (Homoptera : Aphididae) populations virulent to the Dn4 resistance gene

    Czech Academy of Sciences Publication Activity Database

    Smith, C. M.; Belay, T.; Stauffer, CH.; Starý, Petr; Kubečková, I.; Starkey, S.

    2004-01-01

    Roč. 97, č. 3 (2004), s. 1112-1117 ISSN 0022-0493 R&D Projects: GA AV ČR IBS5007102 Grant - others:Kansas Agricultural Experiment Station(US) 04-120-J Institutional research plan: CEZ:AV0Z5007907 Keywords : Diuraphis noxia * barley * virulence Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection Impact factor: 1.283, year: 2004

  4. [The development of the mycetome in the embryo of Euscelis plebejus Fall. (Homoptera-Cicadina)].

    Science.gov (United States)

    Körner, Helge Klaus

    1969-03-01

    The egg of the leafhopper Euscelis plebejus contains 2 types of symbiontic bacteria classified by MüLLER (1949) as t- and a-symbionts. They are lodged near the posterior egg pole as a nearly spherical mass surrounded by periplasm. During anatrepsis of the germ band the volume of the symbiont mass increases considerably. At the same time the a-symbionts are taken up by primary a-mycetocytes which then form a spherical layer around the as yet extracellular mass of t-symbionts. When the mesoderm of the abdominal segments starts to differentiate into organ primordia, a cluster of presumably polyploid mesoderm cells leaves the 2nd abdominal segment and migrates towards the 5th and 6th abdominal segments where the symbionts are lodged. There these cells are filled with the t-symbionts which they harbour through all further stages of embryonic and postembryonic life. The a-symbionts before katatrepsis of the germ band appear to be taken over by a second type of a-mycetocyte which stems from the genital ridge of the 4th-6th abdominal segments and as a rule is binucleate. During and after katatrepsis the t-mycetocytes and secondary a-mycetocytes migrate from their medial position to the lateral walls of the abdomen where they form one compound mycetome on each side.

  5. Test for intercalary regeneration of the metameric pattern of the leafhopperEuscelis plebejus fall. (homoptera).

    Science.gov (United States)

    Vogel, Otto

    1983-09-01

    Immerging U-shaped germ bands of the leafhopperEuscelis plebejus were cut twice by constriction in order to combine the anterior and posterior ends of the embryo. Although these terminal parts fused in a number of cases, no intercalary regeneration was observed.In addition, the experiments revealed that constriction during anatrepsis (germ anlage extension) causes gaps of varying size in the abdominal part of the segment pattern.The data suggest that "differential adhesion" between yolk cells and the surface of the germ anlage might play a part in the immersion of the germ anlage into the yolk.

  6. General trends of chromosomal evolution in Aphidococca (Insecta, Homoptera, Aphidinea + Coccinea

    Directory of Open Access Journals (Sweden)

    Ilya Gavrilov-Zimin

    2015-07-01

    Full Text Available Parallel trends of chromosomal evolution in Aphidococca are discussed, based on the catalogue of chromosomal numbers and genetic systems of scale insects by Gavrilov (2007 and the new catalogue for aphids provided in the present paper. To date chromosome numbers have been reported for 482 species of scale insects and for 1039 species of aphids, thus respectively comprising about 6% and 24% of the total number of species. Such characters as low modal numbers of chromosomes, heterochromatinization of part of chromosomes, production of only two sperm instead of four from each primary spermatocyte, physiological sex determination, "larval" meiosis, wide distribution of parthenogenesis and chromosomal races are considered as a result of homologous parallel changes of the initial genotype of Aphidococca ancestors. From a cytogenetic point of view, these characters separate Aphidococca from all other groups of Paraneoptera insects and in this sense can be considered as additional taxonomic characters. In contrast to available paleontological data the authors doubt that Coccinea with their very diverse (and partly primitive genetic systems may have originated later then Aphidinea with their very specialised and unified genetic system.

  7. Mechanisms of Oryza sativa (Poaceae resistance to Tagosodes orizicolus (Homoptera: Delphacidae under greenhouse condition in Venezuela

    Directory of Open Access Journals (Sweden)

    Alex González

    2012-03-01

    Full Text Available Tagosodes orizicolus is one of the main plagues of rice in tropical America causing two types of damages, the direct one, feeding and oviposition effect, and an indirect one, by the transmission of the “Rice hoja blanca virus”. During 2006-2007 we carried out research under greenhouse conditions at Fundación Danac, Venezuela, in order to determine the mechanisms of antixenosis, antibiosis and tolerance to T. orizicolus, which could be acting in commercial varieties and advanced lines of the rice genetic breeding programs of INIA and Fundación Danac. The method of free feeding was used for the antixenosis evaluation, whereas the method of forced feeding was used for antibiosis evaluation (effect on survival and oviposition. Additionally, we used the indirect method based on biomass depression to estimate the tolerance. Some of the evaluated traits included: grade of damage, number of insects settling on rice plants, percentage of sogata mortality at the mature state, number of eggs in the leaf midrib and an index of tolerance. The results showed that rice genotypes possess different combinations of resistance mechanisms, as well as different grades of reactions. The susceptible control ‘Bluebonnet 50’ was consistently susceptible across experiments and the resistant control ‘Makalioka’ had high antixenosis and high antibiosis based on survival and oviposition. The rest of the genotypes presented lower or higher degrees of antixenosis and antibiosis for survival and viposition. The genotype ‘FD0241-M-17-6-1-1-1-1’ was identified with possible tolerance to the direct damage of sogata.Tagosodes orizicolus es una de las principales plagas del cultivo del arroz en América tropical causando dos tipos de daños a la planta, el directo, por efecto de la alimentación y oviposición; el indirecto, por la transmisión del virus de la hoja blanca del arroz. Durante el período 2006-2007 se llevó a cabo una investigación bajo condiciones de umbráculo en la Fundación Danac, Venezuela, con el objeto de determinar los mecanismos de resistencia de antixenosis, antibiosis y tolerancia a T. orizicolus que pudieran estar actuando en líneas avanzadas y cultivares del programa de mejoramiento enético de arroz de las instituciones INIA y Fundación Danac. Para la evaluación de antixenosis se utilizó el método de libre elección, para antibiosis (efecto sobre sobrevivencia y oviposición de los insectos el de alimentación forzada, adicionalmente se usó un método indirecto para estimar la tolerancia. Dentro de los principales parámetros determinados se encontraban: grado de daño, número de insectos posados sobre plantas de arroz, porcentaje de mortalidad de sogata en estado adulto, número de huevos y se calculó un índice de tolerancia con base en la biomasa. Los resultados mostraron que los genotipos de arroz evaluados poseen diferentes combinaciones en cuanto a los mecanismos de resistencia, así como el grado de su efecto. El testigo ‘Bluebonnet 50’ se mantuvo consistentemente susceptible en las evaluaciones y el testigo resistente ‘Makalioka’ fue el único genotipo que presentó alta antixenosis y alta antibiosis para sobrevivencia y oviposición. El resto de los genotipos presentaron un menor o mayor grado de resistencia de tipo antixenosis y antibiosis para sobrevivencia y oviposición. Se identificó el genotipo ‘FD0241-M-17-6-1-1-1-1’ con posible tolerancia al daño directo de sogata.

  8. A review of the leafhopper genus Jikradia with descriptions of four new species (Homoptera: Cicadellidae

    Directory of Open Access Journals (Sweden)

    Carolina Godoy

    1998-09-01

    Full Text Available The genus Jikradia Nielson extends from eastern North America to Central America and the Galapagos Islands. Four additional new species are described and illustrated: J. mexicana (Mexico J. longa (Costa Rica, Guatemala, Mexico, J. zurquiensis (Costa Rica and J. lizanoi (Costa Rica. J. mexicana general color is ochraceous; the aedeagus without seta-like spine. Jikradia longa, general color is light ochraceous; the aedeagus with long seta-like process subapically with three spine-like setae opposite to single subapical seta. Jikradia zurquiensis, general color brown; aedeagus with single seta-like process subapically with three small spine-like setae basad of single subapical setae on the opposite lateral margin of aedeagus. Jikradia lizanoi, general color brown; aedeagus asymmetrical, long, narrow, tube-like, in lateral aspect with sharply pointed apex, with two long seta-like processes subapically with four spine-like setae. A revised key to all known species, and subspecies, based on male genitalia, is also presented.Se describen e ilustran cuatro especies nuevas de Jikradia Nielson: J. mexicana (México J. longa (Costa Rica, Guatemala, México, J. zurquiensis (Costa Rica y J. lizanoi (Costa Rica. El trabajo inlcuye una clave ilustrada para todas las subespecies, con base en los aparatos genitales masculinos.

  9. Microsatellite marker analysis of peach-potato aphids (Myzus persicae, Homoptera: Aphididae) from Scottish suction traps.

    Science.gov (United States)

    Malloch, G; Highet, F; Kasprowicz, L; Pickup, J; Neilson, R; Fenton, B

    2006-12-01

    The peach-potato aphid Myzus persicae (Sulzer) is an important vector of plant viruses. A network of suction traps collects aerial samples of this aphid in order to monitor and help predict its spatial distribution and likely impact on virus transmission in crops. A suction trap catch is thought to be a good representation of the total aphid pool. Sensitive molecular markers have been developed that determine the genetic composition of the M. persicae population. In Scotland, UK, these were applied to field collections revealing a limited number of clones. Molecular markers are less successful when applied to specimens that have been preserved in an ethanol-based trap fluid designed to preserve morphology. An assessment of different DNA extraction and PCR techniques is presented and the most efficient are used to analyse M. persicae specimens caught in the Dundee suction trap in 2001, a year when exceptionally high numbers were caught. The results reveal that the majority of the M. persicae caught belonged to two highly insecticide resistant clones. In addition, it was possible to compare the relative frequencies of genotypes caught in the trap with those collected at insecticide treated and untreated field sites in the vicinity. These results indicate that, in addition to suction trap data, the ability to sample field sites provides valuable early warning data which have implications for pest control and virus management strategies.

  10. TOKSISITAS BEBERAPA HASIL EKSTRAK DAUN TEMBAKAU TERHADAP Myzus persicae (Homoptera;Aphididae

    Directory of Open Access Journals (Sweden)

    - Sudjak

    2015-09-01

    Full Text Available Penggunaan pestisida kimia sintetik yang tidak rasional dapat menyebabkan pencemaran air, tanah, udara, produk pertanian, keracunan manusia/pekerja, resistensi/resurgensi hama, terbunuhnya hewan bermanfaat, perubahan status hama, dan ledakan hama. Untuk itu dirasa perlu mencari pestisida alternatif untuk mendukung pertanian yang berkelanjutan . Melalui kegiatan penelitian yang bertahap telah diperoleh produk pestisida yang diesktrak dari sisa-sisa tanaman tembakau rakyat di lapang yaitu ekstrak 1, ekstrak 2, ekstrak 3, dan ekstrak 4.Kegiatan penelitian ini dilaksanakan di Laboratorium Entomologi Balai Penelitian Tanaman Pemanis dan Serat, Malang mulai bulan Januari sampai dengan Desember 2011.Tujuan penelitian untuk memanfaatkan tembakau sebagai bahan aktif pembuatan pestisida nabati.Untuk tiap-tiap ekstrak di buat lima macam konsentrasi, yaitu 100%, 50%, 25%, 12,5%, 6,25%, 3,125%, dan 0 (kontrol. Serangga uji yang digunakan adalah hama pengisap daun tembakau Myzus persicae. Masing-masing ulangan dengan 20 serangga uji.Data yang diperoleh dari setiap pengamatan dianalisis menggunakan Analisis Probit. Hasil penelitian menunjukkan bahwa empat ekstrak daun tembakau yang diuji terbukti menyebabkan toksisitas pada kutu daun tembakau M. persicae. Ekstrak 3 merupakan ekstrak yang paling toksit dibanding 3 ekstrak yang lain.  LC50 ekstrak 1, ekstrak 2, ekstrak 3, dan ekstrak 4 berturut-turut 35,53%, 26,93%, 5,08%, dan 5,2%. Kata kunci: Ekstrak tembakau, pestisida botani, M. persicae.

  11. The Hawaiian cave planthoppers (Homoptera: Fulgoroidea: Cixiidae - A model for rapid subterranean speciation?

    Directory of Open Access Journals (Sweden)

    Hannelore Hoch

    1997-01-01

    Full Text Available After the successful colonization of a single ancestral species in the Hawaiian Islands, planthoppers of the cixiid genus Oliarus underwent intensive adaptive radiation resulting in 80 described endemic species. Oliarus habitats range from montaneous rain forests to dry coastal biotopes and subterranean environments. At least 7 independant evolutionary lines represented by different species have adapted to lava tubes on Molokai (1, Maui (3, and Hawaii Island (3. Behavioral and morphological studies on one of these evolutionary lines on Hawaii Island, the blind, flight- and pigmentless Oliarus polyphentus have provided evidence for reproductive isolation between allopatric populations which may in fact be separate species. Significant differences in song parameters were observed even between populations from neighbouring lava tubes, although the planthoppers are capable of underground migration through the voids and cracks of the mesocavernous rock system which is extant in young basalt: after a little more than 20 years, lava tubes within the Mauna Ulu 1974 flow had been colonized by O. ‘polyphenius” individuals, most probably originating from a near-by forestkipuka. Amazingly, this species complex is found on the youngest of the Hawaiian Islands, with probably less than 0.5 m.y., which suggests rapid speciation processes. Field observations have led to the development of a hypothesis to match underground speciation with the dynamics of vegetational succession on the surface of active volcanoes. Planthopper range partitioning and geographic separation of populations by young lava flows, founder events and small population size may be important factors involved in rapid divergence.

  12. Observations of the larval stages of Diceroprocta apache Davis (Homoptera: Tibicinidae)

    Science.gov (United States)

    Ellingson, A.R.; Andersen, D.C.; Kondratieff, B.C.

    2002-01-01

    Diceroprocta apache Davis is a locally abundant cicada in the riparian woodlands of the southwestern United States. While its ecological importance has often been hypothesized, very little is known of its specific life history. This paper presents preliminary information on life history of D. apache from larvae collected in the field at seasonal intervals as well as a smaller number of reared specimens. Morphological development of the fore-femoral comb closely parallels growth through distinct size classes. The data indicate the presence of five larval instars in D. apache. Development times from greenhouse-reared specimens suggest a 3-4 year life span and overlapping broods were present in the field. Sex ratios among pre-emergent larvae suggest the asynchronous emergence of sexes.

  13. The tribe Acutalini Fowler (Homoptera, Membracidae, Smiliinae: new genera, new species and some nomenclatural changes

    Directory of Open Access Journals (Sweden)

    Albino M Sakakibara

    1997-09-01

    Full Text Available The tribe Acutalini Fowler is redescribed as well as the genera Acutalis Fairmaire, Euritea Stål, and Thrasymedes Kirkaldy. The following new taxa and nomenclatural changes are presented: Thrasymedes mexicana sp.n. (from Mexico, Oaxaca; Bordonia gen.n., with B. venezuelana sp.n. (type-species (from Venezuela, Portachuelo, B. clypeata sp.n. (from Colombia, Cuesta Boba, B. majuscula sp.n. (from Venezuela, Portachuelo, and Cornutalis gen.n., with C. cauca sp.n. (type-species (from Colombia, Cauca, and C. validu sp.n. (from Ecuador, Sto. Domingo. Acutalis fusconervosa Fairmaire, 1846 = Horiola venosa Walker, 1858, syn.n.; Euritea munda (Walker, 1858 = Stictolobus nitidus Funkhouser, 1940, syn.n.; Bordonia nigricosta (Goding, 1926, comb.n.; Bordonia virescens (Funkhouser, 1940, comb.n.. One species is transferred to Smiliinae-Ceresini: Tapinolobus curvispina (Walker, 1858, comb.n. (formerly in Thrasymedes = Tapinolobus fasciatus Sakakibara, 1969, syn.n.; another one is transferred to Darninae-Cymbomorphini: Eumela darnioides (Walker, 1858, comb.n. (formerly in Euritea.

  14. On the taxonomy of Anaceratagallia Zachvatkin, 1946 (Homoptera: Auchenorrhyncha: Cicadellidae: Agalliinae) of Western Kyrgyzstan.

    Science.gov (United States)

    Tishechkin, Dmitri Yu

    2017-06-01

    In Western Kyrgyzstan the genus Anaceratagallia includes four species: A. venosa (de Fourcroy, 1785), A. aciculata (Horvath, 1894), A. laevis (Ribaut, 1935) = A. acuteangulata Dubovskiy, 1966 nec Zachvatkin, 1946, and A. alabugensis Dubovskiy, 1966 = A. collicola Dubovskiy, 1966, syn. n. = A. turanica Dubovskiy, 1966, syn. n. = A. laevis Dubovskiy, 1966 nec Ribaut, 1935. Illustrated descriptions and male calling signal oscillograms for all species are given. The range of A. acuteangulata Zachvatkin, 1946 includes Italy, Greece, Turkey, and North Caucasus; records of this species from Ukraine, Kazakhstan and Central Asia are erroneous. Investigation of morphological and acoustic characters in Anaceratagallia showed that small differences in the shape of male genitalia and 2nd abdominal apodemes are not species-specific traits.

  15. The authority and types for the hackberry gall psyllid genus Pachypsylla (Riley) (Hemiptera-Homoptera: Psyllidae)

    Science.gov (United States)

    The nomenclatural problems with the hackberry gall psyllid species names are rectified. The genus Pachypsylla Riley, 1883, type species, Psylla venusta Osten-Sacken, includes 14 nominal species. These are: Pachypsylla venusta (Osten-Sacken, 1861); P. celtidismamma Riley, 1875; P. celtidisgemma Ri...

  16. Duas novas espécies de Tunama fennah, 1968 (Homoptera, Cercopidae

    Directory of Open Access Journals (Sweden)

    Gervásio Silva Carvalho

    1990-01-01

    Full Text Available Two new brazilian species of Tunaima Fennah, 1968 are described: T. brunneoau-rantiaca sp.n. (from São Paulo and Paraná and T. brunneolutea sp.n. (from Paraná and Rio Grande do Sul.

  17. First results in the use of sterile insect technique against Trialeurodes vaporariorum (Homoptera: Aleyroididae) in greenhouses

    International Nuclear Information System (INIS)

    Calvitti, M.; Remotti, P.C.; Pasquali, A.; Cirio, U.

    1998-01-01

    Trials for the evaluation of the effectiveness of the sterile insect technique for the suppression of greenhouse whitefly, Trialeurodes vaporariorum (Westwood), both in cage and in greenhouse conditions are described. The results show a significant reduction of the reproductive capacity of the untreated whitefly populations interacting with sterile insects. Untreated whiteflies, co-existing in a mixed population together with sterile insects, attained less than the half (44%) of their potential reproductive capacity. This trend was also evident in the cage test where the untreated whitefly population, crossed with the sterile whiteflies, increased without exceeding 2/3 of the density recorded in the control cages. These results may be based on 2 joint sterile insect technique effects: primarily a drastic reduction of the progeny of normal untreated females, when mating with sterile males, carriers of dominant lethal mutations, and secondarily a progressive reduction of the females in the population due to an increasing rate of unsuccessful matings resulting in a condition of forced arrhenotoky. No deleterious effects, on plant health and fruit quality, were observed on plants exposed to high sterile whitefly pressures

  18. Pauesia decurrens sp. nov. (Hymenoptera: Braconidae), a parasitoid of a Cinara sp. (Homoptera: Aphididae) from California

    Czech Academy of Sciences Publication Activity Database

    Starý, Petr; Zuparko, R. L.

    2005-01-01

    Roč. 81, 3/4 (2005), s. 171-176 ISSN 0031-0603 R&D Projects: GA AV ČR(CZ) IBS5007102 Institutional research plan: CEZ:AV0Z5007907 Keywords : Insecta * Hymenoptera * Braconidae Subject RIV: EG - Zoology Impact factor: 0.308, year: 2005

  19. Aphids and parasitoids on willows and poplars in southeastern Europe (Homoptera: Aphidoidea; Hymenoptera, Braconidae, Aphidiinae)

    Czech Academy of Sciences Publication Activity Database

    Tomanovic, Ž.; Kavallieratos, N. G.; Starý, Petr; Petrovic-Obradovic, O.; Tomanovic, S.; Jovanović, S.

    2006-01-01

    Roč. 113, č. 4 (2006), s. 174-180 ISSN 1861-3829 R&D Projects: GA AV ČR(CZ) IBS5007102 Grant - others:Ministry of Science and Environmental Protection of the Republic of Serbia(CS) 143006B; Ministry of Science and Environmental Protection of the Republic of Serbia(CS) 145002 Institutional research plan: CEZ:AV0Z50070508 Keywords : agroecosystems * aphids * aphid parasitoid s Subject RIV: EH - Ecology, Behaviour

  20. Areopraon lepelleyi (Waterston) (Hymenoptera: Braconidae: Aphidiinae), a parasitoid of Eriosomatinae (Homoptera: Aphidoidea: Pemphigidae) new to Iran

    Czech Academy of Sciences Publication Activity Database

    Kazemzadeh, S.; Rakhshani, E.; Tomanović, Ž.; Starý, Petr; Petrović, A.

    2009-01-01

    Roč. 14, č. 1 (2009), s. 55-63 ISSN 0354-9410 Grant - others:Ministry of Science and Technological Development of the Republic of Serbia(CS) 143006B Institutional research plan: CEZ:AV0Z50070508 Keywords : Eriosoma lanuginosum * Iran * Areopraon lepelleyi Subject RIV: EG - Zoology

  1. Contact-Induced Emigration of Potato Leafhopper (Homoptera: Cicadellidae) from Alfalfa-Forage Grass Mixtures

    OpenAIRE

    Roda, A. L.; Landis, D. A.; Miller, J. R.

    2017-01-01

    Studies were conducted to evaluate the mechanisms leading to increased potato leafhopper, Empoasca fabae (Harris), emigration from alfalfa-forage grass mixtures. A laboratory behavioral bioassay was used to measure daily emigration rates of adult leafhoppers from alfalfa, Medicago sativa L.; smooth bromegrass, Bromus inermis Leyss.; orchardgrass, Dactylis glomerata L.; and timothy, Phleum pratense L., alone and in 1:1 mixtures of each grass with alfalfa. Emigration was ≍9-fold greater from pu...

  2. The genus Baeturia Stål as represented in New Guinea (Homoptera, Cicadidae)

    NARCIS (Netherlands)

    Blöte, H.C.

    1960-01-01

    Until now only three species of the genus Baeturia have been recorded from New Guinea, viz., B. bicolorata Distant, B. viridicata Distant, and B. nana Jacobi. As I had the opportunity to study a fairly large collection of this group from different sources, collected in New Guinea, it appeared to me

  3. The phylogeny and taxonomic status of the Chlorocystini (sensu stricto) (Homoptera, Tibicinidae)

    NARCIS (Netherlands)

    Boer, de A.J.

    1995-01-01

    The “Baeturia and related genera complex”, as defined earlier (De Boer, 1990) by shared aedeagal characters, is identified as the tribe Chlorocystini (sensu stricto). The Prasiini (sensu stricto) are identified as the sister group of the Chlorocystini (sensu stricto), while the genus Muda is

  4. Appearance of cicada fauna (Homoptera: Cicadoidea) by altitudes in Johor National Park, Mount Ledang, Johor

    Science.gov (United States)

    Tahir, Aliadi Mohd; Sulaiman, Azman

    2015-09-01

    A total of 31 cicada species in 15 genera under two families (Cicadidae, 27 species in 11 genera; Tibicinidae, four species in three genera) was recorded for Johor National Park, Mount Ledang, Johor. This was based on 666 individuals were obtained through six sampling occasions in November 2012 until October 2013, each time using light trap set in six sampling locations (L1, L2, L3, L4a, L4b, L4c) that were selected based on altitudes. The most common and abundant species in L1 is Pomponia sp1 and recognized as new species that need to be described as new to science. Orientopsaltria saudarapadda Duffles & Zaidi appeared as the most common and abundant species in L2, represented by 21 individuals which covers 34.43 % of the total cicadas specimen in that area. In the location of L3, Dundubia vaginata (Fabricius) appeared as the most abundant species represented by 37 individuals or 26.81% while Abroma maculicollis Guerin appeared as the most common species. Shannon's Species Diversity Index (H') in L3 was the highest (H'=2.28) followed by L4b (H'=2.21), L2 (H'=1.93) L4a (H'=1.92), L4c (H'=1.84) and L1 (H'=1.58), and the evenness index in L1 was the highest (E= 0.88), followed by L4b (E= 0.79), L3 (E= 0.77), L2 (E= 0.75), L4c (E= 0.74) and L4a (E= 0.79). Margalef Species Richness Index in L3 was the highest (R'=3.65), followed by oleh L4b (R'=3.01), L4a (R'=2.97), L2 (R'=2.92), L4c (R'=2.4), and L1 (R'=2.01). Generally shows that L3 at the altitude 350 m appear as the best sampling site for cicadas species in Mount Ledang Johor with the highest value of species diversity and richness index.

  5. Repellency and toxicity of three Impatients species (Balsaminaceae) extracts on Myzus persicae Sulzer (Homoptera: Aphididae)

    Czech Academy of Sciences Publication Activity Database

    Pavela, R.; Vrchotová, Naděžda; Šerá, Božena

    2009-01-01

    Roč. 2009, - (2009), s. 48-51 ISSN 0974-391X R&D Projects: GA MZe(CZ) QH72117 Institutional research plan: CEZ:AV0Z60870520 Keywords : Impatiens * repellency * toxicity Subject RIV: EH - Ecology, Behaviour

  6. Biology of Scymnus ningshanensis (Coleoptera: Coccinellidae): A predator of Adelges tsugae (Homoptera: Adelgidae)

    Science.gov (United States)

    Michael Montgomery; Hongbin Wang; Defu Yao; Wenhau Lu; Nathan Havill; Guangwu. Li

    2002-01-01

    Information is presented on the occurrence, development, and feeding of Scymnus (Neopullus) ningshanensis Yu et Yao. Information on its biology was collected in the field and laboratory in China and in quarantine in the United States. This lady beetle was found in China only on hemlock infested with ...

  7. Species and endosymbiont diversity of Bemisia tabaci (Homoptera: Aleyrodidae) on vegetable crops in Senegal.

    Science.gov (United States)

    Hélène, Delatte; Rémy, Baudin; Nathalie, Becker; Anne-Laure, Girard; Traoré, Ramatoulaye Sidebe; Jean-Michel, Lett; Bernard, Reynaud

    2015-03-01

    Bemisia tabaci-transmitted geminiviruses are one of the major threats on cassava and vegetable crops in Africa. However, to date, few studies are available on the diversity of B. tabaci and their associated endosymbionts in Africa. More than 28 species have been described in the complex of B. tabaci cryptic species; among them, 2 are invasive pests worldwide: MED and MEAM1. In order to assess the species diversity of B. tabaci in vegetable crops in Senegal, several samplings in different localities, hosts and seasons were collected and analyzed with nuclear (microsatellite) and mitochondrial (COI) markers. The bacterial endosymbiont community was also studied for each sample. Two species were detected: MED Q1 and MEAM1 B. Patterns of MED Q1 (dominance on most of the samples and sites, highest nuclear and mitochondrial diversity and broader secondary endosymbiont community: Hamiltonella, Cardinium, Wolbachia and Rickettsia), point toward a predominant resident begomovirus vector group for MED Q1 on market gardening crops. Furthermore, the lower prevalence of the second species MEAM1 B, its lower nuclear and mitochondrial diversity and a narrower secondary endosymbiont community (Hamiltonella/Rickettsia), indicate that this genetic group is exotic and results from a recent invasion in this area. © 2014 Institute of Zoology, Chinese Academy of Sciences.

  8. Aploneura lentisci (Homoptera: Aphididae and its interactions with fungal endophytes in perennial ryegrass (Lolium perenne

    Directory of Open Access Journals (Sweden)

    Alison Jean Popay

    2016-09-01

    Full Text Available Aploneura lentisci Pass. is endemic to the Mediterranean region where it is holocyclic, forming galls on its primary host, Pistacia lentiscus and alternating over a 2 year period between Pistacia and secondary hosts, principally species of Graminae. This aphid is widely distributed in Australia and New Zealand on the roots of the common forage grasses, ryegrass (Lolium spp. and tall fescue (Schedonorus phoenix where it exists as permanent, anholocyclic, parthenogenetic populations. Previous studies have indicated that infestations of A. lentisci significantly reduce plant growth and may account for differences in field performance of Lolium perenne infected with different strains of the fungal endophyte Epichloë festucae var lolii. These obligate biotrophs protect their host grasses from herbivory via the production of alkaloids. To confirm the hypothesis that growth of L. perenne is associated with the effect of different endophyte strains on aphid populations, herbage and root growth were measured over time in two pot trials that compared three fungal endophyte strains with an endophyte-free control. In both pot trials, aphid numbers were lowest on plants infected with endophyte strain AR37 at all sampling times. In plants infected with a common toxic strain naturalized in New Zealand, aphid numbers overall were lower than on uninfected plants or those infected with strain AR1, but numbers did not always differ significantly from these treatments. Populations on AR1-infected plants were occasionally significantly higher than those on endophyte-free. Cumulative foliar growth was reduced in AR1 and Nil treatments relative to AR37 in association with population differences of A. lentisci in both trials and root dry weight was reduced in one trial. In four Petri dish experiments survival of A. lentisci on plants infected with AR37 declined to low levels after an initial phase of up to 19 days during which time aphids fed and populations were similar to those on plants without endophyte. Aphids on AR37-infected plants became uncoordinated in their movement and developed tremors before dying suggesting a neurotoxin was responsible for their mortality. Results support the hypothesis that differences in A. lentisci populations due to to endophyte infection status and strain affects plant growth.

  9. Ultralow oxygen treatment for postharvest control of Nasonovia ribisnigri (Homoptera: Aphididae) on iceberg lettuce.

    Science.gov (United States)

    Liu, Yong-Biao

    2005-12-01

    The aphid Nasonovia ribisnigri (Mosley) is a common pest of lettuce in the United States. It hinders export of U.S. lettuce to the overseas market such as Japan where it is a quarantined pest. Ultralow oxygen treatments were studied for control of the insect on iceberg lettuce. Small-scale ultralow oxygen treatments in plastic jars were conducted at 1, 5, and 10 degrees C for different durations to determine effective treatment against nymphs and alates of N. ribisnigri. At oxygen levels of 0.015-0.025%, N. ribisnigri can be controlled in 3 d at 1 degrees C, 2 d at 5 degrees C, and 1 d at 10 degrees C. Large-scale ultralow oxygen treatments were conducted in bulk container treatment chambers with commercial iceberg lettuce heads for 2 d at 6 degrees C with oxygen levels of 0.015 and 0.025% and for 3 d at 3 degrees C with oxygen level of 0.015%. All treatments achieved complete control of N. ribisnigri. No negative impact on lettuce quality was detected after 2 wk of posttreatment storage. Therefore, the selected treatments have potential to be commercially developed for postharvest control of N. ribisnigri on iceberg lettuce.

  10. Oxygenated phosphine fumigation for control of Nasonovia ribisnigri (Homoptera: Aphididae) on harvested lettuce.

    Science.gov (United States)

    Liu, Yong-Biao

    2012-06-01

    Low temperature regular phosphine fumigations under the normal oxygen level and oxygenated phosphine fumigations under superatmospheric oxygen levels were compared for efficacy against the aphid, Nasonovia ribisnigri (Mosley), and effects on postharvest quality of romaine and head lettuce. Low temperature regular phosphine fumigation was effective against the aphid. However, a 3 d treatment with high phosphine concentrations of > or = 2,000 ppm was needed for complete control of the aphid. Oxygen greatly increased phosphine toxicity and significantly reduced both treatment time and phosphine concentration for control of N. ribisnigri. At 1,000 ppm phosphine, 72 h regular fumigations at 6 degrees C did not achieve 100% mortality of the aphid. The 1,000 ppm phosphine fumigation under 60% O2 killed all aphids in 30 h. Both a 72 h regular fumigation with 2,200 ppm phosphine and a 48 h oxygenated fumigation with 1,000 ppm phosphine under 60% O2 were tested on romaine and head lettuce at 3 degrees C. Both treatments achieved complete control of N. ribisnigri. However, the 72 h regular fumigation resulted in significantly higher percentages of lettuce with injuries and significantly lower lettuce internal quality scores than the 48 h oxygenated phosphine fumigation. Although the oxygenated phosphine fumigation also caused injuries to some treated lettuce, lettuce quality remained very good and the treatment is not expected to have a significant impact on marketability of the lettuce. This study demonstrated that oxygenated phosphine fumigation was more effective and less phytotoxic for controlling N. ribisnigri on harvested lettuce than regular phosphine fumigation and is promising for practical use.

  11. Conservation of predatory arthropods in cotton: role of action thresholds for Bemisia tabaci (Homoptera: Aleyrodidae).

    Science.gov (United States)

    Naranjo, S E; Ellsworth, P C; Chu, C C; Henneberry, T J

    2002-08-01

    Studies were conducted in 1994 and 1995 to examine the effects of a range of action thresholds for managing Bemisia tabaci (Gennadius) Biotype B (= B. argentifolii Bellows & Perring) with insecticides in cotton on populations of arthropod predators in Imperial Valley, CA, and Maricopa, AZ. Application of insecticides significantly reduced population densities of spiders, Geocoris punctipes (Say), G. pallens (Stål), Orius tristicolor (White), Nabis alternatus Parshley, Zelus renardii Kolenati, Hippodamia convergens Guerin-Méneville, Spanogonicus albofasciatus (Reuter), Drapetis sp., and Chrysoperla carnea Stephens in one or both years and sites compared with untreated controls. Use of higher B. tabaci thresholds conserved some species and groups relative to lower thresholds. Stepwise regression analyses indicated that reductions in predator populations were generally influenced more strongly by the timing of the first insecticide application than by the total number of sprays necessary to maintain suppression of the pest below any given action threshold. A predation index, which weights the importance of each predator species based on their known frequency of predation on B. tabaci and another key pest, Pectinophora gossypiella (Saunders), was developed and analyzed. Patterns were similar to results based on changes in abundance alone, but the index generally revealed less severe effects of insecticides on overall predator function. The current action threshold for conventional insecticidal control of B. tabaci in Arizona and southern California is five adults per leaf. Results here suggest that predator conservation may be enhanced by raising the initial threshold to delay the first application or initially using more selective materials such as insect growth regulators.

  12. Collective defense of Aphis nerii and Uroleucon hypochoeridis (Homoptera, Aphididae against natural enemies.

    Directory of Open Access Journals (Sweden)

    Manfred Hartbauer

    2010-04-01

    Full Text Available The prevalent way aphids accomplish colony defense against natural enemies is a mutualistic relationship with ants or the occurrence of a specialised soldier caste typical for eusocial aphids, or even both. Despite a group-living life style of those aphid species lacking these defense lines, communal defense against natural predators has not yet been observed there. Individuals of Aphis nerii (Oleander aphid and Uroleucon hypochoeridis, an aphid species feeding on Hypochoeris radicata (hairy cat's ear, show a behavioral response to visual stimulation in the form of spinning or twitching, which is often accompanied by coordinated kicks executed with hind legs. Interestingly, this behaviour is highly synchronized among members of a colony and repetitive visual stimulation caused strong habituation. Observations of natural aphid colonies revealed that a collective twitching and kicking response (CTKR was frequently evoked during oviposition attempts of the parasitoid wasp Aphidius colemani and during attacks of aphidophagous larvae. CTKR effectively interrupted oviposition attempts of this parasitoid wasp and even repelled this parasitoid from colonies after evoking consecutive CTKRs. In contrast, solitary feeding A. nerii individuals were not able to successfully repel this parasitoid wasp. In addition, CTKR was also evoked through gentle substrate vibrations. Laser vibrometry of the substrate revealed twitching-associated vibrations that form a train of sharp acceleration peaks in the course of a CTKR. This suggests that visual signals in combination with twitching-related substrate vibrations may play an important role in synchronising defense among members of a colony. In both aphid species collective defense in encounters with different natural enemies was executed in a stereotypical way and was similar to CTKR evoked through visual stimulation. This cooperative defense behavior provides an example of a surprising sociality that can be found in some aphid species that are not expected to be social at all.

  13. Behavior Performance of Diuraphis noxia (Homoptera: Aphididae) on Fungal Endophyte-Infected and Uninfected Perennial Ryegrass

    Science.gov (United States)

    S.L. Clement; D.G. Lester; A. Dan Wilson; K.S. Pike

    1992-01-01

    The behavior and performance of the Russian wheat aphid, Diuraphis noxia (Mordvilko), on fungal endophyte-infected and endophyte-free perennial ryegrass, Lolium perenne L., was investigated in the laboratory and field. Aphids did not select endophyte-free over endophyte-infected leaf sheaths and stem segments in petri dish preference tests....

  14. Presence of the aphid, Chaetosiphon fragaefolii, on strawberry in Argentina.

    Science.gov (United States)

    Cédola, Claudia; Grecob, Nancy

    2010-01-01

    Seasonal abundance of the strawberry aphid complex under different agronomic practices in the outskirts of La Plata, Argentina was studied on strawberry, Fragaria x ananassa Duchesne (Rosales: Rosaceae). Aphid densities were low in strawberry fields in which insecticides and fungicides were used. In addition to Aphis gossypii, Aphis fabae, Mysus persicae and Macrosiphum euphorbiae, the aphid, Chaetosiphon fragaefolii (Cockerell) (Homoptera: Aphididae), was recorded for the first time in this horticultural area. Life history and some demographic parameters were calculated for C. fragaefolii. The mean duration of nymphal stages was 10.44 days, the oviposition period was 11.8 days, and the mean number of nymph/female/day was 2.4 +/- 0.3. Demographic parameters analyzed included the net reproductive rate R(o) = 14.55 +/- 0.096 nymph/female, generation time T=16.91 +/- 0.035 days, and the intrinsic rate of increase r(m) = 0.158 +/- (0.004). No parasites were found associated with C. fragaefolli. The pathogenic fungus, Entomophthora planchoniana Cornu (Zygomycetes: Entomophthorales) was the main mortality factor. Although aphids are not the main pests in strawberry fields, C. fragaefolii can be a serious problem because it can transmit several virus diseases of strawberry. Greater knowledge of life history traits and mortality factors of this species is needed in order to design appropriate control strategies.

  15. Host Range Specificity of Scymnus camptodromus (Coleoptera: Coccinellidae), A Predator of Hemlock Woolly Adelgid (Hemiptera: Adelgidae).

    Science.gov (United States)

    Limbu, Samita; Cassidy, Katie; Keena, Melody; Tobin, Patrick; Hoover, Kelli

    2016-02-01

    Scymnus (Neopullus) camptodromus Yu and Liu (Coleoptera: Coccinellidae) was brought to the United States from China as a potential biological control agent for hemlock woolly adelgid (Adelges tsugae Annand) (Hemiptera: Adelgidae). Scymnus camptodromus phenology is closely synchronized with that of A. tsugae and has several characteristics of a promising biological control agent. As a prerequisite to field release, S. camptodromus was evaluated for potential nontarget impacts. In host range studies, the predator was given the choice of sympatric adelgid and nonadelgid prey items. Nontarget testing showed that S. camptodromus will feed to some degree on other adelgid species, but highly prefers A. tsugae. We also evaluated larval development of S. camptodromus on pine bark adelgid (Pineus strobi (Hartig)) (Hemiptera: Adelgidae) and larch adelgid (Adelges laricis Vallot) (Hemiptera: Adelgidae); a small proportion of predator larvae was able to develop to adulthood on P. strobi or A. laricis alone. Scymnus camptodromus showed no interest in feeding on woolly alder aphid (Paraprociphilus tessellatus Fitch) (Hemiptera: Aphididae) or woolly apple aphid (Eriosoma lanigerum (Hausmann)) (Hemiptera: Aphididae), and minimal interest in cotton aphid (Aphis gossypii Glover) (Hemiptera: Aphididae) in choice and no-choice experiments. Scymnus camptodromus females did not oviposit on any host material other than A. tsugae-infested hemlock. Under the circumstances of the study, S. camptodromus appears to be a specific predator of A. tsugae, with minimal risk to nontarget species. Although the predator can develop on P. strobi, the likelihood that S. camptodromus would oviposit on pine hosts of this adelgid is small.

  16. Correlation of the aphicidal activity of Beauveria bassiana SFB-205 supernatant with enzymes.

    Science.gov (United States)

    Kim, Jae Su; Roh, Jong Yul; Choi, Jae Young; Wang, Yong; Shim, Hee Jin; Je, Yeon Ho

    2010-01-01

    The supernatant of Beauveria bassiana SFB-205 reduced the population of cotton aphid, Aphis gossypii Glover, with a dosage-dependent manner, which allowed a quality control (QC) factor to be determined for the evaluation of the supernatant as the first step of a development. Enzymes were assumed as possible QC factors based on 1) the comparable aphicidal activity of the supernatant protein pellet to the raw supernatant, 2) the supernatant-induced degradation of the insect cuticles, observed by transmission electron microscopy, and 3) the confirmation of enzymes related to the fungal penetration - chitinase, and the Pr1- and Pr2 proteases - in the supernatant. Finally, from the bioassay with the enzyme-inhibited supernatants processed by substrate inhibition one by one, decreased aphicidal activities were observed for all three enzyme-inhibited treatments. This phenomenon, furthermore, was more remarkable in the chitinase-inhibited supernatant. This finding provides that those enzymes (and most particularly the chitinase) in the supernatant were strongly involved in the aphicidal activity. Consequently, the amount of the chitinase may be used as one of the QC factors to determine the insecticidal activity of the supernatant of B. bassiana SFB-205 in the optimization of mass production. Copyright © 2009 The British Mycological Society. Published by Elsevier Ltd. All rights reserved.

  17. Assessment of Citrus tristeza virus (CTV incidence in Calabria, southern Italy: results of a three-year survey

    Directory of Open Access Journals (Sweden)

    Giuliana Renata Albanese

    2010-05-01

    Full Text Available Since 2006 a survey on Citrus tristeza virus (CTV has been carried out in Calabria, southern Italy, to determine the occurrence of the virus, to evaluate its incidence, to identify and characterize the virus strains, and to monitor the aphid vector populations. Citrus samples were collected from nurseries and orchards located in the five provinces of the region. The virus was not detected in the citrus-growing areas of Catanzaro (CZ or Crotone (KR, whereas it was found in three orchards in Cosenza (CS, three in Vibo Valentia (VV and twelve citrus plantings in Reggio Calabria (RC. The highest infection percentages occurred in citrus orchards close to fields already infected with CTV. Infections were detected not only in foreign cultivars, but also in local cultivars such as ‘Comune’ clementine, ‘Moro’, ‘Ovale’ and ‘Tarocco’ sweet orange, suggesting that CTV was transmitted by aphids. CTV occurred in only a few plantlets sampled in two citrus nurseries located near the main areas already infected. Serological differentiation of several CTV field isolates revealed that the mild strains were prevalent. Aphis gossypii (Glover and A. spiraecola Patch (= A. citricola Van der Goot were the most frequent aphids in the orchards, whereas Toxoptera aurantii (Boyer de Foscoulombe and Myzus persicae (Sulzer occurred with low incidence. The absence of T. citricidus (Kirkaldy was confirmed.

  18. Comparaison des effets de différents types de traitement phytosani-taire des semences du cotonnier au Burundi et en Grèce

    Directory of Open Access Journals (Sweden)

    Carême, C.

    1996-01-01

    Full Text Available Comparison of Different Pesticide Treatments of Cotton Seed in Burundi and in Greece. The effects of several active ingredients and various cotton seed treatments have been compared in 7 trials realized in Burundi and Greece in 1993 and 1994. The trials led in Burundi show the very high significant efficacy of imidacloprid on Aphis gossypii Glover at 3 g a. i./kg associated with chlorothalonil at 08 g a. i./kg seeds, when applied by pelleting on delinted seeds. In Greece, the absence of parasitic pressure at the beginning of the growing season did not allow the classification of the applied treatments concerning their efficiency to control cotton pests. The ecophysiological observations realized during this experimentation show a significant improvement of the bail maturation precocity in plants issued from pelleted seeds with an average dose of 2.2 g imidacloprid and 2.4 g TMTD per kg of seeds. On average, plants issued from treated seeds matured 10 days earlier than the untreated one.

  19. Biología de Eretmocerus mundus (Hymenoptera: Aphelinidae, parasitoide del complejo Bemisia tabaci (Homoptera: Aleyrodidae, en condiciones de laboratorio Biology of Eretmocerus mundus (Hymenoptera: Aphelinidae, parasitoid of Bemisia tabaci complex (Homoptera: Aleyrodidae under laboratory conditions

    Directory of Open Access Journals (Sweden)

    Yerlin Chacón Castro

    2010-06-01

    Full Text Available La estimación de los atributos biológicos de un enemigo natural, previa a su empleo en el campo, constituye un aspecto de importancia en todo proyecto de control biológico. El objetivo de este trabajo fue evaluar los principales parámetros biológicos de Eretmocerus mundus Mercet, parasitoide de Bemisia tabaci (Gennadius, bajo condiciones de laboratorio.La emergencia del adulto, longevidad y fecundidad de la hembra, proporción sexual de la descendencia, tasa intrínseca de crecimiento poblacional (r m, tasa neta de reproducción (Ro y tiempo generacional (T; se estimaron mediante la técnica de tabla de vida y fecundidad, utilizando el pimiento (Capsicum annuum L. y el tomate (Solanum lycopersicum L. como plantas hospederas. Los resultados obtenidos en pimiento y tomate fueron respectivamente: supervivencia pupal: 86.86 ± 1.94 y 83,45 ± 2,13%; longevidad de la hembra: 18,19 ± 1,61 y 17,00 ± 0,92 días; proporción sexual: 0,34 ± 0,06 y 0,47 ± 0,05 hembras/(machos + hembras; l x50: 21 y 18 días; r m: 0,226 ± 0,061 y 0,228 ± 0,057 ninfas parasitadas/hembra/día; Ro: 189,71 ± 24,25 y 154,65 ± 17,58 ninfas parasitadas/hembra; T: 25,88 ± 0,42 y 24,03 ± 0,34 días. Los resultados obtenidos son una contribución al conocimiento de la población local del parasitoide y su posible papel como agente de control biológico de B. tabaci.The estimation of biological attributes of natural enemies prior to its use in the field is an important tool in a biological control program. The objective of the present paper was to evaluate the main biological parameters of Eretmocerus mundus Mercet, a parasitoid of Bemisia tabaci (Gennadius, under controlled laboratory conditions. Parasitoid survival, female longevity, fecundity, sex rate, intrinsic rate of natural increase (r m, net reproductive rate (Ro and generational time (T were studied using life tables, with pepper (Capsicum annuum L. and tomato (Solanum lycopersicum L. as host plants. Results obtained on pepper and tomato, respectively, were: pupal survival: 86.86 ± 1.94 and 83,45 ± 2,13%; female longevity: 18,19 ± 1,61 and 17,00 ± 0,92 days; sex rate: 0,34 ± 0,06 and 0,47 ± 0,05 female/(male + female; l x50: 21 and 18 days; r m: 0,226 ± 0,061 and 0,228 ± 0,057 parasitized nymphs/female/day; Ro: 189,71 ± 24,25 and 154,65 ± 17,58 parasitized nymphs/female; T: 25,88 ± 0,42 and 24,03 ± 0,34 days. Results lead to a better understanding of the local population of this parasitoid and its potential role as a biological control agent of B. tabaci.

  20. Avaliação de inseticidas no controle de Myzus persicae (sulz. (homoptera: aphididae na cultura da alface Evaluation of insecticides to control Myzus persicae (Sulz (Homoptera: Aphididae on lettuce crop

    Directory of Open Access Journals (Sweden)

    Jeferson Zagonel

    2002-09-01

    Full Text Available Foi avaliada a eficiência de inseticidas no controle de Myzus persicae (Sulz. na cultura da alface, cv. Verônica, em experimento conduzido na UEPG, em 1999. Usou-se delineamento experimental de blocos ao acaso com seis tratamentos e quatro repetições. Os tratamentos constaram de thiamethoxam nas doses de 50; 75 e 100 g i.a./ha; imidacloprid na dose de 140 g i.a./ha; pymetrozine na dose de 150 g i.a./ha e testemunha sem pulverização. Os tratamentos foram aplicados nas mudas em bandejas, um dia antes do transplantio. Avaliou-se a fitotoxicidade, o número de pulgões por planta, a porcentagem de plantas com pulgões e a eficiência dos inseticidas. O thiamethoxam nas doses de 50; 75 e 100 g i.a./ha foi eficiente no controle de M. persicae durante todo o ciclo, mostrando eficiência igual ou superior a 98,6%, similar ao imidacloprid. O pymetrozine apresentou eficiência no controle de M. persicae até 21 dias após o transplante das mudas. Os inseticidas não causaram efeitos fitotóxicos nas plantas de alface; além disso, houve produção de plantas com maior massa fresca em relação à testemunha.A field trial was carried out at Universidade Estadual de Ponta Grossa, State of Paraná, Brazil, in 1999, to evaluate the efficiency of insecticides in controlling Myzus persicae (Sulz on lettuce cv. Veronica. The experimental design was of completely randomized blocks with six treatments and four replications. The treatments consisted of thiamethoxam (50; 75 and 100 g i.a/ha imidacloprid (140 g i.a/ha; pymetrozine (150 g i.a/ha and control. The treatments were applied to seedlings grown in polyestyrene trays one day before the transplanting. The fitotoxicity, the number of aphids/plant, the percentage of plants with aphids and the efficiency of the insecticides were evaluated. Thiamethoxan at doses of 50; 75 and 100 g i.a/ha was efficient to control M. persicae from transplanting till 43 days after showing equal or higher efficiency than 98.6%, similar to imidacloprid. The pymetrozine was efficient to control M. persicae until 21 days after transplanting. Effects of fitotoxicity on lettuce plants were not observed. Higher fresh weight was observed in treated plants in comparison to the one of the control.

  1. Effect of sugar beet root aphid, Pemphigus fuscicornis (Homoptera: Pemphigidae), on sugar beet yield and quality in Iran.

    Science.gov (United States)

    Zarrabi, M

    2007-10-01

    Pemphigus fuscicornis (Koch) is a pest of sugar beet root in warm and dry regions of Iran. This belongs to the Middle East and south east of Asia fauna. Nymphs establish colonies in root sutures and feed heavily which cause wilting and yellowing in beet near harvest. This study was conducted to determine infestation indices, damage occurrence and the necessity for control measures of this pest. Nymph colonies were monitored in different experimental fields that were planted with commonly used monogerm variety Afshari and then five infested places were selected. Damaged root specimens were sampled from five foci and ranked for infestation, yield and sugar concentration. Results indicated that there were no significant differences in weight, sugar concentration and impurities between indices 1, 2, 3 and none infested beets. Only the sugar concentration of indices 4 showed significant differences with zero infested beets. In the other hand, no specimens were found with the highest population density index (indices 5). Therefore, the sugar beet root aphid populations did not reach to the level of economic damage in these experimental fields. Thus, the control measures such as chemical application and use of resistant varieties may be used when the colonies density increases to the indices four and five throughout the foci in such fields.

  2. Comparison of AC electronic monitoring and field data for estimating tolerance to Empoasca kraemeri (Homoptera: Cicadellidae) in common bean genotypes.

    Science.gov (United States)

    Serrano, M S; Backus, E A; Cardona, C

    2000-12-01

    Two methods for estimating the tolerance of common bean genotypes to Empoasca kraemeri Ross & Moore were compared, using a yield trial carried out at Centro Internacional de Agricultura Tropical (CIAT), Cali, Colombia, versus stylet penetration tactics measured by AC electronic feeding monitors. A stylet penetration index was devised based on principal component scores of three penetration tactics identified (pulsing laceration, cell rupturing, and lancing sap ingestion), combined with knowledge of the hopperburn symptoms caused by each tactic. Tolerant genotypes, as classified by the CIAT yield index, showed significantly more unprotected yield and lower hopperburn scores than the susceptible control. They also induced performance of less pulsing laceration (the tactic considered most damaging to the plant), and more of the other two, mitigating tactics, especially cell rupturing. When index values were calculated for each genotype, stylet penetration index values matched those of the yield index for three out of five genotypes: two EMP-coded tolerant lines ('EMP 385' and 'EMP 392') and the susceptible control 'BAT 41'. Thus, for these three genotypes, all subsequent hoppereburn symptoms are predictable by the type of feeding behavior performed on them. 'Porrillo Sintético' and 'EMP 84', considered borderline genotypes by the yield index, were overestimated and underestimated respectively, by the stylet penetration index. We postulate that, for these two genotypes, plant physiological responses to feeding (either compensatory or heightened sensitivity, respectively) synergize with type of feeding performed to generate the overall hopperburn condition. This multivariate analysis of electronic monitoring data was successfully used to devise an index of resistance. The implications of using the stylet penetration index and the advantages of using electronic monitoring in a bean-breeding program are discussed.

  3. A new genus and new species of felt scales (Homoptera: Coccinea: Eriococcidae from Tierra del Fuego (Chile

    Directory of Open Access Journals (Sweden)

    Ilya A. Gavrilov-Zimin

    2016-10-01

    Full Text Available Telmatococcus igniumterrae gen. nov. et sp. nov. is described and illustrated based on the material collected from a sphagnum bog in the extreme southern part of South America (Tierra del Fuego. The new monotypic genus differs from all known genera of Eriococcidae in having short cylindrical truncated setae of the anal apparatus and pouches with numerous quinquelocular pores near the anal apparatus. The habitat of the new taxon is characterized.

  4. The impact of some physiomorphic characters of sugarcane genotypes on their resistance against sugarcane pyrilla, pyrilla perpusilla wlk. (lophopidae: homoptera)

    International Nuclear Information System (INIS)

    Rasul, A.; Hassan, M.; Suhail, A.; Sahi, S.T.

    2010-01-01

    Field trials were conducted in the Research Area, Directorate of Sugarcane, Ayub Agricultural Research Institute, Faisalabad to study he physio-morphic characters of sugarcane resistance to the sucking pest Pyrilla perpusilla. Twenty genotypes of sugarcane were tested for their resistance susceptibility against P. perpusilla, as a preliminary screening experiment, during 2006. Based on the population-density count, 3 genotypes, viz., HSF- 240, CPF-243 and S-2002-US-114 showing resistance responses, 3 genotypes viz. CPHS-35, S-2003-US-394 and S-2003-US-623 showing susceptible trends and 3 genotypes viz. S-2003-US-809, S-2002-US-140 and S- 2002-US-104 exerting intermediate trends against the pest under test were selected for the final screening trials during 2007.The genotype S-2003-US-623, was found to be comparatively susceptible; whereas, HSF-240, showed resistance responses. The leaf-width and cane length showed a positive and significant correlation whereas the leaf-spine density had a significant negative effect with pest-population. The Leaf-length and Cane-Diameter did not show a significant correlation with the pest population. (author)

  5. The taxonomy and biogeography of the bloetei group of the genus Baetura Stål, 1866 (Homoptera, Tibicinidae)

    NARCIS (Netherlands)

    Boer, de A.J.

    1989-01-01

    The bloetei group is proposed for a monophyletic group of 18 species of the genus Baeturia Stål, 1866. Fifteen species are described as new ( B. bilebanarai, B. bismarckensis, B. bloetei, B. boulardi, B. brandti, B. cristovalensis, B. gressitti, B. macgillavryi, B. manusensis, B. marginata, B.

  6. Performance of novel vs traditional insecticides for the control of amrascs biguttula biguttula (homoptera, cicadellidae) on cotton

    International Nuclear Information System (INIS)

    Karar, H.; Babar, T.K.; Shahzad, F.; Saleem, M.; Ali, A.; Akram, M.

    2013-01-01

    Amrasca biguttula biguttula (ishida) can reduce the yield of cotton approximately 25%. no potential predators have been recorded in the field for its control. to overcome this pest insecticides play significant role in the improvement of crop yields all over the world during the last four to five decades. to save the crop from this notorious pest, ten formulations of insecticides viz., acephate 75sp (acephate) at the rate 625g, imidacloprid 25wp (imidacloprid) at the rate188g, thiamethaxim 25wg (actara) at the rate 60g, imidacloprid 70wg (confidor) at the rate 43g, dimethoat e 40ec (sanitox) at the rate 1000 ml, nytonpyron 10sl (pyramid) at the rate 500ml, lambdacyhlothrin 2.5e (kango) at the rate 825 ml, thiachloprid 480sc (talent) at the rate 63 ml, imidacloprid 25sl (confidor) at the rate 500ml, and diafenthiuron 500sc (polo), at the rate 500ml, per hectare were sprayed in the field having maximum population of nymphs and adults of jassid at cotton research station, multan on cotton variety bt-886 in the month of july, 2011 and 2012. the maximum mortality of Jassid was observed in those treatments, where acephate was applied with 79, 72, 65 mortality, nytonpyron with 69, 63, 55 and imidacloprid 68, 63, 57 percent mortality after 24, 72 and 168 h of spray. minimum mortality of jassid was observed in the treatments where talent was applied having 25, 17 and 16 percent mortality 24, 72 and 168 h after spray. By the application of acephate, pyramid and confidor 25sl on cotton crop the yield can be increased. (author)

  7. Functional and numerical responses of Eretmocerus mundus Mercet (Hymenoptera: Aphelinidae) parasitizing cotton whitefly, Bemisia tabaci Gennadius (Homoptera: Aleyrodidae).

    Science.gov (United States)

    Sohani, Nooshin Zandi; Shishehbor, Parviz; Kocheili, Farhan

    2008-04-01

    Laboratory experiments were conducted to measure the functional and numerical responses of Eretmocerus mundus Mercet parasitizing cotton whitefly, Bemisia tabaci Gennadius. Parasitoids were isolated singly for 24 h in 5 cm petri dishes with either 5, 10, 20, 40, 60 or 100 second nymphal stages of B. tabaci. Results showed a typical type II functional response, with up to 43.2 hosts attacked when 100 hosts were provided. The rate of attack and handling time were 0.0465 and 0.3341 days, respectively. At above mentioned densities, the parasitoids lived an average of approximately 4 days. At host densities of < or =20 host/day, the total number of eggs laid was limited by the number of hosts available. Total fecundity was highest with an average of 196 eggs/female at density 100.

  8. Adult attractiveness and oviposition preference of Bemisia tabaci (Genn.) (Homoptera: Aleyrodidae) B-biotype in cotton genotypes

    OpenAIRE

    Boiça Júnior,Arlindo Leal; Campos,Zeneide Ribeiro; Lourenção,André Luiz; Campos,Alcebíades Ribeiro

    2007-01-01

    The silverleaf whitefly Bemisia tabaci B-biotype is an important pest of cotton; it affects plant vigour, transmits geminivirus and reduces lint quality. In order to evaluate the resistance of cotton genotypes, Gossypium hirsutum (L.), to the whitefly Bemisia tabaci B-biotype, both free-choice and no-choice attractiveness and non-preference for oviposition tests were carried out in a shade house, at room temperature. Low attractiveness to adults of this whitefly was observed for plants of gen...

  9. Bacterial symbionts, Buchnera, and starvation on wing dimorphism in English grain aphid, Sitobion avenae (F.) (Homoptera: Aphididae)

    Science.gov (United States)

    Wing dimorphism in aphids can be affected by multiple cues including both biotic (nutrition, crowding, interspecific interactions, the presence of natural enemies, maternal and transgenerational effects, and alarm pheromone) and abiotic factors (temperature, humidity, and photoperiod). Virtually al...

  10. Pattern formation in longitudinal halves of leaf hopper eggs (Homoptera) and some remarks on the definition of "Embryonic regulation".

    Science.gov (United States)

    Sander, Klaus

    1971-12-01

    1. Eggs of the leaf hopperEuscelis plebejus F. were fragmented longitudinally by a novel technique during cleavage. 2. Irrespective of the plane of fragmentation, both fragments may produce germ bands which are either of perfect bilateral symmetry or contain at least some bilaterally symmetrical body segments. With one possible exception, no longitudinal half-patterns were formed. 3. Ventral and lateral egg halves produce either complete germ bands or anterior partial germ bands. The failure to produce posterior body segments is correlated to the absence of special posterior pole materials marked by the symbiont mass. 4. Dorsal egg halves may produce either complete germ bands or posterior partial germ bands. The loss of anterior segments may be due to lack of keimanlagen cells. 5. The results are discussed and compared to those from transverse fragmentations carried out earlier. 6. Aided by a formalized presentation of the results a dilemma of definition is pointed out which results from the common usage of defining embryonic regulation as the alternative of mosaic development and at the same time by reference to the normal result of development.

  11. Varietals resistance and susceptibility in mustard (brassica campestris l.) genotypes against aphid myzus persicae (sulzer) (homoptera: aphididae)

    International Nuclear Information System (INIS)

    Sarwar, M.; Ahmad, N.; Khan, G.Z.; Tofique, M.

    2009-01-01

    The exploitation of resistant cultivars is an imperative, simple, practical and flexible way to cope with insect pests incidence. Thirty genotypes of mustard (Brassica campestris L.) were tested for their resistance and susceptibility to aphid Myzus persicae (Sulzer) exposed under natural field conditions. Data on pest tolerance of genotypes were judged by quantitative traits such as number of aphids on each infested plant and mean dry weight of seeds per genotype. Studies observed the discrepancy in overall rates of pest invasion and seed yield contained by trailed mustard genotypes. Agati sarson (P), S-9-S-97-100/45 and S-9-S-97-100/45 were the least damaged genotypes showing their moderate resistance. Amongst other genotypes, MM-I/01-5, MM-I285 and MM-I/01-6 were the most damaged showing oversensitive response. Although the majority of genotypes were found vulnerable to pest, Agati sarson (P) and S-9-S-97-100/45 due to their lowest hypersensitive response toward aphid contamination and increased pods yield could be used for the development of essential resistance in mustard plant. A marked mode of damage inflicted by aphid on the crop was noticed and the abiotic factors contributing variations in aphid infestation levels during both growing seasons were determined. Knowledge about the host plant resistance investigated can facilitate growers to choose the most appropriate cultivars as pest control strategy. (author)

  12. Comparative profiling of microRNAs in the winged and wingless English grain aphid, Sitobion avenae (F.) (Homoptera: Aphididae)

    Science.gov (United States)

    English green aphid, Sitobion avenae (F.), show a classic polyphenic wing dimorphism among isogenic adults that is an intriguing model for the study of morphological plasticity in response to the environment. Short non-coding microRNA (miRNA) molecules regulate gene expression by post-transcriptiona...

  13. A redescription of Puto antennatus Sign. (Homoptera, Coccoidea) with notes on Ceroputo pilosellae Šulc and Macrocerococcus superbus Leon.

    NARCIS (Netherlands)

    Reyne, A.

    1954-01-01

    In the taxonomy of Coccoidea or scale insects much confusion is due to an insufficient knowledge of the type species of several genera. Especially our knowledge of some of the older genera is very incomplete, as the descriptions of their type species are extremely short and superficial from the

  14. Parasitism and predation of the planthopper Tagosodes orizicolus (Homoptera: Delphacidae by a dryinid parasitoid in Costa Rica

    Directory of Open Access Journals (Sweden)

    Floria Mora-Kepfer

    2009-11-01

    Full Text Available We analyzed the effect of predation and parasitism by the native dryinid Haplogonatopus hernandezae as a natural enemy of the rice pest Tagosodes orizicolus under controlled conditions in an insectary in Costa Rica. We found no change in the proportion of T. orizicolus nymphs that were fed upon, parasitized, and that showed no apparent damage throughout the adult stage in H. hernandezae, which favors a stable control of the pest. The percentage of T. orizicolus nymphs that were parasitized (37 % and preyed upon (36.5 % was similar, eliminating 73,5 % of the total nymphs causing damage to the rice plants (N = 1 099. Of the total 324 parasitized nymphs, female nymphs were more parasitized than male nymphs (95 % and 5 % respectively and dryinids developed more successfully in female host nymphs. These tendencies did not change with dryinid age. Survival of dryinids was higher in female T. orizicolus, both for larvae that emerged from the host and pupated, and for pupae that moulted to adults. In cages where the nymphs had no contact with dryinids we found a higher amount of males than females (57.44 ± 28.5 vs 45.22 ± 25.85. In contrast, when the nymphs were in contact with dryinids, the sex ratio was two females to one male reaching adulthood since the dryinids fed more on male nymphs (N = 692. Our results indicate that female dryinids prefer to oviposit in female T. orizicolus nymphs and prey on males. Reproduction by parthenogenesis, acceleration of the development in an insectary with controlled conditions and eficiency of H. hernandezae as a parasitoid and predator indicate that this dryinid is an effective biological control agent of T. orizicolus. Rev. Biol. Trop. 57 (Suppl. 1: 203-211. Epub 2009 November 30.

  15. CONTROLE QUÍMICO DO PULGÃO MYZUS PERSICAE (SULZER,1776 (HOMOPTERA-APHIDIDAE NA CULTURA DO FUMO

    Directory of Open Access Journals (Sweden)

    Manoel Fernando Sigaran Tarragó

    1994-01-01

    Full Text Available RESUMO Estudou-se a ação de diferentes inseticidas sobre populações do pulgão, Myzus persicae, em lavouras de fumo da Agro Comercial Fumageira S. A., var. Sumatra, no Município de Cruz das Almas - BA. Foram realizados dois ensaios, um em dezembro de 1991 e o outro em fevereiro de 1992, e nas duas oportunidades mostraram-se eficientes os inseticidas Acefate 750 PS, Pirimicarb 500 PM e Metamidofos 600 CE.

  16. Resistance of Endophyte-Infected Plants of Tall Fescue and Perennial Ryegrass to the Russian Wheat Aphid (Homoptera: Aphididae)

    Science.gov (United States)

    S.L. Clement; K.S. Pike; W.J. Kaiser; A. Dan Wilson

    1991-01-01

    Fewer aphids of the Russian wheat aphid, (Mordvilko), were found on tall fescue and perennial ryegrass plants harboring systemic fungal endophytes than on endophyte-free plants in laboratory tests. These results indicate that enhanced resistance in some perennial grasses to D. noxia is associated with the presence of endophytic fungi.

  17. Guineapsaltria, a new genus from the Australian — New Guinean region (Homoptera, Tibicinidae), with notes on its taxonomy and biogeography

    NARCIS (Netherlands)

    Boer, de A.J.

    1993-01-01

    The genus Guineapsaltria is erected for eight species, distributed in New Guinea and northeastern Queensland. Five species are transferred from the genus Baeturia Stål, 1866 and redescribed, viz. G. chinai (Blöte, 1960), G. flava (Goding & Froggatt, 1904), G. pallida (Blöte, 1960), G. stylata

  18. Chemical Composition and Behavioral Effects of Five Plant Essential Oils on the Green Pea Aphid Acyrthosiphon pisum (Harris) (Homoptera: Aphididae).

    Science.gov (United States)

    Kasmi, Abir; Hammami, Majdi; Raoelison, Emmanuel G; Abderrabba, Manef; Bouajila, Jalloul; Ducamp, Christine

    2017-05-01

    Essential oils (EOs) from Schinus molle, Helichrysum gymnocephalum, Cedrelopsis grevei and Melaleuca viridiflora, four aromatic and medicinal plants, are commonly used in folk medicine. EOs were characterized by gas chromatography/mass spectrometry (GC/MS) and quantified by gas chromatography-flame ionization detection (GC-FID); then evaluated for their behavioral effects on adults of the green pea aphid Acyrthosiphon pisum (Harris) using a Perspex four-armed olfactometer in order to test the compatibility of their use as phytoinsecticides to control this insect pest. Our results showed that the EOs from the leaves of S. molle, M. viridiflora and C. grevei did not change aphids' behavior. However, S. molle fruits EO seemed to be attractive while H. gymnocephalum leaves EO exhibited repellency towards aphids at a dose of 10 μl. The major compounds in S. molle fruits EO were 6-epi-shyobunol (16.22%) and d-limonene (15.35%). While, in H. gymnocephalum leaves EO, 1,8-cineole was the main compound (47.4%). The difference in aphids' responses to these two EOs could be attributed to the differences in their compositions. Our findings suggest that these two EOs have potential applications for the integrated pest management of A. pisum (Harris). © 2017 Wiley-VHCA AG, Zurich, Switzerland.

  19. Aphids (Homoptera, Aphidodea inhabiting the trees Crataegus x media Bechst. in the urban green area. Part I. The population dynamics

    Directory of Open Access Journals (Sweden)

    Bożena Jaśkiwicz

    2013-12-01

    Full Text Available The studies were conducted in the years 1999-2001 in the green areas of Lublin, on the trees of Crataegus x media Bechst. The purpose of the studies was to establish the species composition and the population dynamics of aphids inhabiting hawthorn in the street and park sites. The studies found out the presence of four aphid species on the examined trees, namely Aphis pomi De Geer, aphids from the genus Dysaphis Börn., Ovatus crataegarius (Walk. and Rhopalosiphum insertum (Walk.. More aphid species and bigger populations were found in the street site (A as compa red with the park site (B.The weather conditions (air temperatures of over 30°C and stormy rainfalls limited the population of all aphid species. On the other hand, a mild winter and a warm spring with the rainfalls within the norm caused that the number of aphids decreased considerably.

  20. Clonal turnover of MACE-carrying peach-potato aphids (Myzus persicae (Sulzer), Homoptera: Aphididae) colonizing Scotland.

    Science.gov (United States)

    Kasprowicz, L; Malloch, G; Foster, S; Pickup, J; Zhan, J; Fenton, B

    2008-04-01

    Peach-potato aphids, Myzus persicae (Sulzer), collected in Scotland in the years 1995 and 2002-2004 were characterized using four microsatellite loci and three insecticide resistance mechanisms. From 868 samples, 14 multilocus genotypes were defined (designated clones A-N). Five of these (denoted A, B, H, M and N) carried modified acetylcholinesterase (MACE) resistance, the most recent resistance mechanism to have evolved in M. persicae. The current paper shows that the continued presence of MACE aphids is due to turnover, as clones A and B were replaced in field samples by clones H, M and N in later seasons. Thus, insecticide-resistant populations in Scotland can be attributed to multiple waves of rapid clone colonisations and not to the continued presence of stable resistant clones or mutation or sexual recombination in local populations. The MACE clones carried varying levels of the other insecticide resistance mechanisms, kdr and esterase. The presence of these mechanisms could alter the clones success in the field depending on insecticide spraying (positive selection) and resistance fitness costs (negative selection).

  1. Pear transformed with a lytic peptide gene for disease control affects nontarget organism, pear psylla (Homoptera: Psyllidae).

    Science.gov (United States)

    Puterka, Gary J; Bocchetti, Chris; Dang, Phat; Bell, R L; Scorza, Ralph

    2002-08-01

    The biology and behavior of pear psylla, Cacopsylla pyricola Foerster, on a transgenic clone of 'Bartlett' pear, Pyrus communis L., containing a synthetic antimicrobial gene, D5C1, was compared with that of a nontransgenic parental clone to determine whether there were any nontarget effects. The gene construct also contained the marker gene nptII (aminoglycoside 3'-phosphotransferase II) that encodes for antibiotic resistance to identify transformed plants. The purpose of the original transformation was to enhance pear resistance to the bacterial disease fireblight caused by Erwinia amylovora (Burr.) Winslow et al. The biology and behavior of pear psylla on a transgenic clone were compared with a nontransgenic parental pear clone in short- (crops.

  2. Antifeedant activity of botanical crude extracts and their fractions on Bemisia tabaci (Homoptera: Aleyrodidae adults: I. Gliricidia sepium (Fabaceae

    Directory of Open Access Journals (Sweden)

    Guillermo Flores

    2008-12-01

    Full Text Available Bemisia tabaci is an important virus vector on a number of crops worldwide. Therefore, a preventive approach to deal with viral epidemics may be the deployment of repellents or phagodeterrents at earlier stages of plant development (critical period. Thus, the crude extract and four fractions thereof (water, water:methanol, methanol, and diethyl ether of mother-of-cocoa (Gliricidia sepium, Fabaceae were tested for phagodeterrence to B. tabaci adults under greenhouse conditions, on tomato plants, in Costa Rica. Both restricted-choice and unrestricted-choice experiments showed that the crude extract and some fractions exerted such effect on the insect. In the former (in sleeve cages, three fractions caused deterrence at doses as low as 0.1% (methanol, 0.5% (water:methanol and 1.5% (diethyl ether. However, in the latter (plants exposed in a greenhouse no one of the fractions performed well, suggesting that the deterrent principles somehow decomposed under the experimental conditions. Rev. Biol. Trop. 56 (4: 2099-2113. Epub 2008 December 12.Mundialmente, Bemisia tabaci es un importante vector de virus en numerosos cultivos. Por tanto, un enfoque preventivo para enfrentar las epidemias virales podría ser el empleo de sustancias repelentes o fagodisuasivas en las etapas tempranas del desarrollo de las plantas (período crítico. Así, tanto el extracto crudo como cuatro fracciones (agua, agua:metanol, metanol y éter dietílico del madero negro (Gliricidia sepium, Fabaceae fueron evaluadas en cuanto a su actividad fagodisuasiva sobre los adultos de B. tabaci en condiciones de invernadero, utilizando plantas de tomate, en Turrialba, Costa Rica. Tanto los experimentos de escogencia restringida como los de escogencia irrestricta revelaron que el extracto crudo y algunas fracciones mostraron dicha actividad. En los primeros experimentos (en jaulas de manga, tres fracciones causaron fagodisuasión a dosis tan bajas como 0.1% (metanol, 0.5% (agua:metanol y 1.5% (éter dietílico. Sin embargo, en los segundos (plantas expuestas dentro de un invernadero ninguna de las fracciones lo hizo, lo cual sugiere que los principios fagodisuasivos perdieron su actividad en esas condiciones experimentales.

  3. Bacterial symbionts, Buchnera, and starvation on wing dimorphism in English grain aphid, Sitobion avenae (F. (Homoptera: Aphididae

    Directory of Open Access Journals (Sweden)

    Fangmei eZhang

    2015-05-01

    Full Text Available Wing dimorphism in aphids can be affected by multiple cues, including both biotic (nutrition, crowding, interspecific interactions, the presence of natural enemies, maternal and transgenerational effects, and alarm pheromone and abiotic factors (temperature, humidity, and photoperiod. The majority of the phloem-feeding aphids carry Buchnera, an obligate symbiotic proteobacteria. Buchnera has a highly reduced genome size, but encode key enzymes in the tryptophan biosynthetic pathway and is crucial for nutritional balance, development and reproduction in aphids. In this study, we investigated the impact of two nutritional-based biotic factors, symbionts and starvation, on the wing dimorphism in the English grain aphid, Sitobion avenae, a devastating insect pest of cereal crops (e.g., wheat worldwide. Elimination of Buchnera using the antibiotic rifampicin significantly reduced the formation of winged morphs, body mass and fecundity in S. avenae. Furthermore, the absence of this primary endosymbiont may disrupt the nutrient acquisition in aphids and alter transgenerational phenotypic expression. Similarly, both survival rate and the formation of winged morphs were substantially reduced after neonatal (< 24h old offspring were starved for a period of time. The combined results shed light on the impact of two nutritional-based biotic factors on the phenotypic plasticity in aphids. A better understanding of the wing dimorphism in aphids will provide the theoretical basis for the prediction and integrated management of these phloem-feeding insect pests.

  4. A new species of Aphidius Nees, 1818 (Hymenoptera, Braconidae, Aphidiinae) attacking Uroleucon aphids (Homoptera, Aphididae) from Iran and Iraq

    Czech Academy of Sciences Publication Activity Database

    Rakhshani, E.; Talebi, A. A.; Starý, Petr; Tomanovic, Ž.; Manzari, S.; Kavallieratos, N. G.; Cetkovic, A.

    2006-01-01

    Roč. 40, 32-34 (2006), s. 1923-1929 ISSN 0022-2933 R&D Projects: GA AV ČR(CZ) IBS5007102 Grant - others:The Ministry of Science and Environmental Protection of the Republic of Serbia(CS) 143006 Institutional research plan: CEZ:AV0Z50070508 Keywords : Aphidiinae * Aphidius * Iran Subject RIV: EG - Zoology Impact factor: 0.631, year: 2006

  5. Biología de Eretmocerus mundus (Hymenoptera: Aphelinidae, parasitoide del complejo Bemisia tabaci (Homoptera: Aleyrodidae, en condiciones de laboratorio

    Directory of Open Access Journals (Sweden)

    Yerlin CHACÓN CASTRO

    2010-01-01

    Full Text Available La estimación de los atributos biológicos de un enemigo natural, previa a su empleo en el campo, constituye un aspecto de importancia en todo proyecto de control biológico. El objetivo de este trabajo fue evaluar los principales parámetros biológicos de Eretmocerus mundus Mercet, parasitoide de Bemisia tabaci (Gennadius, bajo condiciones de laboratorio. La emergencia del adulto, longevidad y fecundidad de la hembra, proporción sexual de la descendencia, tasa intrínseca de crecimiento poblacional (r m , tasa neta de reproducción (R o y tiempo generacional (T; se estimaron mediante la técnica de tabla de vida y fecundidad, utilizando el pimiento ( Capsicum annuum L. y el tomate ( Solanum lycopersicum L. como plantas hospederas. Los resultados obtenidos en pimiento y tomate fueron respectivamente: supervivencia pupal: 86.86 ± 1.94 y 83,45 ± 2,13%; longevidad de la hembra: 18,19 ± 1,61 y 17,00 ± 0,92 días; proporción sexual: 0,34 ± 0,06 y 0,47 ± 0,05 hembras/(machos + hembras; l x50 : 21 y 18 días; r m : 0,226 ± 0,061 y 0,228 ± 0,057 ninfas parasitadas/hembra/día; Ro: 189,71 ± 24,25 y 154,65 ± 17,58 ninfas parasitadas/hembra; T: 25,88 ± 0,42 y 24,03 ± 0,34 días. Los resultados obtenidos son una contribución al conocimiento de la población local del parasitoide y su posible papel como agente de control biológico de B. tabaci.

  6. A contribution to the taxonomy, cytogenetics and reproductive biology of the genus Aclerda Signoret (Homoptera, Coccinea, Aclerdidae

    Directory of Open Access Journals (Sweden)

    Ilya Gavrilov-Zimin

    2012-11-01

    Full Text Available A new species of scale insects, Aclerda pseudozoysiae sp. n., is described and illustrated. The karyotypes and some aspects of reproductive biology and cytogenetics of the new species species and Aclerda takahashii Kuwana, 1932 were studied, representing the first data for the genus Aclerda Signoret, 1874 and the family Aclerdidae as a whole. A. pseudozoysiae sp. n. has 2n=16, bisexual reproduction, and heterochromatinization of one haploid set of chromosomes in male stages of the life cycle, matching either a Lecanoid or a Comstockioid genetic system. A. takahashii demonstrates 2n=18 and unusual type of parthenogenesis with diploid and haploid embryos (inside each gravid female without heterochromatinization. Both species are ovoviviparous; all stages of embryonic development occur inside the mother’s body.

  7. Lady beetles (Coleoptera: Coccinellidae) from Chinese hemlocks infested with the hemlock woolly adelgid, Adelges tsugae Annand (Homoptera: Adelgidae)

    Science.gov (United States)

    Gouyue Yu; Michael E. Montgomery; Defu Yao

    2000-01-01

    Fifty-four species of lady beetles were collected from three Chinese hemlock species, Tsuga dumosa (D. Don) Eichler, T. forrestii Downie and T. chinensis (Franchet) Pritzel, in Yunnan, Sichuan and Shaanxi provinces of China as part of a search for natural enemies of the hemlock woolly adelgid, Adelges tsugae Annand. Twenty new species are described: Clitostethus...

  8. The environmental plasticity of diverse body color caused by extremely long photoperiods and high temperature in Saccharosydne procerus (Homoptera: Delphacidae

    Directory of Open Access Journals (Sweden)

    Haichen Yin

    2016-09-01

    Full Text Available Melanization reflects not only body color variation but also environmental plasticity. It is a strategy that helps insects adapt to environmental change. Different color morphs may have distinct life history traits, e.g., development time, growth rate, and body weight. The green slender planthopper Saccharosydne procerus (Matsumura is the main pest of water bamboo (Zizania latifolia. This insect has two color morphs. The present study explored the influence of photoperiod and its interaction with temperature in nymph stage on adult melanism. Additionally, the longevity, fecundity, mating rate, and hatching rate of S. procerus were examined to determine whether the fitness of the insect was influenced by melanism under different temperature and photoperiod. The results showed that a greater number of melanic morphs occurred if the photoperiod was extremely long. A two-factor ANOVA showed that temperature and photoperiod both have a significant influence on melanism. The percentages of variation explained by these factors were 45.53% and 48.71%, respectively. Moreover, melanic morphs had greater advantages than non-melanic morphs under an environmental regime of high temperatures and a long photoperiod, whereas non-melanic morphs were better adapted to cold temperatures and a short photoperiod. These results cannot be explained by the thermal melanism hypothesis. Thus, it may be unavailable to seek to explain melanism in terms of only one hypothesis.

  9. Antifeedant activity of botanical crude extracts and their fractions on Bemisia tabaci (Homoptera: Aleyrodidae adults: II. Sechium pittieri (Cucurbitaceae

    Directory of Open Access Journals (Sweden)

    Guillermo Flores

    2008-12-01

    Full Text Available Bemisia tabaci is a key pest of vegetables and other crops worldwide, but it is a particularly serious problem in the tropics, due to its ability to transmit several types of viruses, especially begomoviruses (Geminiviridae. Therefore, a preventive approach to deal with viral epidemics may be the deployment of repellents or phagodeterrents at earlier stages of plant development (critical period. Thus, the crude extract and four fractions thereof (water, water: methanol, methanol, and diethyl ether of wild "tacaco" (Sechium pittieri, Cucurbitaceae, were tested for phagodeterrence to B. tabaci adults under greenhouse conditions, on tomato plants, in Costa Rica. Both restricted-choice and unrestricted-choice experiments showed that the crude extract as well as some fractions exert such effect on the insect. In the former (in sleeve cages, fractions caused deterrence at doses as low as 0.1% (ether and 0.5% (water and water: methanol, with the methanol fraction showing no activity. However, in the latter (plants exposed in a greenhouse no one of the fractions performed well, suggesting that the deterrent principles somehow decomposed under the experimental conditions. Rev. Biol. Trop. 56 (4: 2115-2129. Epub 2008 December 12.Bemisia tabaci es una plaga clave de hortalizas y otros cultivos, mundialmente, y representa un problema particularmente serio en los trópicos, debido a su habilidad para transmitir varios tipos de virus, especialmente begomovirus (Geminiviridae. Por tanto, un enfoque preventivo para enfrentar las epidemias virales podría consistir en la utilización de sustancias repelentes o disuasivas en las eta-pas tempranas del desarrollo de la planta (período crítico. Así, el extracto crudo y cuatro fracciones (agua, agua: metanol, metanol, y éter dietílico de tacaco cimarrón (Sechium pittieri, Cucurbitaceae, fueron evaluadas por su posible actividad fagodisuasiva sobre B. tabaci en un invernadero, utilizando plantas de tomate, en Turrialba, Costa Rica. Tanto los experimentos de escogencia restringida como los de escogencia irrestricta mostraron dicha actividad en el extracto crudo y en algunas de sus fracciones. En el primer tipo de experimento (en jaulas de manga, las fracciones causaron fagodisuasión a dosis tan bajas como 0.1% (éter dietílico y 0.5% (agua y agua: metanol, mientras que la fracción metanólica no la causó. Sin embargo, en los otros experimentos (plantas expuestas a B. tabaci dentro de un invernadero ninguna de las fracciones funcionó bien, lo cual sugiere que los principios disuasivos se disiparon bajo esas condiciones experimentales.

  10. Interplant movement and spatial distribution of alate and apterous morphs of Nasonovia ribisnigri (Homoptera: Aphididae) on lettuce.

    Science.gov (United States)

    Diaz, B M; Barrios, L; Fereres, A

    2012-08-01

    Knowledge on colonization modes and interplant movement of Nasonovia ribisnigri can contribute to the development of optimal control of this pest. The aim of this study was to determine the spatio-temporal distribution and the mode of spread between adult morphs of Nasonovia ribisnigri, comparing spring and autumn lettuce protected crops. The spatial and temporal pattern was analyzed using the spatial analysis by distance indices (SADIE) methodology and other related displacement indices. The population size of N. ribisnigri was greater in the autumn than in the spring growing seasons due to milder temperatures. The percentage of plants colonized by aphids was higher in spring than in autumn, showing the great dispersal potential of this aphid species independent of their population size. Differential propensity for initial displacement from the central plant was observed between adult morphs in spring, resulting in a greater ability of apterous than alate aphids to spread far away from the source plant. In autumn, both adult morphs showed an initial reduced displacement; however, the number of plants infested (≈20%) with at least one aphid at this initial time (seven days) was similar for both adult morphs and both growing seasons. Analysis of the spatial pattern of both adult morphs revealed a predominantly random distribution for both spring and autumn trials. This pattern was achieved by a prevalent random movement over the area (γ≈0.5). These results highlight the ability of the apterous N. ribisnigri to spread within greenhouse lettuce crops early in the spring, suggesting that detection of the pest by deep visual inspection is required after lettuce emergence.

  11. Hosting Capacity of Horticultural Plants for Insect Pests in Brazil Capacidad de Alojamiento de Plantas Hortícolas para Plagas de Insectos en Brasil

    Directory of Open Access Journals (Sweden)

    Germano L.D Leite

    2011-09-01

    Full Text Available Factors such as fertilization, allelochemicals, trichomes, weather, and natural enemies can influence pest populations. Thus, it is necessary to understand the factors that predispose vegetable species to pests and the role of polyculture, crop rotation, and neighboring plants. The objective of this research was to study the hosting capacity for pests of Abelmoschus esculentus (L., Brassica oleracea L. vars. acephala and capitata, Capsicum annuum L., Cucurbita moschata (Duchesne, Cucurbita maxima Duchesne and Cucumis sativus L., Lycopersicon esculentum Mill., Solanum gilo Raddi and Solanum melongena L., and Phaseolus vulgaris L. The higher density of Bemisia tabaci (Genn. adults on C. sativus can be due to the higher amount of pentacosane and octacosane in this plant. The occurrence of Brevicoryne brassicae (L. only in Brassica spp. can be accounted for by the nonacosane of these plants. The low trichome density and greater palmitic acid level can explain the greatest damage by Aphis gossypii Glover in A. esculentum. Empoasca sp. was more frequent in P. vulgaris followed by A. esculentum, which are plants with lower K content. Solanum melongena was attacked more by Hydrangea similis (Walker and Epitrix sp. perhaps because of higher palmitic acid and 11,14,17-eicosatrienoic methyl ester concentrations in their leaves. Frankliniella sp. exhibited more damage in C. sativus probably owing to higher pentacosane and octacosane in its leaves. Sistena sp. was more frequent in C. maxima and had higher octadecane levels and trichome density. The presence of ¥-humulene and hexacosane can explain the damage by Tuta absoluta (Meyrick on L. esculentum.Factores tales como la fertilización, aleloquímicos, tricomas, el clima y los enemigos naturales pueden influir en las poblaciones de plagas. Por lo tanto, es necesario comprender los factores que predisponen a las especies vegetales a las plagas y el papel de policultivos, rotación de cultivos y las plantas

  12. SELECTIVITY OF INSECTICIDES TO NATURAL ENEMIES ON SOIL CULTIVATED WITH COTTON SELETIVIDADE DE INSETICIDAS AOS INIMIGOS NATURAIS OCORRENTES SOBRE O SOLO CULTIVADO COM ALGODOEIRO

    Directory of Open Access Journals (Sweden)

    Paulo Eduardo Degrande

    2008-11-01

    Full Text Available

    The objective of this research was to evaluate the selectivity of the most used insecticides for controlling Aphis gossypii Glover, 1877, on natural enemies occurring on the cotton crop soil, under field conditions. The study was conducted in Dourados, Mato Grosso do Sul State, Brazil, as randomized blocks, with seven treatments and four replications. The treatments were: Acetamiprid 200 PS, Carbosulfan 400 CE, Diafentiurom 500 PM, Tiametoxam 250 WG, Imidacloprid 200 SC, Paration Metil 600 CE, and control. The samplings of cotton pests natural enemies occurring in the area were made with ";modified pittfall"; traps. During the evaluation period, it was verified the presence of natural enemies, mainly Araneae (31%, Formicidae (29%, and Tachinidae (16%. The insecticide Acetamiprid 200 PS was not selective to the family Formicidae, but it was selective to Araneida and Tachinidae. The insecticide Tiametoxam 250 WG represented a larger effect in the first day (DAA to the families Formicidae and Tachinidae, when mortality rates of 100% and 56%, respectively, were observed, but it was selective to Arachnida. The insecticide Imidacloprid 200 SC was not selective to ants and Tachinidae, but it was selective to the occurring spiders. Carbosulfan 400 CE was selective to spiders. Paration Metil 600 CE only preserved populations of Araneida.

    KEY-WORDS: Predator; parasitoid; Gossypium hirsutum.


  13. Alterações anatômicas em algodoeiro infectado pelo vírus da doença azul Anatomical alterations in blue disease infected cotton plant

    Directory of Open Access Journals (Sweden)

    Juliana K. Takimoto

    2009-01-01

    Full Text Available A doença azul do algodoeiro está associada a um vírus ainda pouco conhecido em suas características morfológicas e moleculares, tanto quanto a sua patologia e epidemiologia. O tipo de transmissão circulativa pelo afídeo vetor Aphis gossypii Glover, associado a recentes relatos de estudos moleculares, sustentam ser o agente etiológico uma espécie membro da família Luteoviridae. No presente trabalho, estudos anatômicos comparativos em plantas sadias e infectadas foram realizados com a finalidade de conhecer aspectos estruturais da interação vírus-espécie hospedeira, com potencial aplicação na área de diagnose e melhoramento genético. Os estudos anatômicos foram realizados em folhas de plantas infectadas, com área foliar reduzida, nervuras cloróticas e margem foliar voltada para baixo. O encurtamento dos entrenós, que resultam em um agrupamento de folhas, flores e frutos, e conseqüente redução da altura da planta, do número e tamanho dos frutos, são expressões fenotípicas da planta de algodão infectada, a qual serviu para o presente estudo. Nas plantas infectadas com o agente da doença azul havia maior acúmulo de calose e de cristais de oxalato de cálcio, cloroplastos íntegros distribuídos na região periférica das células do mesofilo e aparente alteração química no interior das células do parênquima paliçádico. Inclusões nos vasos do floema e, ocasionalmente no xilema, também foram observadas. O acúmulo de calose e a presença de inclusões no floema podem indicar uma relação ou preferência do vírus por esse tecido.Cotton blue disease is caused by a virus whose morphological and molecular characteristics is not well known and so demanding information its phytosanitary and epidemiological characteristics. Evidences of an aphid borne (Aphis gossypii Glover circulative (persistent type of transmission, associated with a recent molecular report, sustain for a virus species belonging to the

  14. Ocorrência e flutuação populacional de tripes, pulgões e inimigos naturais em crisântemo de corte em casa de vegetação Occurrence and population fluctuation of thrips, aphids and natural enemies in cut chrysanthemum in greenhouse

    Directory of Open Access Journals (Sweden)

    Lívia Mendes Carvalho

    2006-01-01

    Full Text Available Os pulgões e os tripes são importantes pragas em cultivo de crisântemo em casas de vegetação. O objetivo deste trabalho foi avaliar a ocorrência e flutuação populacional de tripes, pulgões e inimigos naturais em cultivares de crisântemo de corte ('White Reagan', 'Yellow Snowdon' e 'Sunny Reagan' em casa de vegetação comercial. A amostragem de tripes foi realizada através de batidas nas plantas ("tapping method" e a de pulgões a partir de coletas diretas nas plantas. Das espécies de tripes amostradas, mais de 90% foram identificadas como Frankliniella occidentalis (Pergande, e o restante incluíram F. gemina (Bagnall, Frankliniella sp., Caliothrips phaseoli (Hood e Haplothrips gowdeyi (Franklin. Foi observado maior número de tripes/planta no cultivar White Reagan se comparado com 'Yellow Snowdon'. Aphis gossypii Glover foi a espécie de pulgão mais comum (> 80%, sendo também coletados Myzus persicae (Sulzer e Dysaphis sp. Maior número de pulgões foi verificado na cultivar White Reagan, quando comparada com 'Sunny Reagan'. Orius insidiosus (Say foi o único predador encontrado associado aos tripes, sendo verificada uma correlação positiva significativa entre a população de tripes e a desse predador. Dentre os inimigos naturais relacionados aos pulgões, foram observados parasitóides (Aphidius colemani Viereck e Lysiphlebus testaceipes Cresson e predadores (Chrysoperla sp., Cycloneda sanguinea Linnaeus e Scymnus sp.. Houve uma correlação positiva significativa entre o crescimento populacional de pulgões e desses predadores e parasitóides nas cultivares White Reagan e Sunny Reagan. Inimigos naturais podem ocorrer naturalmente em casas de vegetação e influenciar as populações de pragas.Aphids and thrips play an important role on chrysanthemum crops in greenhouses. The objective of this work was to evaluate the occurrence and population densities of thrips, aphids and natural enemies in cut chrysanthemum cultivars

  15. Cucumber Plants Baited with Methyl Salicylate Accelerates Scymnus (Pullus) sodalis (Coleoptera: Coccinellidae) Visiting to Reduce Cotton Aphid (Hemiptera: Aphididae) Infestation.

    Science.gov (United States)

    Dong, Y J; Hwang, S Y

    2017-10-01

    The cotton aphid, Aphis gossypii (Glover) (Hemiptera: Aphididae), is a major pest of many crops worldwide and a major cucumber plant pest in Taiwan. Because cotton aphids rapidly develop insecticide resistance and because of the insecticide residue problem, a safe and sustainable method is required to replace conventional chemical control methods. Methyl salicylate (MeSA), a herbivore-induced plant volatile, has been shown to affect aphids' behavior and attract the natural enemies of aphids for reducing their population. Therefore, this study examined the direct effects of MeSA on cotton aphids' settling preference, population development, and attractiveness to natural enemies. The efficiency of using MeSA and the commercial insecticide pymetrozine for reducing the cotton aphid population in laboratory and outdoor cucumber plant pot was also examined. The results showed no difference in winged aphids' settling preference and population development between the MeSA and blank treatments. Cucumber plants infested with cotton aphids and baited with 0.1% or 10% MeSA contained significantly higher numbers of the natural enemy of cotton aphids, namely Scymnus (Pullus) sodalis (Weise) (Coleoptera: Coccinellidae), and MeSA-treated cucumber plants contained a lower number of aphids. Significantly lower cotton aphid numbers were found on cucumber plants within a 10-m range of MeSA application. In addition, fruit yield showed no difference between the MeSA and pymetrozine treatments. According to our findings, 0.1% MeSA application can replace insecticides as a cotton aphid control tool. However, large-scale experiments are necessary to confirm its efficiency and related conservation biological control strategies before further use. © The Author 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  16. Effect of reproductive mode on host plant utilization of melon aphid (Hemiptera: Aphididae).

    Science.gov (United States)

    Liu, Xiangdong; Gao, Xue

    2010-12-01

    Variation in the reproductive mode of melon aphid Aphis gossypii Glover occurred on the large geographic scale, but the performance of different reproductive modes to use host plant is poorly understood. Life tables of melon aphid population that undergo the anholocyclic, androcyclic, and intermediate reproductive mode were conducted on different host plants. The results showed that the anholocyclic and androcyclic strains could become adults and produce offspring on cotton Gossypium hirsutum L., whereas the intermediate strain could not. The survival rate, net reproductive rate (R(0)), and intrinsic rate of natural increase (r(m)) of the androcyclic strain on cotton were significantly greater than that of the anholocyclic strain. The three strains could aptly use cucurbits host plants including cucumber Cucumis sativa L., pumpkin Cucurbita moschata (Duchesne ex Lam.), and zucchini Cucurbita pepo L.; survival rate and R(0) were not significantly different on these two host plants. Moreover, the r(m) of the anholocyclic strain on cucumber and the androcyclic strain on pumpkin and zucchini were significantly greater than that of the other two strains. The abilities of the three strains to use a host plant were flexible, because their r(m) on pumpkin or zucchini became equal after rearing for four successive generations; furthermore, the intermediate strain attained the ability to use cotton, and the performance of anholocyclic and intermediate strains to use cotton also significantly increased after feeding on pumpkin or zucchini for one or three generations. It was concluded that the reproductive mode and feeding experience affected the performance of melon aphid to use a host plant. © 2010 Entomological Society of America

  17. Identification of top-down forces regulating cotton aphid population growth in transgenic Bt cotton in central China.

    Directory of Open Access Journals (Sweden)

    Peng Han

    Full Text Available The cotton aphid Aphis gossypii Glover is the main aphid pest in cotton fields in the Yangtze River Valley Cotton-planting Zone (YRZ in central China. Various natural enemies may attack the cotton aphid in Bt cotton fields but no studies have identified potential specific top-down forces that could help manage this pest in the YRZ in China. In order to identify possibilities for managing the cotton aphid, we monitored cotton aphid population dynamics and identified the effect of natural enemies on cotton aphid population growth using various exclusion cages in transgenic Cry1Ac (Bt+CpTI (Cowpea trypsin inhibitor cotton field in 2011. The aphid population growth in the open field (control was significantly lower than those protected or restricted from exposure to natural enemies in the various exclusion cage types tested. The ladybird predator Propylaea japonica Thunberg represented 65% of Coccinellidae predators, and other predators consisted mainly of syrphids (2.1% and spiders (1.5%. The aphid parasitoids Aphidiines represented 76.7% of the total count of the natural enemy guild (mainly Lysiphlebia japonica Ashmead and Binodoxys indicus Subba Rao & Sharma. Our results showed that P. japonica can effectively delay the establishment and subsequent population growth of aphids during the cotton growing season. Aphidiines could also reduce aphid density although their impact may be shadowed by the presence of coccinellids in the open field (likely both owing to resource competition and intraguild predation. The implications of these results are discussed in a framework of the compatibility of transgenic crops and top-down forces exerted by natural enemy guild.

  18. Differential Life History Trait Associations of Aphids with Nonpersistent Viruses in Cucurbits.

    Science.gov (United States)

    Angelella, G M; Egel, D S; Holland, J D; Nemacheck, J A; Williams, C E; Kaplan, I

    2015-06-01

    The diversity of vectors and fleeting nature of virus acquisition and transmission renders nonpersistent viruses a challenge to manage. We assessed the importance of noncolonizing versus colonizing vectors with a 2-yr survey of aphids and nonpersistent viruses on commercial pumpkin farms. We quantified aphid alightment using pan traps, while testing leaf samples with multiplex RT-PCR targeting cucumber mosaic virus (CMV), zucchini yellow mosaic virus (ZYMV), watermelon mosaic virus (WMV), and papaya ringspot virus (PRSV). Overall, we identified 53 aphid species (3,899 individuals), from which the melon aphid, Aphis gossypii Glover, a pumpkin-colonizing species, predominated (76 and 37% of samples in 2010 and 2011, respectively). CMV and ZYMV were not detected, but WMV and PRSV were prevalent, both regionally (WMV: 28/29 fields, PRSV: 21/29 fields) and within fields (infection rates = 69 and 55% for WMV in 2010 and 2011; 28 and 25% for PRSV in 2010 and 2011). However, early-season samples showed extremely low infection levels, suggesting cucurbit viruses are not seed-transmitted and implicating aphid activity as a causal factor driving virus spread. Interestingly, neither noncolonizer and colonizer alightment nor total aphid alightment were good predictors of virus presence, but community analyses revealed species-specific relationships. For example, cowpea aphid (Aphis craccivora Koch) and spotted alfalfa aphid (Therioaphis trifolii Monell f. maculata) were associated with PRSV infection, whereas the oleander aphid (Aphis nerii Bover de Fonscolombe) was associated with WMV spread within fields. These outcomes highlight the need for tailored management plans targeting key vectors of nonpersistent viruses in agricultural systems. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  19. Indian Bt Cotton Varieties Do Not Affect the Performance of Cotton Aphids

    Science.gov (United States)

    Lawo, Nora C.; Wäckers, Felix L.; Romeis, Jörg

    2009-01-01

    Cotton varieties expressing Cry proteins derived from the soil bacterium Bacillus thuringiensis (Bt) are grown worldwide for the management of pest Lepidoptera. To prevent non-target pest outbreaks and to retain the biological control function provided by predators and parasitoids, the potential risk that Bt crops may pose to non-target arthropods is addressed prior to their commercialization. Aphids play an important role in agricultural systems since they serve as prey or host to a number of predators and parasitoids and their honeydew is an important energy source for several arthropods. To explore possible indirect effects of Bt crops we here examined the impact of Bt cotton on aphids and their honeydew. In climate chambers we assessed the performance of cotton aphids, Aphis gossypii Glover (Hemiptera: Aphididae) when grown on three Indian Bt (Cry1Ac) cotton varieties (MECH 12, MECH 162, MECH 184) and their non-transformed near isolines. Furthermore, we examined whether aphids pick up the Bt protein and analyzed the sugar composition of aphid honeydew to evaluate its suitability for honeydew-feeders. Plant transformation did not have any influence on aphid performance. However, some variation was observed among the three cotton varieties which might partly be explained by the variation in trichome density. None of the aphid samples contained Bt protein. As a consequence, natural enemies that feed on aphids are not exposed to the Cry protein. A significant difference in the sugar composition of aphid honeydew was detected among cotton varieties as well as between transformed and non-transformed plants. However, it is questionable if this variation is of ecological relevance, especially as honeydew is not the only sugar source parasitoids feed on in cotton fields. Our study allows the conclusion that Bt cotton poses a negligible risk for aphid antagonists and that aphids should remain under natural control in Bt cotton fields. PMID:19279684

  20. Dicty_cDB: Contig-U15920-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available t... 44 10.0 1 ( EU019869 ) Aphis gossypii from Hibiscus elongation factor 1 ... ...44 10.0 1 ( EU019868 ) Aphis gossypii from Hibiscus mutabilis elongation... 44 10.0 1 ( EF660855 ) Myzus per

  1. ORF Alignment: NC_005785 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available gossypii ATCC 10895] ref|NP_983966.1| ADL130Wp ... [Eremothecium gossypii] ... Length = 150 ... Query: 59 ... EGPLGSASME...LPDFVSLDHDAASGQVAVTVHDAANKSQRAMWGTVRSTLGSHVQGVNEGH 118 ... EGPLGSASMELPDFVSLDHDAA...SGQVAVTVHDAANKSQRAMWGTVRSTLGSHVQGVNEGH Sbjct: 1 ... EGPLGSASMELPDFVSLDHDAASGQVAVTVH

  2. ORF Alignment: NC_005788 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available uery: 286 ESYQTKRQRLMKQLKENYAGHTAFCVTALDEICWFLNIRGSDVEYNPVFYAYFVIHQDSS 345 ... ESYQTKRQRLMKQLKENYAGHT...AFCVTALDEICWFLNIRGSDVEYNPVFYAYFVIHQDSS Sbjct: 1 ... ESYQTKRQRLMKQLKENYAGHTAFCVTALDE...gossypii ATCC 10895] ref|NP_986634.1| AGL032Cp ... [Eremothecium gossypii] ... Length = 385 ... Q

  3. New species of the family Triozidae (Homoptera: Psylloidea) from China, and the first record of Psylloidea as host of Braconidae (Hymenoptera)

    NARCIS (Netherlands)

    Li, F.; Achterberg, van C.; He, J.

    2000-01-01

    Two new species of Triozidae (Psylloidea) from China producing sphere-shaped leaf galls on Ficus hainanensis Merr. & Shun., are illustrated and described. For the first time Psylloidea are reported as host of a species of Braconidae. The parasitoid belonging to the genus Bracon Fabricius, 1804, is

  4. Review of the genus Oncopsis Burmeister, 1838 (Homoptera: Auchenorrhyncha: Cicadellidae: Macropsinae) of Russia and adjacent countries with description of a new species from Central Asia.

    Science.gov (United States)

    Tishechkin, Dmitri Yu

    2017-01-11

    Illustrated descriptions and data on host plants and distribution for 21 species of Oncopsis of Russia and adjacent countries are given, and O. abdykulovi sp. n. from Central Asia is described. Conspecificity of O. planiscuta from East Siberia and Sakhalin,of O. tristis from Moscow Area, Alati Mts., and Sakhalin, and of O. burjatica from East Siberia and Sakhalin is corroborated by male calling signal analysis.

  5. Establishment of Lipolexis oregmae (Hymenoptera: Aphidiidae) in a classical biological control program directed against the brown citrus aphid (Homoptera: Aphididae) in Florida

    International Nuclear Information System (INIS)

    Persad, A.B.; Hoy, M.A.; Ru Nguyen

    2007-01-01

    The parasitoid Lipolexis oregmae Gahan (introduced as L. scutellaris Mackauer) was imported from Guam, evaluated in quarantine, mass reared, and released into citrus groves in Florida in a classical biological control program directed against the brown citrus aphid, Toxoptera citricida Kirkaldy. Releases of 20,200, 12,100, and 1,260 adults of L. oregmae were made throughout Florida during 2000, 2001, and 2002, respectively. To determine if L. oregmae had successfully established, surveys were conducted throughout the state beginning in the summer of 2001 and continuing through the summer of 2003. Parasitism during 2001 and 2002 was evaluated by holding brown citrus aphids in the laboratory until parasitoid adults emerged. Lipolexis oregmae was found in 10 sites in 7 counties and 4 sites in 3 counties with parasitism rates ranging from 0.7 to 3.3% in 2001 and 2002, respectively. Laboratory tests indicated that high rates of mortality occurred if field-collected parasitized aphids were held in plastic bags, so a molecular assay was used that allowed immature L. oregmae to be detected within aphid hosts immediately after collection. The molecular assay was used in 2003 with the brown citrus aphids and with other aphid species collected from citrus, weeds, and vegetables near former release sites; immatures of L. oregmae were detected in black citrus aphids, cowpea aphids, spirea aphids, and melon aphids, as well as in the brown citrus aphid, in 4 of 8 counties sampled, with parasitism ranging from 2.0 to 12.9%, indicating that L. oregmae is established and widely distributed. Samples taken in Polk County during Oct 2005 indicated that L. oregmae has persisted. The ability of L. oregmae to parasitize other aphid species on citrus, and aphids on other host plants, enhances the ability of L. oregmae to persist when brown citrus aphid populations are low. (author) [es

  6. Monitoreo de estados inmaduros de la mosca blanca [Trialeurodes vaporariorum (Westwood) (Homoptera-Aleyrodidae)] reinfestando cultivo de tomate bajo invernadero en el período estival

    OpenAIRE

    Sánchez, Daniel E.; Scotta, Roberto R.; Arregui, María Cristina

    2002-01-01

    En los cultivos de tomate en invernadero, la mosca blanca de los invernaderos (Trialeurodes vaporariorum) se ha convertido en plaga clave, tanto por los daños que ocasiona, como por la dificultad para su control con métodos químicos. El objetivo de este trabajo fue determinar la distribución de los estados inmaduros de mosca blanca reinfestando la planta de tomate cultivada bajo invernadero, las áreas de concentración en el cultivo y detectar si existía en el período estival una relación entr...

  7. A reliable bioassay procedure to evaluate per os toxicity of Bacillus thuringiensis strains against the rice delphacid, Tagosodes orizicolus (Homoptera: Delphacidae

    Directory of Open Access Journals (Sweden)

    Rebeca Mora

    2007-06-01

    Full Text Available A reliable bioassay procedure was developed to test ingested Bacillus thuringiensis (Bt toxins on the rice delphacid Tagosodes orizicolus. Initially, several colonies were established under greenhouse conditions, using rice plants to nurture the insect. For the bioassay, an in vitro feeding system was developed for third to fourth instar nymphs. Insects were fed through Parafilm membranes on sugar (10 % sucrose and honey bee (1:48 vol/vol solutions, observing a natural mortality of 10-15 % and 0-5 %, respectively. Results were reproducible under controlled conditions during the assay (18±0.1 °C at night and 28±0.1 °C during the day, 80 % RH and a 12:12 day:light photoperiod. In addition, natural mortality was quantified on insect colonies, collected from three different geographic areas of Costa Rica, with no significant differences between colonies under controlled conditions. Finally, bioassays were performed to evaluate the toxicity of a Bt collection on T. orizicolus. A preliminary sample of twenty-seven Bt strains was evaluated on coarse bioassays using three loops of sporulated colonies in 9 ml of liquid diet, the strains that exhibited higher percentages of T. orizicolus mortality were further analyzed in bioassays using lyophilized spores and crystals (1 mg/ml. As a result, strains 26-O-to, 40-X-m, 43S-d and 23-O-to isolated from homopteran insects showed mortalities of 74, 96, 44 and 82 % respectively while HD-137, HD-1 and Bti showed 19, 83 and 95 % mortalities. Controls showed mortalities between 0 and 10 % in all bioassays. This is the first report of a reliable bioassay procedure to evaluate per os toxicity for a homopteran species using Bacillus thuringiensis strains. Rev. Biol. Trop. 55 (2: 373-383. Epub 2007 June, 29.Se desarrolló una metodología de bioensayo para evaluar toxinas de Bacillus thuringiensis (Bt ingeridas por Tagosodes orizicolus, plaga del arroz y vector del virus de la hoja blanca. Se establecieron colonias del insecto en condiciones de invernadero usando plantas de arroz como alimento. Para el bioensayo, se desarrolló un sistema de alimentación in vitro para ninfas de tercer y cuarto estadío. Los insectos se alimentaron de soluciones de miel de abeja (1:48 vol/vol y sacarosa (10 % a través de membranas de Parafilm. Se observaron mortalidades del 10-15 % y 0-5 %, respectivamente, en ambas dietas. Los resultados fueron reproducibles en condiciones controladas de humedad y temperatura (18±0.1 °C de noche y 28±0.1 °C de día, 80 % H.R y a 12:12 fotoperíodo día:noche. Asimismo, se analizó la mortalidad natural de los insectos según su procedencia, sin embargo, no se observaron diferencias significativas en condiciones controladas. Finalmente, se elaboraron bioensayos para evaluar la toxicidad de una colección de cepas de Bt contra T. orizicolus. Se evaluó preliminarmente, una submuestra de 27 cepas de Bt en bioensayos burdos usando tres asadas como inóculo para 9 ml de dieta líquida. Posteriormente, las cepas que mostraron los mayores porcentajes de mortalidad se evaluaron en bioensayos usando esporas y cristales liofilizados (1 mg/ml. Como resultado, las cepas aisladas a partir de homópteros 26-O-to, 40-X-m, 43-S-d y 23-O-to mostraron mortalidades de 74, 96, 44 y 82 % respectivamente, mientras que las HD-137, HD-1 y Bti mostraron 19, 83 y 95 % de mortalidad. Los controles presentaron mortalidades de 0 y 10 % en los bioensayos. Este es el primer informe de un bioensayo para evaluar la toxicidad de cepas de Bt utilizando la especie T. orizicolus.

  8. Scymnus (Pullus) suturalis Thunberg (Coleoptera: Coccinellidae): New locality records and a report on feeding on hemlock woolly adelgid, Adelges tsugae Annand (Homoptera: Adelgidae)

    Science.gov (United States)

    S.M. Lyon; M.E. Montgomery

    1995-01-01

    Scymnus (Pullus) suturalis Thunberg is a Palearctic species that occurs on conifers, where it is reported to feed on aphids (I. Hodek. 1973. Biology of Coccinellidae. Academia, Czechoslovak Academy of Science. Prague). The occurrence of S. suturalis in North America was first reported by R.D. Gordon (1982. Proc. Entomol. Soc. Wash...

  9. Source Areas for the Early Immigration of Sogatella furcifera (Homoptera: Delphacidae) at Xiushan in the Middle Reach of Yangtze River of China.

    Science.gov (United States)

    Jiang, C X; Chen, X L; Bi, J C; Li, J J; Xiao, X H; Li, Q; Wang, H J; Yang, Q F

    2015-12-01

    The spatiotemporal distribution of source areas for the early immigration of the white-backed planthopper, Sogatella furcifera (Horvάth), at Xiushan in the middle reach of Yangtze River of China, was analyzed with HYSPLIT (Hybrid Single-Particle Lagrangian Integrated Trajectory) and ArcGIS 10.0. The analysis was based on light trap data collected during April-July in 2000-2012. The synoptic meteorology backgrounds during the immigration periods were analyzed by GrADS (Grid Analysis and Display System). The light trap catches of S. furcifera varied monthly and annually. S. furcifera started immigration in Xiushan in early April to early May, whereas the main immigration period was in July. The distribution of the source areas varied monthly, and the core was moved from the south to the north gradually. The main source areas of S. furcifera in May were in southwestern Guangxi and northern Vietnam. The source areas of S. furcifera in June were located in southwestern Guangxi and western Hunan. Additionally, some of the pests were from southeastern Yunnan. The source areas in July were in northwestern Guangxi, southwestern Guizhou, eastern Yunnan, and the transitional parts of Guangxi, Guizhou, and Yunnan. The sum frequencies of southwest and south winds on the 850 hPa isobaric surface of Xiushan of May-July in heavy occurrence years were more than the light occurrence years. The key meteorological factors were suggested to be vertical perturbation, precipitation, and wind shear during S. furcifera immigration periods. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  10. Is the old world fig, Ficus carica L. (Moraceae), an alternate host for the Asian citrus psyllid, Diaphorina citri (Kuwayama) (Homoptera: Psyllidae)?

    Science.gov (United States)

    The only non-rutaceous plant on which D. citri has been found breeding in Texas is the edible fig, Ficus carica (Moraceae). In the summer of 2010, we discovered D. citri nymphs on a dooryard fig tree. Fig has its own species of psyllid, Homatoma ficus, but both adults and nymphs of that species ar...

  11. Effects of double-stranded RNA on virulence of Paecilomyces fumosoroseus (Deuteromycotina: Hyphomycetes against the silverleaf whitefly, Bemisia tabaci strain B (Homoptera: Aleyrodidae

    Directory of Open Access Journals (Sweden)

    Andréia Cristiane Souza Azevedo

    2000-03-01

    Full Text Available Bands of double-stranded RNA (dsRNA were detected in three out of twelve isolates of Paecilomyces fumosoroseus. Identity of these bands was confirmed by RNAse, DNAse and S1 nuclease treatments. The cure of dsRNA for one isolate (P92 was successfully carried out for a single conidium subculture. Isogenic strains, with or without dsRNA, were submitted to virulence tests against the whitefly Bemisia tabaci strain B. In contrast to findings for some phytopathogenic fungi, these dsRNA fragments did not cause hypovirulence in P. fumosoroseus.Bandas de dsRNA foram detectadas em três dos doze isolados de Paecilomyces fumosoroseus. A identidade destas bandas foi provada através de tratamentos com RNAse, DNAse e S1 nuclease. A cura do dsRNA para um dos isolados (P92 foi obtida através do isolamento de colônias monospóricas. Linhagens isogênicas, com e sem dsRNA, foram submetidas ao teste de virulência contra a mosca branca Bemisia tabaci biotipo B. Ao contrário do que ocorre para vários fungos fitopatogênicos, os fragmentos de dsRNA não causaram hipovirulência em P. fumosoroseus.

  12. Populations of Bemisia tabaci (Homoptera: Aleyrodidae) on cotton grown in open-top field chambers enriched with CO/sub 2/

    Energy Technology Data Exchange (ETDEWEB)

    Butler, G.D. Jr.; Kimball, B.A.; Mauney, J.R.

    1985-02-01

    Atmospheric CO/sub 2/ levels are anticipated to rise from the current ambient level of ca. 350 ..mu..l/liter to 500-600 ..mu..l/liter in the next 50 to 75 years. Plant scientists are artificially enhancing the CO/sub 2/ environment of crop plants to increase photosynthesis, which is currently limited by inadequate levels of CO/sub 2/. It is not known how increases of CO/sub 2/ might affect consumers in the food chain. Population levels of sweet potato whitefly (SPWF), Bermisiaa tabaci (Gennadius), were assessed with sticky traps placed in a field experiment wherein cotton was grown in open-top field chambers that were enriched with CO/sub 2/ at levels approaching 200% ambient concentration levels. Although trapping started at the first of June, only an occasional SPWF was caught until early August. At that time populations began to increase at an exponential rate similar to that observed in commercial cotton fields in Arizona and California in previous years. There was no difference in rate of buildup of SPWF in ambient and CO/sub 2/-enriched chambers in either wet or dry irrigation treatment. Thus, it seems that raised CO/sub 2/ levels, either natural or artificial, do not affect SPWF populations.

  13. [Phagodeterrent activity of the plants Tithonia diversifolia and Montanoa hibiscifolia (Asteraceae) on adults of the pest insect Bemisia tabaci (Homoptera: Aleyrodidae)].

    Science.gov (United States)

    Bagnarello, Gina; Hilje, Luko; Bagnarello, Vanessa; Cartín, Victor; Calvo, Marco

    2009-12-01

    Bemisia tabaci (Gennadius) is a polyphagous, cosmopolitan and worldwide relevant pest, mainly acting as a virus vector on many crops. A sound preventive approach to deal with it would be the application of repellent or deterrent substances hopefully present in tropical plants, which in turn may contribute to take advantage of the remarkable rich Mesoamerican biodiversity. Therefore, extracts of two wild plants belonging to family Asteraceae, titonia (Tithonia diversifolia) and "tora" (Montanoa hibiscifolia), were tested for phagodeterrence to B. tabaci adults. The crude leaf extract of each one, as well as four fractions thereof (hexane, dichlorometane, ethyl acetate, and methanol) were tested under greenhouse conditions; in addition, the extracts were submitted to a phytochemical screening to determine possible metabolites causing phagodeterrence. Both restricted-choice and unrestricted-choice experiments were conducted. In the former ones, each fraction was tested at four doses (0.1, 0.5, 1.0 and 1.5% v/v), which were compared with four control treatments: distilled water, endosulfan, an agricultural oil (Aceite Agricola 81 SC), and the emulsifier Citowett. Tomato plants were sprayed and placed inside sleeve cages, where 50 B. tabaci adults were released. The criterion to appraise phagodeterrence was the number of landed adults on plants at 48h. For the unrestricted-choice experiments, only the two highest doses (1.0 and 1.5%) of the crude extracts of each species were tested, and compared to distilled water and the agricultural oil. The titonia and "tora" crude extracts caused phagodeterrence, and for both plant species the methanol fraction stood out. Results suggest that metabolites causing phagodeterrence are several sesquiterpenic lactones, polyphenolic compounds (flavonoids and tannins) and saponins.

  14. Herencia de la resistencia al daño mecánico causado por Tagosodes orizicolus (Muir (Homoptera-Delphacidae en arroz Oryza sativa

    Directory of Open Access Journals (Sweden)

    Cuevas P. Federico

    1996-12-01

    Full Text Available

    In Colombia all rice varieties developed are reported as resistant to Tagosodes orizicolus. Given the narrow genetic base of the resistant sources, this study was undertaken to identify the resistant parents or donors more oftenly used in Latin America. The materials were characterized as resistant (Mudgo, Amistad 82, IRAT 120, IRAT 124, Makalioka or susceptible based on the free chosen test and non chosen test and on the survival and oviposition of the insect (Chianan 8, Colombia 1, Bluebonnet 50, IR 8 (lCA, IR 8 (IRRI, Tetep and Cica 8. The damage was associated with insect survival, oviposition and eggs eclotion. To determine heritability two parents (Makalioka and Mudgo, were crossed with IR 8 F1 and F3 populations were also evaluated based on the free chosen test.

     

     

    En Colombia las variedades de arroz desarrolladas se consideran como resistentes a Tagosodes orizicolus. Dada la estrechez genética de las fuentes de resistencia, se inició este estudio para identificar los progenitores donantes de resistencia usados con mayor frecuencia en América Latina. Los materiales se caracterizaron como resistentes (Mudgo, Amistad 82, IRAT, 120, IRAT 124 Y Makalioka o susceptibles (Chianan 8, Colombia 1, Bluebonnet 50, IR 8 (lCA, IR (IRRI, Tetep y Cica 8, con base en las pruebas de libre escogencia, no escogencia, sobre vivencia y oviposición. El daño estuvo asociado con la supervivencia, oviposición y eclosión de huevos del insecto. Para la determinación de la herencia se cruzaron los progenitores Makalioka y Mudgo con IR8. En la Progenie F1 del cruzamiento resistente x resistente el 111% de las plantas fueron susceptibles; Mudgo y Makalioka segregaron 23 y 41% de plantas susceptibles.

  15. Female-induced increase of host-plant volatiles enhance specific attraction of aphid male Dysaphis plantaginea (Homoptera: Aphididae) to the sex pheromone

    NARCIS (Netherlands)

    Tol, van R.W.H.M.; Helsen, H.H.M.; Griepink, F.C.; Kogel, de W.J.

    2009-01-01

    All aphid species studied so far share the same sex pheromone components, nepetalactol and nepetalactone. Variation by different enantiomers and blends of the two components released by different aphid species are limited and can only partially explain species-specific attraction of males to

  16. The propensity of different larval stages of lacewing Chrysoperla carnea (Stephens (Neuroptera: Chrysopidae to control aphid Myzus persicae (Sulzer (Homoptera: Aphididae evaluated on Canola Brassica napus L.

    Directory of Open Access Journals (Sweden)

    Muhammad Sarwar

    2014-04-01

    Full Text Available Green lacewings (Neuroptera: Chrysopidae are considered among the most effective generalist predators of aphids. In the present experimentation, the use of 1st, 2nd and 3rd instars of the chrysopid Chrysoperla carnea (Stephens larvae against aphids pest was investigated under field conditions in Brassica napus L. Four releases of predator’s 1st, 2nd and 3rd instar larvae were made from the time of aphid’s appearance on canola crop till its maturity at fortnightly intervals. The influences on aphids due to the larvae of C. carnea predator were assessed by examining pest incidence and abundance of the natural enemies at plant growth stage, and seed yield recorded at crop harvest in the test field. Results indicated that predators, irrespective of their developmental stage, reacted very positively to their preys’ reduction except in untreated control. Of the different larval stages tested, the applications of 1st instar followed by 2nd and 3rd instar larvae were most effective in reducing aphids’ population compared with untreated control. In the similar fashion, the releases of 1st and 2nd instar larvae of C. carnea were more effective in increasing crop yields compared with check treatment. Obviously, the applications of 1st and 2nd instar larvae of C. carnea involved efficiently in prey location and consumption, and performed predation activity for longer period (2-3 weeks. On the other hand, the release of 3rd instar larvae was too late to play a direct beneficial role in crop protection suggesting that they may have less time (1 week to remain involved in efficient prey consumption. Further, 1st or 2nd instar larvae may be much hungrier and eaten more pests in study areas without resting or moving to new location and thus can potentially be used to enhance biological control of aphids.

  17. Host Plant-Herbivore-Predator Interactions in Chrysoperla carnea (Neuroptera: Chrysopidae) and Myzus persicae (Homoptera: Aphididae) on Four Plant Species Under Laboratory Conditions.

    Science.gov (United States)

    Farrokhi, Milad; Gharekhani, Gholamhossein; Iranipour, Shahzad; Hassanpour, Mahdi

    2017-12-05

    The common green lacewing, Chrysoperla carnea (Stephens) (Neuroptera: Chrysopidae), is a well-known biocontrol agent. The current study examined host plant-herbivore-predator interactions with C. carnea and Myzus persicae on four host plants (peach, almond, pepper, and potato). The experiments were carried out at 25 ± 1°C and 65 ± 5% RH at a photoperiod of 16:8 (L:D) h). Duration of the preadult growth period, adult longevity, fecundity, and population growth parameters were analyzed based on the age-stage, two-sex life table theory. The shortest and longest preadult developmental times of the predator were observed on the peach and potato, respectively. The highest and lowest predation rate, oviposition period, and male and female longevity of predator were also observed on the peach and potato, respectively. The lowest intrinsic rate of increase (r) and finite rate of increase (λ) were observed on the potato (0.1087 and 1.11 d-1, respectively) and the highest on the peach (0.1460 and 1.15 d-1, respectively). The maximum and minimum mean generation times (T) were 41.84 and 35.59 d in the potato and peach, respectively. Overall, peach was found to be a more appropriate host than the other host plants for development and predation fitness of C. carnea. These findings reveal that information on tritrophic interactions and subsequent life table evaluation of natural enemies improves integrated pest management programs. Published by Oxford University Press on behalf of Entomological Society of America 2017. This work is written by (a) US Government employee(s) and is in the public domain in the US.

  18. The study and analysis of the mating behavior and sound production of male cicada Psalmocharias alhageos (Kol.) (Homoptera:Cicadidae) to make disruption in mating.

    Science.gov (United States)

    Zamanian, H; Mehdipour, M; Ghaemi, N

    2008-09-01

    Psalmocharias alhageos is an important pest of vine in most parts of Iran, Afghanistan, Pakistan, southern areas of Russia, Turkey and Iraq. This cicada is spread in most provinces in Iran such as Esfahan, Hamedan, Qazvin, Markazi, Lorestan, Qom, Kerman, Tehran and Kordestan. In addition to vine, this insect damages some other fruit trees, such as apple, sour cherry, quince, peach, pomegranate and pear trees and some non-fruit trees, namely white poplar, ash, elm, eglantine, silk and black poplar trees. The nymphs of cicada damage the trees by feeding on root, adult insects on young bud and by oviposition under branch barks. Nourishing root by nymph leads to the weakness of the tree and hinder its growth. The high density oviposition of adult insects inside young barks causes withering of branches. The resulted damage on vine products is 40% which is one of the most important factors in product reduction in vineyard. This research was conducted in Takestan in Qazvin. It was conducted for the first time to study the behaviors of the mates of this vine cicada in order to manage it. Two systems were used to record the sound of male cicada called analog voice-recorder and digital voice recorder. To analyze the recorded sound of the male cicada we used of spectrum analyzer, digital storage oscilloscope and protens 7 computer softwares. We could call the attention of natural enemies an disturb the male insect's attracting sound by producing natural and artificial sound in the range of 1-6 kHz in two different ripeness status of the fruits and could prevent mating and oviposition of female cicadas.

  19. Reproducción de cochinilla silvestre Dactylopius opuntiae (Homóptera: Dactylopiidae Reproduction of wild cochineal Dactylopius opuntiae (Homoptera: Dactylopiidae

    Directory of Open Access Journals (Sweden)

    Arnoldo Flores-Hernández

    2006-06-01

    Full Text Available Por sus características, la cochinilla silvestre ofrece perspectivas de aprovechamiento como fuente de carmín y para el mejoramiento genético de la grana fina. Por lo anterior, se estableció una multiplicación y crianza de cochinilla silvestre, proveniente de la zona árida del norte de México para caracterizarla, utilizando como hospedero a Opuntia megacantha Salm Dyck. Los resultados indican que la especie silvestre pertenece al género-especie Dactylopius opuntia. Se determinó la presencia de partenogénesis en hembras. La duración de los estadios biológicos depende del sexo del insecto; el adulto hembra permaneció durante 38.4 días y 4.2 días para machos, los primeros estadios ninfales fueron similares en duración (18.1-19.8 días. El ciclo biológico de las hembras fue de 77 días mientras que el de los machos fue de 43 días. Para las hembras se estimó un periodo de preoviposición de 18.8 días, manteniéndose en oviposición durante 21 días con un promedio de 131 insectos por hembra. La proporción sexual hembras: machos fue 1:1. El tipo de reproducción fue predominantemente sexual, aunque hubo hembras partenogénicas. Este es el primer reporte de Dactylopius opuntiae como cochinilla silvestre asociada a la zona árida del noreste de México, específicamente en el Bolsón de Mapimí, Durango, México.Wild cochineal has characteristics that offer advantage as a source of carmine and for fine cochineal improvement. To characterize wild cochineal, we initiated a breeding effort raising wild cochineal from the arid zone of the north oh Mexico, using as a host organism Opuntia megacantha Salm dick. The results indicate that the wild specie is Dactylopius opuntiae. The presence of parthenogenesis in females was determined. The duration of ontogenetic stages depends on the sex of the insect. The adult female lasted 38.4 days and 4.2 days for males, the first stage nymphs were similar in duration (18-19.8 days. The complete biological cycle of the females was 77 days, and in the males 43 days. A period of preoviposition of 18.8 days for the females was found, laying eggs during 21 days with an average of 131 insects per female. The sex ratio female: male was 1:1. The reproduction generally was sexual although there were parthenogenetic females. This is the first report of Dactylopius opuntiae as a source of wild cochineal in the arid zone of North, Central and Norwest of Mexico specifically in the Bolson of Mapimí, Durango, Mexico.

  20. Microsatellite markers reveal a predominant sugarcane aphid (Homoptera: Aphididae) clone is found on sorghum in seven states and one territory of the USA

    Science.gov (United States)

    The sugarcane aphid, Melanaphis sacchari, has become a serious pest causing severe economic losses to sorghum grown in the southern United States (U.S.). Since its original detection in four states in 2013, M. sacchari on sorghum has now, for 2016, spread to 19 states. The presence of one or multip...

  1. Impact of insecticides on non-target arthropods in watermelon cropImpacto de inseticidas em artrópodes não-alvo associados à cultura da melancia

    Directory of Open Access Journals (Sweden)

    Cíntia Ribeiro Souza

    2012-10-01

    Full Text Available Watermelon Citrullus lunatus (Thunberg, Matsumura & Nakai is an ecosystem having a variety of arthropods, each one playing a specific role. Although some of them are considered pest to crops, some others are responsible for soil aeration, nutrient release and predation of pest species and are, therefore, considered beneficial to crops. The intensive farming practiced for watermelon cultivation in Brazil is based on the use of tiamethoxam and deltamethrin, which may not only kill target but also nontarget organisms such as beneficial arthropods. Research data regarding the influence of insecticides on arthropods in watermelon cropping is scarce. This study aimed to evaluate the effect of the insecticides deltamethrin and thiamethoxam on soil surface and watermelon canopy arthropod community. The study was carried out in the State of Tocantins, Brazil. Although the application of thiamethoxam and deltamethrin was efficient in controlling populations of Aphis gossypii (Glover, as we expected, they negatively affected non-target arthropods such as detritivores insects in the canopy and soil surface. Ecological implications of the impact of such pesticides on beneficial arthropod species are discussed.A cultura da melancia Citrullus lunatus (Thunberg, Matsumura & Nakai abriga uma grande diversidade de artrópodes, cada um desempenhando um papel específico. Apesar de alguns desses artrópodes serem considerados pragas, outros são responsáveis pela aeração do solo, liberação de nutrientes e predação das espécies-praga, sendo, dessa forma, considerados benéficos às culturas. A agricultura intensiva praticada no Brasil para o cultivo da melancia é baseada no uso dos inseticidas como tiamethoxam e deltametrina, que pode não só matar as pragas, mas também organismos não-alvo. Pesquisas relacionadas à influência de inseticidas sobre artrópodes benéficos na cultura da melancia são escassas. Este estudo foi realizado com o objetivo de

  2. A comparison of alternative plant mixes for conservation bio-control by native beneficial arthropods in vegetable cropping systems in Queensland Australia.

    Science.gov (United States)

    Qureshi, S A; Midmore, D J; Syeda, S S; Reid, D J

    2010-02-01

    Cucurbit crops host a range of serious sap-sucking insect pests, including silverleaf whitefly (SLW) and aphids, which potentially represent considerable risk to the Australian horticulture industry. These pests are extremely polyphagous with a wide host range. Chemical control is made difficult due to resistance and pollution, and other side-effects are associated with insecticide use. Consequently, there is much interest in maximising the role of biological control in the management of these sap-sucking insect pests. This study aimed to evaluate companion cropping alongside cucurbit crops in a tropical setting as a means to increase the populations of beneficial insects and spiders so as to control the major sap-sucking insect pests. The population of beneficial and harmful insects, with a focus on SLW and aphids, and other invertebrates were sampled weekly on four different crops which could be used for habitat manipulation: Goodbug Mix (GBM; a proprietary seed mixture including self-sowing annual and perennial herbaceous flower species); lablab (Lablab purpureus L. Sweet); lucerne (Medicago sativa L.); and niger (Guizotia abyssinica (L.f.) Cass.). Lablab hosted the highest numbers of beneficial insects (larvae and adults of lacewing (Mallada signata (Schneider)), ladybird beetles (Coccinella transversalis Fabricius) and spiders) while GBM hosted the highest numbers of European bees (Apis mellifera Linnaeus) and spiders. Lucerne and niger showed little promise in hosting beneficial insects, but lucerne hosted significantly more spiders (double the numbers) than niger. Lucerne hosted sig-nificantly more of the harmful insect species of aphids (Aphis gossypii (Glover)) and Myzus persicae (Sulzer)) and heliothis (Heliothis armigera Hübner). Niger hosted significantly more vegetable weevils (Listroderes difficillis (Germar)) than the other three species. Therefore, lablab and GBM appear to be viable options to grow within cucurbits or as field boundary crops to

  3. Monitoring of aphid flight activities in seed potato crops in Serbia

    Directory of Open Access Journals (Sweden)

    Andja Vucetic

    2013-07-01

    Full Text Available Aphid flight activities in seed potato fields have been studied by the yellow water traps. It is a good method for monitoring aphids as vectors of viruses, but this study also showed it is a suitable method for insect-diversity research. During the four-year studies, over 11.500 specimens were collected and a total of 107 different taxa of aphids were identified. The most abundant species were polyphagous species, such as: Acyrthosiphon pisum (Haris, Aphis fabae Scopoli, Aphis gossypii Glover and Brachycaudus helichrysi (Kaltenbach. The results of the studies show that diversity of aphids in different regions of Serbia is similar regardless of the altitude and the diversity of terrain. At most sites it ranged from 2 to 3. The highest value was recorded in Begeč, locality in northern part of Serbia, in year 2008, and it was 2.92. The maximum values of the Shannon-Weaver diversity index at all sites were recorded in the first weeks of the monitoring of aphid flight activities. Morisita-Horn similarity index shows no significant differences between sites regardless of altitudes. The sites are grouped by year, not by similarity of relief. In spite of these results, the Chi-square analysis showed highly significant difference in vector frequencies among seasons and sites with more pronounced differences for PVY. As a consequence of differences in vector frequencies, the vector pressure index in some regions was different also. The number of vectors and vector pressure index vary depending on the altitude of localities. At localities at altitudes under 1000 m, they were high. The highest index was at Kotraža, locality in central part of Serbia, in 2007, when PVY index exceeded the value of 180, while for PLRV it was 60. At high altitudes on mountain Golija, above 1100 m, the number of aphids was low, as well as the vector pressure index which indicates that these regions are suitable for producing virus-free seed potato.

  4. Concours annuels

    Directory of Open Access Journals (Sweden)

    Royal Academy for Overseas Sciences

    2016-01-01

    Full Text Available Yearly competitions. Pour améliorer le rendement agricole, on est amené à établir des programmes de fertilisation des sols et de protection phytosanitaire souvent basés essentiellement sur l'utilisation des intrants chimiques. Cependant, l'utilisation des engrais chimiques peut entraîner la dégradation des sols et favoriser le développement des insectes ravageurs piqueurs-suceurs. Il est donc nécessaire de rechercher des méthodes de fertilisation alternatives qui permettraient de limiter la prolifération des insectes. La rhizobactérie Bacillus amyloliquefaciens est connue comme bio-fertilisant. Le présent travail vise à évaluer la dynamique des populations du puceron A. gossypii Glover sur le cotonnier en fonction du matériel de fertilisation utilisé, à savoir la souche de B. amyloliquefaciens FZB 42 et l'engrais minéral (NPKSMgB: 21-17-10-4,5-3,5-0,75. A cet effet, trois variantes ont été testées: trempage des semences dans la suspension de la rhizobactérie, application de NPKSMgB et un témoin (sans apport de fertilisant. Les résultats ont montré que les cotonniers fertilisés avec de l'engrais minéral ont de façon significative attiré plus de pucerons que les plantes fertilisées avec B. amyloliquefaciens. Sur la base de ces résultats et de données obtenues dans d'autres essais menés en plein champ qui montraient un effet positif de l'application de B. amyloliquefaciens sur le rendement du cotonnier, on peut conclure que l'utilisation de cette rhizobactérie peut constituer une solution intéressante pour la fertilisation du cotonnier.

  5. Adult attractiveness and oviposition preference of Bemisia tabaci (Genn. (Homoptera: Aleyrodidae B-biotype in cotton genotypes Atratividade de adultos e preferência para oviposição de Bemisia tabaci (Genn. (Homoptera: Aleyrodidae biótipo B em genótipos de algodoeiro

    Directory of Open Access Journals (Sweden)

    Arlindo Leal Boiça Júnior

    2007-01-01

    Full Text Available The silverleaf whitefly Bemisia tabaci B-biotype is an important pest of cotton; it affects plant vigour, transmits geminivirus and reduces lint quality. In order to evaluate the resistance of cotton genotypes, Gossypium hirsutum (L., to the whitefly Bemisia tabaci B-biotype, both free-choice and no-choice attractiveness and non-preference for oviposition tests were carried out in a shade house, at room temperature. Low attractiveness to adults of this whitefly was observed for plants of genotypes Fabrika, CNPA Ita 90, Makina, Coodetec 407, and IAC 01-639 CPA 02-24, which may represent a resistance component of these genetic materials to the insect. Genotypes BRS Aroeira, Coodetec 406, Fabrika, and Coodetec 401 presented the non-preference-for-oviposition type of resistance in the free-choice and no-choice tests. The numbers of trichomes and gossypol glands per cm² were not suitable to evaluate non-preference for oviposition of whitefly adults on cotton genotypes.Considerada importante praga do algodoeiro, a mosca-branca Bemisia tabaci biótipo B pode através de sua alimentação, diminuir o vigor das plantas, trasmitir vírus e prejudicar a qualidade da fibra. Visando avaliar a resistência de genótipos de algodoeiro, Gossypium hirsutum (L., à mosca-branca Bemisia tabaci biótipo B, realizaram-se testes de atratividade e não-preferência para oviposição, com e sem chance de escolha, em telado, a temperatura ambiente. Verificou-se baixa atratividade das plantas dos genótipos Fabrika, CNPA Ita 90, Makina, Coodetec 407 e IAC 01-639 CPA 02-24 a adultos dessa mosca-branca, o que pode representar um componente de resistência destes materiais genéticos ao inseto. Os genótipos BRS Aroeira, Coodetec 406, Fabrika e Coodetec 401 apresentaram resistência do tipo não-preferência para oviposição, nos testes com e sem chance de escolha. Os números de tricomas e de glândulas de gossipol por cm² não foram adequados para se avaliar a não-preferência para oviposição de adultos da mosca-branca em genótipos de algodoeiro.

  6. Luta biológica clássica com Hyperaspis pantherina Fürsch (Coleoptera: Coccinellidae no combate à Orthezia insignis Browne (Homoptera: Ortheziidae em jacarandá Biological control with Hyperaspis pantherina Fürsch (Coleoptera: Coccinellidae to control Orthezia insignis Browne (Homoptera: Ortheziidae on blue jacaranda

    Directory of Open Access Journals (Sweden)

    Ana Paula Félix

    2008-12-01

    Full Text Available Os jacarandás e várias plantas ornamentais que ornamentam passeios e áreas ajardinadas da cidade do Funchal encontram-se infestados pela cochonilha Orthezia insignis Browne. Para combater esta praga foi importada do Quénia, uma joaninha, Hyperaspis pantherina Fürsch. Este predador é específico de O. insignis e tem sido utilizado, com sucesso em programas de luta biológica, em vários países de África, no Peru, Hawai e na Ilha de Santa Helena. Na Ilha da Madeira, desde Julho de 2002, H. pantherina está a ser criado em laboratório e largado em jacarandás infestados com o objectivo de combater a cochonilha-dojacarandá através da luta biológica clássica. Referem-se as largadas de H. pantherina e o sistema de monitorização adoptado para verificar a aclimatação do predador.The Jacaranda trees and other ornamental plants used in sidewalks and gardenlike areas of sidewalks and other gardened areas of the downton Capital city of Madeira Island (Funchal, are infested by the Jacaranda or Lantana Bug, Orthezia insignis Browne. A ladybird, Hyperaspis pantherina Fürsch, was imported from Kenya to control this pest. This ladybird is a specific predator of O. insignis and it has been used, successfully in biological control programs, in several countries of Africa, in Peru, Hawaii and in Santa Helena Island. In Madeira Island, H. pantherina is being reared in laboratory and released into infested jacarandas since July 2002, in a classical biological control way. The releasing of H. pantherina is described in detail as well as the adopted monitoring system to verify its acclimation.

  7. Toxicidade de manipueira de mandioca (Manihot esculenta Crantz e erva-de-rato (Palicourea marcgravii St. Hill a adultos de Toxoptera citricida Kirkaldy (Homoptera: Aphididae Toxicity of cassava manipueira (Manihot esculenta Crantz and erva-de-rato (Palicourea marcgravii St. Hill to adults of Toxoptera citricida Kirkaldy (Homoptera: Aphididae

    Directory of Open Access Journals (Sweden)

    Adriana Dantas Gonzaga

    2008-01-01

    Full Text Available A utilização de extratos de plantas pode ser uma alternativa para o controle de pragas. Dentre as plantas com atividade inseticida, destacam-se a erva-de-rato (Palicourea marcgravii e o subproduto (manipueira da produção de farinha de mandioca (Manihot esculenta, plantas comuns na região Amazônica. Esse trabalho teve, como principal objetivo, investigar o potencial inseticida da manipueira e do extrato de erva-de-rato sobre Toxoptera citricida (pulgão-preto do citros. Os extratos liofilizados de manipueira e de erva-de-rato foram pulverizados sobre plantas de citros contendo pulgões em cinco concentrações (10mg/ml, 20mg/ml, 30mg/ml, 40mg/ml e 50mg/ml. Todas as concentrações analisadas causaram mortalidade dos pulgões superior a 50%, sendo que a maior concentração causou a mortalidade de todos os insetos. O potencial destes extratos demonstrado no experimento coloca os mesmos como uma alternativa ao uso de inseticidas sintéticos no controle do pulgão-preto dos citros.The utilization of plant extracts might be an alternative for the control of crop pests. Between the plants with insecticide potential, stands-out: Erva-de-rato (Palicourea marcgravii and the Cassava, a byproduct of the manipueira (Manihot esculenta,common plants in the amazon region. That work had as main objective , to investigate the insecticide potential of Manihot esculenta (manipueira of cassava and Palicourea marcgravii (erva-de-rato on Toxoptera citricida (brown citrus aphid, in experimental conditions. The freeze dryed Manipueira and and Erva-de-rato extracts, were sprayed on citrus plants infected by brown citros aphid. In laboratory, extracts of these two plants were obtained in five concentrations (10mg/ml, 20mg/ml, 30mg/ml, 40mg/ml and 50mg/ml. All the analyzed concentrations (10 to 50mg/ml caused mortality on T. citricida of above 50%, and the higher concentration of 50mg/ml caused the mortality of all the insects (n = 100% in application processes contact. The potential of these extracts, as demonstrated in the tests, confirms that they can be an insecticide alternative, for the control of the brown citrus aphid.

  8. Membracidos de Colombia - I. Revisión parcial de las especies del género Alchisme Kirkaldy (Homoptera: Membracidae: Hoplophorioninae Membracidos de Colombia - I. Revisión parcial de las especies del género Alchisme Kirkaldy (Homoptera: Membracidae: Hoplophorioninae

    Directory of Open Access Journals (Sweden)

    Restrepo Mejía Ruben

    1980-09-01

    Full Text Available Se revisó el género Alchisme Kirkaldy. De las diecinueve especies anotadas por Metcalf (1965 no se obtuvieron especímenes de A. apicalis (Walker, A. costaricensis Goding, A. elevata Goding, A. laticornis Funkhouser, A. pinguicornisFunkhouser, A. recurva (Stäl, A. spinosa Funkhouser y A. truncaticornis (Germar. Se incluyen las descripciones originales de estas especies y tentativamente se localizan en la clave presentada. Se redescriben: A. bos (Fairmaire, A. fastidiosa (Fairmaire, A. grossa (Fairmaire, A. inermis (Fairmaire, A. nigrocarinata (Fairmaire, A. rubrocostata (Spinola, A. turrita (Germar, A. ustulata (Fairmaire, A. virescens (Fairmaire y A. nigrocarinata var. tridentata (Fairmaire, para la cual se usa su combinación original A. tridentata (Fairmaire. Se sinonimizóa A. projecta Funkhouser en favor de A. bos (Fairmaire.Se ilustran las principales características del pronoto y de los genitales de los machos; se observaron y se obtuvieron fotografías de los edeagos en un microscopio electrónico "rastreador" (Scanning Electro Microscope, las cualesse incluyen como parte de las ilustraciones. Se analizó la distribución geográfica del género y se ilustró por medio de mapas.The genus Alchisme Kirkaldy was revised. From nineteen species listed by Metcalf (1965 not specimens were obtained of eight of them. Original descriptions of these species are included and tentatively are localized in the key.  A redescription is given for the species A. bos (Fairmaire, A. fastidiosa (Fairmaire, A. grossa (Fairmaire, A. inermis (Fairmaire, A. nigrocarinata (Fairmaire, A. rubrocostata (Spinola, A. turrita (Germar, A. ustulata (Fairmaire, A. virescens (Fairmaire y A. nigrocarinata var. tridentata (Fairmaire, for which was used the original combination A. tridentata (Fairmaire. A. projecta Funkhouser was synonymized in A. bos (Fairmaire. The main pronotum characters and male genitalia are illustred; Scanning Electro Microscope pictures of the aedeagus of the insects were observed and obtained and are included as part of the illustrations. Geographic distributionsof the genus was analized and maps were prepared.

  9. Control of whiteflies and aphids in tomato ( Solanum lycopersicum L ...

    African Journals Online (AJOL)

    Whitefly (Bemisia tabaci, Homoptera: Aleyrodidae) and aphid (Homoptera) on tomato (Solanum lycopersicum L.) are economically important insect pests that are difficult to manage due to their resistance to a wide range of chemical pesticides. Field experiments were conducted to assess the effects of fermented plant ...

  10. Development of a stage-structured process-based predator–prey model to analyse biological control of cotton aphid, Aphis gossypii, by the sevenspot ladybeetle, Coccinella septempunctata, in cotton

    NARCIS (Netherlands)

    Xia, J.Y.; Wang, J.; Cui, J.J.; Leffelaar, P.A.; Rabbinge, R.; Werf, van der W.

    2018-01-01

    Agricultural system diversification is well known to affect the population dynamics of crop pests, but predator–prey dynamics in crop systems are difficult to analyse due to interactions between multiple life stages of predator and prey, the modulating effect of temperature, the actions of

  11. The impact of task constraints on the planning and control of interceptive hitting movements

    NARCIS (Netherlands)

    Caljouw, S.R.; van der Kamp, J.; Savelsbergh, G.J.P.

    2006-01-01

    On the basis of research in self-paced aiming movements, Glover [S. Glover, Separate visual representations in the planning and control of action, Behav. Brain Sci., 27 (2004) 3-24] proposed a dichotomy between visual systems that accommodate planning and on-line control of action. Specifically, the

  12. Occurrence of Diaretiella rapae (Mc´Intosh, 1855 (Hymenoptera: Aphidiidae Parasitising Lipaphis erysimi (Kaltenbach, 1843 and Brevicoryne brassicae (L. 1758 (Homoptera: Aphididae in Brassica napus in Mato Grosso do Sul

    Directory of Open Access Journals (Sweden)

    Mussury Rosilda Mara

    2002-01-01

    Full Text Available The occurrence of Diaretiella rapae parasitising Lipaphis erysimi and Brevicoryne brassicae in canola field (Brassica napus was evaluated through two sample methods in Dourados-MS. The methods, used weekly, were: entomologic sweep net and plants sacking. The aphids population was observed from initial to the senescence plant development. Aphids were more abundant during the flowering phase, and they were usually located in the stems of the inflorescence and development fruits. In this phase the largest parasitism level for D. rapae (89,7% occurred. The sample method with a sweep net captured significantly (t=4,484, P <= 0,01 more D. rapae while sacking method captured more parasitise aphids (t=2,199 with P <= 0,05 and active aphids (t=3,513, P <= 0,01.

  13. Health assessment of pine forest as affected by geothermal activities: Presence of Monterey pine aphid, Essigella californica (Essig (Homoptera: Aphidae associated with higher concentrations of boron on pine needles

    Directory of Open Access Journals (Sweden)

    Adolfo Arturo Del Rio Mora

    2014-06-01

    Full Text Available Studies on assessments of the air pollution and deposition caused by geothermal fields on the forest health and presence of pests have been few documented to date. In the geothermal field "Los Humeros", located between the borders of the states of Puebla and Veracruz, Mexico was realized a forest health monitoring to know the assessment could have these emissions of sulphur (S and other two chemical elements measured by their concentrations on leaf tissues in the surrounding forests. For it were evaluated the forest healthy and pest insects registered at 20 stands of which were chosen completely at random 40 trees in total/site of the species Pinus montezumae and P. teocotein natural stands and plantations and picked up leaf tissue samples representatives per stand to determine the contents of sulphur (S, boron (B and arsenic (As representing each forest stand. The results of the study revealed that the presence of forest pests are not related to the proximity of the sites to emissions from stationary sources of emissions and moreover the amount of these 3 chemical substances monitored do not have none influence on the forest healthy sites condition, except for the Monterey pine aphid Essigella californica Essig, which seems to be directly associated with higher Boron content in the needles (mean=167.47±32.15, and peak 635.46 ppm and proximity of emission sources geothermal vents or where it is believed all these chemical elements are carried down by air currents to specific points and deposited in the stands. The general model obtained and with significance of R2=56.6 and P value 0.0033 for the presence of Monterey Pine aphid and the three main pollutants released from smoke plumes in geothermal systems is [D: Essigella]= -0.2088 + 1.880E-0.5 (A:SO4+ 0.002245 (B:B + 1.248 (C:As. The results suggest the use of aphid species as bioindicators of polluted sites.

  14. Taxonomic study of Central Asian species of the genus Macropsis Lewis, 1836 (Homoptera: Auchenorrhyncha: Cicadellidae: Macropsinae). III: Descriptions of two new willow-dwelling species, new synonym, annotated check-list, and key to species.

    Science.gov (United States)

    Tishechkin, Dmitri Yu

    2015-07-09

    Macropsis milkoi Tishetshkin sp. n. from West Tien Shan, Alay and Hissar-Darvaz Mts. (Kyrgyzstan and Tajikistan) and Macropsis anufrievi Tishetshkin sp. n. from Hissar-Darvaz Mts. (Tajikistan) are described. M. elaeagni Emelyanov, 1964 = M. cyanescens Dubovskiy, 1966 syn. n. is redescribed and illustrated based on the material from Central Asia. Annotated check list and key to 30 Macropsis species from Uzbekistan, Kyrgyzstan, Tajikistan and the mountains of Southern Kazakhstan are given.

  15. Aphids (Homoptera, Aphidodea inhabiting the trees Crataegus x media Bechst. in the urban green area. Part II. Domination and frequency of aphids, their enemies and the damage caused by aphids

    Directory of Open Access Journals (Sweden)

    Aneta Sławińska

    2013-12-01

    Full Text Available The studies were conducted in Lublin in the years 1999-2001 in two sites (street and park ones on the trees Crataegus x inedia Bechst. The purpose was to determine the domination and frequency of particular aphid species, their effect on the decorative character of plants as well as the occurrence of the aphidophagous in aphid colonies. It was found out that A. pomi was the dominating species in both sites. The decorative character of the studied trees was lowered by aphids A. pomi and aphids from the genus Dysaphis. Aphids from the genus Dysaphis also caused changes in the chemical composition of the injured plant parts. The presence of predatory arthropods was observed in aphid colonies occurring on hawthorn. The most numerous of these were the larvae of Syrphidae and Coccinellidae. The culture of parasitized aphids gave numerous flights of parasitoids and hyperparasitoids. Greater number of both predators and parasitoids of I and II grades were observed in the street site as compared to the park site.

  16. Use Google Scholar, Scopus and Web of Science for Comprehensive Citation Tracking. A review of: Bakkalbasi, Nisa, Kathleen Bauer, Janis Glover and Lei Wang. “Three Options for Citation Tracking: Google Scholar, Scopus and Web of Science.” Biomedical Digital Libraries 3.7 (2006.

    Directory of Open Access Journals (Sweden)

    Lorie A. Kloda

    2007-09-01

    Full Text Available Objective – To determine whether three competing citation tracking services result in differing citation counts for a known set of articles, and to assess the extent of any differences.Design – Citation analysis, observational study.Setting – Three citation tracking databases: Google Scholar, Scopus and Web of Science. Subjects – Citations from eleven journals each from the disciplines of oncology and condensed matter physics for the years 1993 and 2003.Methods – The researchers selected eleven journals each from the list of journals from Journal Citation Reports 2004 for the categories “Oncology” and “Condensed Matter Physics” using a systematic sampling technique to ensure journals with vary ingimpact factors were included. All references from these 22 journals were retrieved for the years 1993 and 2003 by searching three databases: Web of Science, INSPEC, and PubMed. Only research articles were included for the purpose of the study. From these, a stratified random sample was created to proportionally represent the content of each journal (oncology 1993: 234 references, 2003: 259 references; condensed matter physics 1993: 358 references, 2003: 364 references. In November of 2005, citations counts were obtained for all articles from Web of Science, Scopus and GoogleScholar. Due to the small sample size and skewed distribution of data, non‐parametric tests were conducted to determine whether significant differences existed between sets.Main Results – For 1993, mean citation counts were highest in Web of Science for both oncology (mean = 45.3, SD = 77.4 and condensed matter physics (mean = 22.5, SD= 32.5. For 2003, mean citation counts were higher in Scopus for oncology (mean = 8.9,SD = 12.0, and in Web of Science for condensed matter physics (mean = 3.0, SD =4.0. There was not enough data for the set of citations from Scopus for condensed matter physics for 1993 and it was therefore excluded from analysis. A Friedman test to measure for differences between all remaining groups suggested a significant difference existed, and so pairwise post‐hoc comparisons were performed. The Wilcoxon Signed Ranked tests demonstrated significant differences “in citation counts between all pairs (p Conclusion – The study does not confirm the authors’ hypothesis that differing scholarly coverage would result in different citation counts from the three databases. While there were significant differences in mean citation rates between all pairs of databases except for Google Scholar and Scopus in condensed matter physics for 2003, no one database performed better overall. Different databases performed better for different subjects, as well as for different years, especially Scopus, which only includes references starting in 1996. The results of this study suggest that the best citation database will depend on the years being searched as well as the subject area. For a complete picture of citation behaviour, the authors suggest all three be used.

  17. The Natural and Cultural Environmental Resources of the Aquilla Creek Watershed, Hill County, Texas.

    Science.gov (United States)

    1972-11-01

    canadensis Jacq. Wild Lettuce Lactuca serriola L. Prickly Lettuce Lepidium austrinum Small Southern Peppergrass Lepidium virginicum L. var. medium...white ants) Plecoptera (Stoneflies) Hemiptera (Bugs) Homoptera (Cicadas, leafhoppers, aphids , scale insects) Heteroptera Hymenoptera (Sawflies, ants

  18. Natural history of whitefly in Costa Rica: an evolutionary starting point

    NARCIS (Netherlands)

    Burger, J.S.M.; Gort, G.; Van Lenteren, J.C.; Vet, L.E.M.

    2004-01-01

    To understand evolution of foraging behaviour in the whitefly parasitoid Encarsia formosa (Hymenoptera, Aphelinidae), natural densities and distributions of whitefly (Homoptera, Aleyrodidae) were quantified in E. formosa's presumed area of origin, the Neotropics. Leaves were collected in Costa Rican

  19. Natural history of whitefly in Costa Rica: an evolutionary starting point

    NARCIS (Netherlands)

    Burger, J.M.S.; Gort, G.; Lenteren, van J.C.; Vet, L.E.M.

    2004-01-01

    1. To understand evolution of foraging behaviour in the whitefly parasitoid Encarsia formosa (Hymenoptera, Aphelinidae), natural densities and distributions of whitefly (Homoptera, Aleyrodidae) were quantified in E. formosa's presumed area of origin, the Neotropics. 2. Leaves were collected in Costa

  20. Understanding biological control of greenhouse whitefly with the parasitoid Encarsia formosa : from individual behaviour to population dynamics

    NARCIS (Netherlands)

    Roermund, van H.J.W.

    1995-01-01

    The greenhouse whitefly, Trialeurodes vaporariorum (Westwood) (Homoptera, Aleyrodidae), is a very common, highly polyphagous pest insect all over the world. Biological control of whiteflies with the parasitoid Encarsia formosa Gahan (Hymenoptera, Aphelinidae) was already applied in the 1920s in

  1. Evaluating the impact of invasive species in forest landscapes: the southern pine beetle and the hemlock woolly adelgid

    Science.gov (United States)

    John D. Waldron; Robert N. Coulson; David M. Cairns; Charles W. Lafon; Maria D. Tchakerian; Weimin Xi; Kier Klepzig; Andrew. Birt

    2010-01-01

    The southern pine beetle, Dendroctonus frontalis (Zimmerman) (Coleoptera: Curculionidae: Scolytinae) (SPB), is an indigenous invasive species that infests and causes mortality to pines (Pinus spp.) throughout the Southern United States. The hemlock woolly adelgid, Adelges tsugae (Annand) (Homoptera:...

  2. Biogeographic congruence in the south Pacific

    DEFF Research Database (Denmark)

    Seberg, Ole

    1991-01-01

    Zealand, Tasmania and Australia) are congruent. The area cladograms are derived from Nothofagus (Fagacae), Embothriinae (Protaceae), Oreobolus (Cyperaceae), Cyttaria (Helotiales) and Eriococcidae (Homoptera). The resulting general area cladogram showing southern South America as the sister-area to New...

  3. Influence of pesticide treatments on the dynamics of whiteflies and associated parasitoids in snap bean fields

    NARCIS (Netherlands)

    Manzano, M.R.; Lenteren, van J.C.; Cardona, C.

    2003-01-01

    To determine the influence of pesticide treatments on the population dynamics of the whiteflies Trialeurodes vaporariorum (Westwood) and Bemisia tabaci Gennadius (Homoptera: Aleyrodidae) and their naturally occurring parasitoids, we performed field experiments on insecticide sprayed and unsprayed

  4. Intraguild predation by the generalist predator Orius majusculus on the parasitoid Encarsia formosa

    DEFF Research Database (Denmark)

    Sohrabi, Fariba; Enkegaard, Annie; Shishehbor, Parviz

    2013-01-01

    Intraguild predation of Orius majusculus (Reuter) (Heteroptera: Anthocoridae) on Encarsia formosa (Gahan) (Hymenoptera: Aphelinidae), both natural enemies of Bemisia tabaci (Gennadius) (Homoptera: Aleyrodidae), was studied under laboratory conditions. The experiments quantified prey consumption b...

  5. Research

    African Journals Online (AJOL)

    ebutamanya

    2016-05-27

    . PubMed | Google Scholar. 24. Glover-Amengor M, Owusu W, Akanmori B. Determinants of anaemia in pregnancy in Sekyere West District, Ghana. Ghana. Medical Journal. 2005;39(3):102. PubMed | Google Scholar. 25.

  6. ORF Alignment: NC_005786 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ossypii ATCC 10895] ref|NP_985218.1| AER362Wp ... [Eremothecium gossypii] ... Length = 115 ... Query: 54 ... RPTASIA...EFNNRYVGKLSNDEPERTYVINGQIRGIRVVGRSMCFVDLQQQGSALQLMVNH 113 ... RPTASIAEFNNRYVGKLSNDEPE...RTYVINGQIRGIRVVGRSMCFVDLQQQGSALQLMVNH Sbjct: 1 ... RPTASIAEFNNRYVGKLSNDEPERTYVINGQIRGIRVVGRSMCFVDLQQQGSALQLMVNH 60 ...

  7. Local Purchasing of Journals is Required in Addition to a Nationally Purchased Collection to Meet the Information Needs of NHS Staff. A review of: Glover, Steven William, John Addison, Colette Gleghorn, and John Bramwell. “Journal Usage in NHS Hospitals: A Comparison Report of Total Usage at an Acute NHS Trust and a Specialist NHS Trust in the North West of England.” Health Information and Libraries Journal 24.3 (2007: 193‐9.

    Directory of Open Access Journals (Sweden)

    Jennie Kelson

    2008-03-01

    Full Text Available Objective ‐ To compare journal usage between an acute National Health Service (NHS Trust and a specialist NHS Trust located in North West England to provide some evidence as to how well the National Core Content Collection (provided by ProQuest meets the needs of staff in these settings.Design ‐ Comparative studySetting ‐ An acute NHS Trust, comprising four hospital sites, and a cancer specialist NHS Trust based on a single site. Both Trusts are located in North West England. The cancer specialist NHS Trust is a teaching hospital with undergraduate nurses, medical students, and student radiographers. This Trust is also closely associated with an adjoining cancer research institute. The acute NHS Trust has a large number of healthcare staff in training and was not described as a teaching hospital.Subjects ‐ Staff of the respective NHS Trusts. The staff numbers for each organisation were not provided.Methods ‐ COUNTER usage statistics of online journals, obtained from publisher administration tools, were collected for one year covering the period 1 December 2005 to 30 November 2006. Where available, the number of photocopies made from print journals during the same period by library users for their own use was also included. All full‐text downloads of journal articles were counted as part of this study, hence the possibility of double counting if a single article was requested in both HTML and PDF versions. Details of free or open access articles accessed without the need for a username and password were not included in the study. To encourage use of the electronic journals, library services at both Trusts implemented a number of initiatives to maximize publicity. These included direct e‐mails to staff, posters, and presentations to staff. Athens registration, required for access to the electronic journal collections, was promoted as part of the induction process for new library users. Staff members were encouraged to apply for the electronic table of contents alert for journals in their area of specialty. An A‐Z list of journals was accessible via the Trusts’ intranet and internet sites, and direct links to electronic journals were added to the NHS Dialog/Datastar databases and on PubMed.Main results ‐ The libraries at both Trusts in the study provide the majority of their journals in electronic‐only format. In addition to the National Core Content titles, the cancer specialist Trust provides access to an additional five journal collections: Science Direct Health Sciences, Blackwell Synergy Medical and Nursing collection, five journals selected from Nature Publishing Group, selected society journals via HighWire Press and Oxford University Press titles. Staff members of the acute Trust have access to an additional three journal collections: Science Direct Health Sciences, the BMJ Publishing Group (BMJPG collection and 16 LWW titles via Ovid. During the study period, a total of 93,376 articles were downloaded or copied. Of these, 47,079 articles were downloaded or copied by staff of the cancer specialist NHS Trust and 46,297 articles were downloaded or copied by staff of the acute NHS Trust. The usage of each of the journal collections during the study period for each Trust is shown in the table below with the most used resource shown in bold. (See article for table General information regarding some of the commonly used journal titles by staff of each Trust was included in the commentary, but levels of use were not enumerated. Staff of the cancer specialist NHS Trust favoured cancer‐related titles, whilst staff of the acute NHS Trust accessed journal titles over a greater range of subject areas. Details of the top titles accessed from the National Core Content collection were not provided for either Trust. A possible reason given for the lower usage level of the National Core Content collection by the cancer specialist NHS Trust compared to the acute NHS Trust was the presence of embargoes on many cancer‐related titles within the National Core Content collection. Information about training offered to staff, their level of access to computer facilities,or familiarity with accessing electronic journal collections was not provided.Conclusion ‐ Staff of both Trusts in the study recorded a high level of journal use, with a total of 93,376 articles downloaded or photocopied during the study period. There was a marked difference in the usage patterns of the National Core Content journals between the two Trusts studied with the acute NHS Trust showing a higher proportion of usage (29.9%compared with the cancer specialist Trust(4.5%. Staff members of the acute NHS Trust accessed a greater range of subject areas, while staff those at the cancer specialist NHS Trust favoured cancer related titles.The results indicated that the National Core Content collection did not meet the information needs of the specialist cancer Trust as well as it met the needs of the more generalist acute Trust. The National Core Content collection appears insufficient to meet the diverse information needs of all NHS staff. Local purchasing of journals, in addition to national level provision, is therefore required to ensure that the needs of local specialties are adequately supported.

  8. Atropine’s Effects upon the Heart and Its Systemic Output,

    Science.gov (United States)

    1986-01-01

    1968. 7. ALLEN, G.S., A.B. GLOVER, M.W McCULLOCH , M.J. RAND, and D.F STORY. Modulation by acetyl- choline of adrenergic transmission in the rabbit ear...Bethesda, Maryland: American Physiological Society, 1979, p 581-620. 208. LEWIS, R.P. and J.V. WARREN . Beneficial effect of intravenous atropine in the...1928. 347. STORY, D.E, G.S. ALLEN, A.B. GLOVER, W. HOPE, M.W. McCULLOCH , M.J. RAND, and C. SARANTOS. Modulation of adrenergic transmission by

  9. The EU needs more anticipatory funding of health and environmental research

    DEFF Research Database (Denmark)

    Hansen, Steffen Foss; Gee, David

    2014-01-01

    In recent months, there have been several attacks on the Precautionary Principle and how the principle has been used in the EU. For example, the scientific advisor to the President of the European Commission, Ann Glover, has accused Commissioners of having “crazy ideas” about the safety of nanote......In recent months, there have been several attacks on the Precautionary Principle and how the principle has been used in the EU. For example, the scientific advisor to the President of the European Commission, Ann Glover, has accused Commissioners of having “crazy ideas” about the safety...

  10. Microsatellite DNA reveals population genetic differentiation among sprat (Sprattus sprattus) sampled throughout the Northeast Atlantic, including Norwegian fjords

    DEFF Research Database (Denmark)

    Glover, Kevin A.; Skaala, Øystein; Limborg, Morten

    2011-01-01

    Glover, K. A., Skaala, Ø., Limborg, M., Kvamme, C., and Torstensen, E. Microsatellite DNA reveals population genetic differentiation among sprat (Sprattus sprattus) sampled throughout the Northeast Atlantic, including Norwegian fjords. – ICES Journal of Marine Science, 68: 2145–2151. Sprat (Sprat...... display population genetic differentiation throughout the Northeast Atlantic, and there may be limited connectivity between Norwegian fjord and sea-going populations.......Glover, K. A., Skaala, Ø., Limborg, M., Kvamme, C., and Torstensen, E. Microsatellite DNA reveals population genetic differentiation among sprat (Sprattus sprattus) sampled throughout the Northeast Atlantic, including Norwegian fjords. – ICES Journal of Marine Science, 68: 2145–2151. Sprat...

  11. Stimulation des défenses naturelles par l’application d’un Lombricompost. Effet sur les paramètres populationnels d’Aphis fabae scop. (Homoptera: Aphididae et la qualité Phytochimique de la fève

    Directory of Open Access Journals (Sweden)

    Zahr-Eddine Djazouli

    2017-06-01

    Full Text Available Chaichi, W. Djazouli, Z. Djemai, I. Abdelkader, S. Ribera, I. and Nancé, J. 2017. Stimulation of natural defences by the application of lombricompost. Effect on the Aphis fabae scop. (Homoptéra: Aphididae population and phytochemical quality of faba bean. Lebanese Science Journal, 18(1: 81-97. The integrated production in durable agriculture aims to improve the efficiency of biological inputs through formulations extending the remanence in the field or the incorporation of synergistic products which, being themselves nontoxic at used quantities, increase the protective action of the viabe cultivations. The lombricultivation represents an appropriate technology to enhance the value of the farm residues and manage, on a long term basis, plant health. The study focused on the stimulation of natural defenses of bean through the use of a lombricompost dilutions produced in two different seasons. The effect of lombricompost has been evaluated based on the Aphis fabae population density in relation to the phytochemical quality of the nutritional support. Variations of biochemical molecule contents and major mineral elements during the leaf expanding phase have been noticed. These changes affect the biological performance as well as the density of A. fabae population. The results allowed detecting a positive effect of lombricompost on plant chemistry. On the other hand, enrichment in proteins and proline under the effect of strong dilution was noticed. Finally, results related to the repressive effect of the different forms of lombricompost showed a marked difference between treatments and the control, with a stronger effect on the winged forms. Results also indicated some variability of the Aphis Fabae populational structure in relation to the phytochemical enrichments established by the application of lombricompost.

  12. Nigerian Journal of Horticultural Science - Vol 13, No 1 (2008)

    African Journals Online (AJOL)

    Spread of the spiraling white fly Aleurodicus dispersus (Homoptera: Aleyrodidae) and its parasitoids Encarcia species (Hymenoptera: Aphelinidae) on horticultural plants in ... Nutrient release patterns of kola pod husk and pacesetter grade b fertilizer during incubation in the laboratory · EMAIL FULL TEXT EMAIL FULL TEXT

  13. Download this PDF file

    African Journals Online (AJOL)

    E-mail: egetudegaga@yahoo.corn. ABSTRACT: The woolly whitefly, Aleurothrixus floccosus (Maskell) (Homoptera: Aleyrodidae), is a new invasive alien insect pest of .... thuringiensis (Bt) is recommended. However, when the pest just invaded a new country like Ethiopia now classical biological control is the approach to.

  14. Author Details

    African Journals Online (AJOL)

    Wester2, D. Vol 17, No 1 (2010) - Articles Strip Cropping: A Potential IPM Tool for Reducing Whitefly, Bemisia tabaci Gennadius (Homoptera: Aleyrodidae) Infestations in Cassava Abstract PDF. ISSN: 0855-4307. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More ...

  15. Author Details

    African Journals Online (AJOL)

    Spread of the spiraling white fly Aleurodicus dispersus (Homoptera: Aleyrodidae) and its parasitoids Encarcia species (Hymenoptera: Aphelinidae) on horticultural plants in Northwest and Central Nigeria Abstract · Vol 13, No 1 (2008) - Articles A Survey of Rootstock Usage and their Influence on Major Insects and Diseases ...

  16. Seasonality and structure of the arthropod community in a forested ...

    African Journals Online (AJOL)

    Eight groups (Araneae, Hymenoptera, Heteroptera, Homoptera, Diptera, Coleoptera, Orthoptera and Lepidoptera) made up over 95 % of all the arthropod individuals caught. There were seasonal peaks in the abundances. The highest numbers of arthropods per sample were found during the late rainy season and early dry ...

  17. Fungal Endophytes of Wild Barley and their Effects on Diuraphis noxia Population Development

    Science.gov (United States)

    S.L. Clement; A. Dan Wilson; D.G. Lester; C.M. Davitt

    1997-01-01

    Laboratory experiments were conducted to compare the expression of Diuraphis noxia (Mordvilko) (Homoptera: Aphididae) resistance in four plant introduction (PI) lines of wild barley (Hordeum) infected with different species or strains of endophytic fungi (tribe Balansieae, family Clavicipitaceae, Neotyphodium gen. nov. [formerly...

  18. Author Details

    African Journals Online (AJOL)

    Agyei-Afriyie, F. Vol 31 (1991): Special Food and Agriculture Edition - Articles Relationship between permethrin susceptiblity and elevated esterase in clones of cotton aphid (Homoptera:Aphididae) Details. ISSN: 0855-1448. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors ...

  19. Author Details

    African Journals Online (AJOL)

    Adjei-Afriye, F. Vol 36, No 1 (1996): Volume 31-36; 1991-1996 - Articles Relationship between permethrin susceptibility and elevated esterase in clones of cotton aphid (Homoptera: Aphididae) Abstract. ISSN: 0855-1448. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors ...

  20. Author Details

    African Journals Online (AJOL)

    Relationship between permethrin susceptiblity and elevated esterase in clones of cotton aphid (Homoptera:Aphididae) Details · Vol 39 (1999) - Articles Studies on some esterases of Coccinella septempunctata Brukii (Coleoptera: Coccinellidae) with varying degrees of insecticide tolerance, and implications for integrated ...

  1. Author Details

    African Journals Online (AJOL)

    Lamo-Ayo, J. Vol 1, No 1 (1993) - Articles Aspects of the Biology of the Carrot Aphid Chomaphis (dysaphis) foeniculus Theobald (Homoptera: Aphididae) in Uganda Abstract PDF. ISSN: 2410-6909. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL ...

  2. Characterizing pathways of invasion using Sternorryhncha on imported plant material in cargo

    Science.gov (United States)

    Timothy T. Work

    2011-01-01

    Non-indigenous Homoptera, mainly scales, aphids, and mealy bugs, intercepted on plants destined for cultivation represent an elevated risk for the establishment of invasive insects in North America. These insects [grouped as the suborder Sternorrhyncha] are often parthenogenic and are imported on viable host plants.

  3. Short Communication: Occurrence of the pea aphid, Acyrthosiphon ...

    African Journals Online (AJOL)

    The occurrence of pea aphid, Acyrthosiphon pisum (Harris) (Homoptera: Aphididae), on wild annual and perennial leguminous plants was studied at two locations (Adet and Wondata) in West Gojam, Ethiopia in 1999/2000 seasons. Annual and perennial leguminous wild or volunteer plants encountered in the study areas ...

  4. Download this PDF file

    African Journals Online (AJOL)

    AISA

    Aphis craccivora Koch (Homoptera : Aphididae) is an economic pest of cowpea in eastern Uganda and in .... For instance, in USA, F. auriculariawas reported .... DATA ANALYSIS. The data were subjected to analysis of variance. (ANOVA) after checking the validity of assumptions underlying this analysis. Treatment.

  5. The potential of classical biological control against Leucaena Psyllid ...

    African Journals Online (AJOL)

    The Leucaena psyllid Heteropsylla cubana Crawford (Homoptera: Psyllidae) has caused damaging effects to Leucaena leucocephala (Lam.) de Wit in Tanzania since its outbreak in 1992. Cultural, genetic and chemical controls have been tried in some localised areas. In 1995, a hymenopterous parasitoids, Tamarixia ...

  6. Landscape context does not constrain biological control of Phenacoccus manihoti in intensified cassava systems of southern Vietnam

    Science.gov (United States)

    Following its continent-wide spread in Africa during the 1970s and early 1980s, the cassava mealybug, Phenacoccus manihoti (Homoptera: Pseudococcidae) was inadvertently introduced to Southeast (SE) Asia in late 2008. In both regions P. manihoti can inflict severe damage on cassava, impact food secur...

  7. screening of new isolates of bt and cloning of their dna amplicons

    African Journals Online (AJOL)

    NEMAPPA

    2012-09-18

    Sep 18, 2012 ... and biopesticides [Bacillus thuringiensis (Bt)] have proved beneficial over conventional chemical pesticides in controlling them. The cry toxins constitute a family of related proteins that can kill insects belonging to the. Lepidoptera, Coleoptera, Diptera, Hymenoptera, Homoptera, and Mallophaga, as well as ...

  8. Author Details

    African Journals Online (AJOL)

    Influence Of Phytolyma lata (Homoptera: Psyllidae) On Seedling Growth Of Milicia excelsa. Abstract · Vol 26 (2010) - Articles A comparison of tree seedling growth in artificial gaps of different sizes in two contrasting forest types. Abstract · Vol 26 (2010) - Articles Wildfire incidence and management in the forest transition zone ...

  9. Resistance to lettuce aphid (Nasonovia ribisnigri) biotype 0 in wild lettuce accessions PI 491093 and PI 274378

    Science.gov (United States)

    Lettuce aphid, Nasonovia ribisnigri Mosley (Homoptera : Aphididae), is a major insect pest of lettuce, Lactuca sativa L, in many commercial lettuce productions areas around the world. Resistance to lettuce aphid was first reported in Lactuca virosa L. accession IVT 280 and characterized as complete,...

  10. Download this PDF file

    African Journals Online (AJOL)

    AJL

    Use of Beauveria bassiana (Bals) to control the immature stages of the whitefly, Trialeurodes vaporariorum. (Westwood) (Homoptera: Aleyrodidae) in the greenhouse. Arab. J. Plant Prot. 2:83-86. Van leeuwen T, Nauen R, Witters J, Duso C, Tirry L (2010).The control of eriophyoid mites: state of the art and future challenges.

  11. Polynomial Approximation Algorithms for the TSP and the QAP with a Factorial Domination Number

    DEFF Research Database (Denmark)

    Gutin, Gregory; Yeo, Anders

    2002-01-01

    Glover and Punnen (J. Oper. Res. Soc. 48 (1997) 502) asked whether there exists a polynomial time algorithm that always produces a tour which is not worse than at least n!/p(n) tours for some polynomial p(n) for every TSP instance on n cities. They conjectured that, unless P = NP, the answer to t...

  12. Modeling and Control for Microgrids

    Science.gov (United States)

    Steenis, Joel

    Traditional approaches to modeling microgrids include the behavior of each inverter operating in a particular network configuration and at a particular operating point. Such models quickly become computationally intensive for large systems. Similarly, traditional approaches to control do not use advanced methodologies and suffer from poor performance and limited operating range. In this document a linear model is derived for an inverter connected to the Thevenin equivalent of a microgrid. This model is then compared to a nonlinear simulation model and analyzed using the open and closed loop systems in both the time and frequency domains. The modeling error is quantified with emphasis on its use for controller design purposes. Control design examples are given using a Glover McFarlane controller, gain scheduled Glover McFarlane controller, and bumpless transfer controller which are compared to the standard droop control approach. These examples serve as a guide to illustrate the use of multi-variable modeling techniques in the context of robust controller design and show that gain scheduled MIMO control techniques can extend the operating range of a microgrid. A hardware implementation is used to compare constant gain droop controllers with Glover McFarlane controllers and shows a clear advantage of the Glover McFarlane approach.

  13. Black Women's Faculty Voices in New Mexico: Invisible Assets Silent No More

    Science.gov (United States)

    Woodley, Xeturah Monique

    2014-01-01

    There continues to exist a lack of Black women faculty at institutions of higher education (Moses, 1989; Collins, 1991; Gregory, 2001). Although we can see an increase in the number of research projects focused on Black women faculty there still remains a significant gap in the research (Glover, 2006; Foster-Williamson, 2002; Thomas &…

  14. A review and critical analysis of how cognitive neuroscientific investigations using dance can contribute to sport psychology

    NARCIS (Netherlands)

    Cross, E.S.; Acquah, D.; Ramsey, R.

    2014-01-01

    Whether watching Michael Jackson moonwalk or Savion Glover tap dance, it is striking how skilfully some people can move their bodies. The emerging field of cognitive neuroscience has produced important advances in understanding the control and perception of complex action. Here we outline the merits

  15. Children's Use of Allocentric Cues in Visually- and Memory-Guided Reach Space

    Science.gov (United States)

    Cordova, Alberto; Gabbard, Carl

    2012-01-01

    Theory suggests that the vision-for-perception and vision-for-action processing streams operate under very different temporal constraints (Glover, 2004; Goodale, Jackobson, & Keillor, 1994; Graham, Bradshaw, & Davis, 1998; Hu, Eagleson, & Goodale, 1999). With the present study, children and young adults were asked to estimate how far a cued target…

  16. a method for grouping sweet corn genotypes

    Indian Academy of Sciences (India)

    ity improvement and plant nutrition. I. Genetic mutations affect- ing carbohydrate properties of the maize endosperm. Qual. Plant. Mat. Veget. 13, 86–97. Holder D. G., Glover D. V. and Shannon J. C 1974 Interaction of shrunken-2 with five other carbohydrate genes in Zea mays L. endosperm. Crop Sci. 14, 643–646. Hossain ...

  17. Browse Title Index

    African Journals Online (AJOL)

    Items 351 - 400 of 488 ... Vol 8, No 2 (2011), Pneumatic reduction of intussusception in children at Korle Bu Teaching Hospital: An initial experience, Abstract. Y Boateng Mensah, H Glover-Addy, V Etwire, MB Twum, S Asiamah, W Appeadu-Mensah, AAJ Hesse. Vol 3, No 1 (2006), Post Polio Paralysis: A Clarion Call For ...

  18. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 309 ... Issue, Title. Vol 19, No 1 (2011), Calibration and Performance Testing of Sodium Iodide, NaI (Tl), Detector at the Food and Environmental Laboratory of the Radiation Protection Institute of the Ghana Atomic Energy Commission, Abstract PDF. A Faanu, G Emi-Reynolds, EO Darko, R Awudu, ET Glover, ...

  19. Molecular genetic analysis of consanguineous families with primary ...

    Indian Academy of Sciences (India)

    MUZAMMIL AHMAD KHAN

    that reduction in brain size is due to misorientation of mitotic spindle fibres, which also affects the ratio of symmetric to asymmetric cell divisions and thus, decrease the number of neuronal cells (do Carmo Avides and Glover 1999). Keywords. primary microcephaly; Pakistani families; exome sequencing; ASPM gene; ...

  20. Water Quality Criteria for 2,4-Dinitrotoluene and 2,6-Dinitrotoluene

    Science.gov (United States)

    1987-08-01

    Bestimmung der biolgischen Schadwir-kung wassergefahrdender Stoffe gegen Protozoen . Z. Wasser Abwasser .- Forsch. 11(6):210-214. Bringmann, G. and R. Kuhn...bakterienfressende sowie saprozoische protozoen . Gas- Wasserfach: Wasser/Abwasser 122(7):308-313. Burlinson, N.E. and D.J. Glover. 1977a. Photochemistry of

  1. 78 FR 46796 - Federal Acquisition Regulation; Federal Acquisition Circular 2005-69; Small Entity Compliance Guide

    Science.gov (United States)

    2013-08-01

    ... and III of the Iran Threat Reduction and Syria Human Rights Act of 2012. This final rule will not have... 2012-009 Glover. Performance. IV Repeal of Sunset for 2013-011 Jackson. Certain Protests of Task or... impose any additional requirements on small business. ] Item IV--Repeal of Sunset for Certain Protests of...

  2. African Journal of Library, Archives and Information Science - Vol 25 ...

    African Journals Online (AJOL)

    A Comparison of Cataloguing and Classification Education (CCE) in Library and Information Science in South Africa, Brazil and the USA (SOBUSA): An Overview. Dennis N. Ocholla, Lyudmila Ocholla, Hope A. Olson, Jeannette R. Glover, José Augusto Guimarães ...

  3. Indonesia's Fires and Haze : The Cost of Catastrophe (mise à jour ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Indonesia's Fires and Haze : The Cost of Catastrophe (mise à jour en 2006). Couverture du livre Indonesia's Fires and Haze : The Cost of Catastrophe (mise à jour. Directeur(s):. David Glover et Timothy Jessup. Maison(s) d'édition: ISEAS, CRDI. 1 janvier 1999. ISBN : 9812300066. 160 pages. e-ISBN : 1552503321.

  4. Cloning and expression analysis of a new anther-specific gene ...

    Indian Academy of Sciences (India)

    separation of the sporogenous cells, microspore mitosis, pollen differentiation and others (Glover et al. 1988). Anther and pollen formation, and development are a critical period in the plant life cycle, which involves the precise expression of coordinated genes and a wide variety of gene interactions (Goldberg et al. 1993).

  5. Complementary Health Approaches for Smoking Cessation: What the Science Says

    Science.gov (United States)

    ... Tang R, Posner MI. Brief meditation training induces smoking reduction. Proc Natl Acad Sci USA. 2013;110(34):13971-13975. Walker N, Howe C, Glover M, et al. Cytisine versus nicotine for smoking cessation. N Engl J Med. 2014;371(25): ...

  6. Perspectives on Liberal Education: Pioneers and Pallbearers.

    Science.gov (United States)

    Watson, JoAnna M., Ed.; Stevens, Rex P., Ed.

    Nine essays on education in the humanities and the debate surrounding liberal education are presented by the faculty of Mercer University. "Liberal Education and the Christian Intellectual Tradition," by Willis B. Glover, addresses the root question of what liberal education means. In "Science as a Liberal Arts Discipline," Dan R. Quisenberry…

  7. 78 FR 43205 - Federal Acquisition Regulation; Submission for OMB Review; Bankruptcy (FAR Subpart 42.9; 52.242-13)

    Science.gov (United States)

    2013-07-19

    ... Regulation; Submission for OMB Review; Bankruptcy (FAR Subpart 42.9; 52.242-13) AGENCY: Department of Defense... approved information collection requirement concerning Bankruptcy. A notice was published in the Federal...-0108, Bankruptcy, in all correspondence. FOR FURTHER INFORMATION CONTACT: Curtis E. Glover, Sr...

  8. Aphid resistance in florist's chrysanthemum (Chrysanthemum ...

    African Journals Online (AJOL)

    ... SAE is readily toxic when ingested by the pea aphid, Acyrthosiphon pisum, and the cotton aphid, Aphis gossypii. We transformed chrysanthemum genotype 1581 by Agrobacterium tumefaciens-mediated transformation with the SAE gene under the control of the chrysanthemum RbcS promoter to induce aphid resistance.

  9. Flavour Compounds in Fungi

    DEFF Research Database (Denmark)

    Ravasio, Davide Antonio

    are encoded by the ARO gene family which represents a widely conserved set of genes in the Saccharomyces clade. Comparative genomic analysis revealed conservation of these genes also in the riboflavin over producer Ashbya gossypii, a closely related species belonging to the Eremothecium clade. ARO80...

  10. Original Research Original Research

    African Journals Online (AJOL)

    User

    2013-06-16

    Jun 16, 2013 ... in watermelon cultivation (Burubai and Eribo, 2. It is observed that cow urine has inhibitory against several plant ... compared with the nectar. 004; Gururaja et al., 2011). lications in agriculture. It has ..... against melon aphids (Aphis gossypii) & pickleworms. (Diaphania hyalinata) in watermelon cultivation.

  11. field evaluation of non-synthetic insecticides for the management of ...

    African Journals Online (AJOL)

    Preferred Customer

    of the variegated grasshopper, Zonocerus variegatus. (L.), caused extensive defoliation to okra plants. Effect of actellic, Bt and neem seed extract on insect population. Actellic, neem extract and Bt caused a significant. (P<0.05) reduction in the population of P. uniformis,. A. gossypii, E. similis, S. doragata, P. litura and S.

  12. Shrub-inhabiting insects of the 200 Area Plateau, southcentral Washington.

    Energy Technology Data Exchange (ETDEWEB)

    Rogers, L.E.

    1979-10-01

    This study characterizes the insects (including spiders) associated with major shrubs of the 200 Area Plateau on the Hanford Site in southcentral Washington. Big sagebrush (Artemisia tridentata), rabbitbrush (Chrysothamnus sp.) and hopsage (Grayia spinosa) were the three shrubs included in the study. Hemiptera (true bugs) and homoptera (bugs) were the two groups most abundant on sagebrush. Homoptera and Araneida (spiders) were the common inhabitants of rabbitbrush, and Orthoptera (grasshoppers), Coleoptera (beetles), and Araneida the taxa most frequently collected from hopsage. A discussion of the effects of insects on western native shrubs is included. None of the insect populations appeared to threaten the stability of shrub stands, which is important because of the erodability of 200 Area soils.

  13. Simulate rain about action insecticide flonicamid in the control of the cotton aphid=Chuva simulada sobre ação inseticida flonicamid no controle do pulgão-do-algodoeiro.

    Directory of Open Access Journals (Sweden)

    Paulo Eduardo Degrande

    2011-10-01

    Full Text Available The cotton production system in Brazil concentrates on the area of the cerrado, characterized by frequent rains that interfere in the effectiveness of the necessary sprays during its cycle. The objective of the work was to evaluate simulate rain of 15 mm in 4 hours after spraying in the control of Aphis gossypii with insecticide flonicamid. Plants of Gossypium hirsutum were cultivated in pots containing soil as substrate in greenhouse conditions. The pots were arranged in randomized complete design with seven treatments and five replicates, consisting of: test without insecticide spraying, without insecticide spraying with rain, flonicamid spraying with simulate rain of 15 mm after 30 minutes, 1, 2 and 4 hours after spraying. Equivalent insecticide was sprayed 75 g of flonicamid by hectare. The efficiency evaluation was accomplished through the individuals of A. gossypii count which started from an artificial infestation 6 days before the application of the treatments. The results were: a 15-mm precipitation during the first four hours after flonicamid spraying interfered negatively in the control of A. gossypii.O cultivo do algodoeiro no Brasil concentra-se na Região do Cerrado, caracterizada por chuvas freqüentes que interferem na eficácia das pulverizações necessárias durante seu ciclo. O objetivo do trabalho foi avaliar chuva simulada de 15 mm nas 4h iniciais após pulverização no controle de A. gossypii com inseticida flonicamid. Plantas de Gossypium hirsutum foram cultivadas em vasos contendo solo como substrato em condições de casa-de-vegetação. Cada parcela foi constituída de um vaso com duas plantas. Utilizou-se delineamento experimental inteiramente casualizado com sete tratamentos e cinco repetições, consistindo de: testemunha sem pulverização de inseticida, testemunha sem pulverização de inseticida com presença de chuva e pulverização de flonicamid com chuva simulada de 15 mm aos 30 min., 1, 2 e 4h após aplica

  14. Influence de la succession des générations de cicadulina mbila ...

    African Journals Online (AJOL)

    L\\'étude de l\\'influence de la succession de quatre générations d\\'une population de Cicadulina mbila Naude (Homoptera: Cicadellidae) sur la transmission du Maize Streak Virus (MSV) réalise au Burkina Faso a montre qu\\'au cours des générations successives, l\\'insecte vecteur voit son efficacité de transmission du virus ...

  15. Annual predictions of the peak numbers of Sitobion avenae infesting winter wheat

    Czech Academy of Sciences Publication Activity Database

    Honěk, A.; Martinková, Z.; Dixon, Anthony F. G.; Saska, P.

    2017-01-01

    Roč. 141, č. 5 (2017), s. 352-362 ISSN 0931-2048 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0073 Institutional support: RVO:86652079 Keywords : metopolophium-dirhodum wlk * cereal aphid populations * rhopalosiphum-padi l * english grain aphid * field populations * growth-stages * fixed levels * yield loss * homoptera * dynamics * abundance * ears * growth * leaves * maximum * population Subject RIV: EH - Ecology, Behaviour OBOR OECD: Biodiversity conservation Impact factor: 1.641, year: 2016

  16. Genetic Structure of the Aphid, Chaetosiphon fragaefolii, and Its Role as a Vector of the Strawberry yellow edge virus to a Native Strawberry, Fragaria chiloensis in Chile

    OpenAIRE

    Lavandero, Blas; Rojas, Pamela; Ramirez, Claudio C.; Salazar, Marcela; Caligari, Peter D.S.

    2012-01-01

    The monoecious anholocyclical aphid, Chaetosiphon fragaefolii (Cockerell) (Homoptera: Aphididae), was collected on a native strawberry, Fragaria chiloensis (L.) Duchesne (Rosales: Rosaceae) from different sites in Chile. The presence of this aphid was recorded during two consecutive years. F. chiloensis plants were collected from seven natural and cultivated growing areas in central and southern Chile. Aphids were genotyped by cross-species amplification of four microsatellite loci from other...

  17. Capability of Forficula auricularia linnaeus (Dermaptera ...

    African Journals Online (AJOL)

    Les pucerons, Aphis craccivora Koch (Homoptera : Aphididae) compte parmi les ravageurs d\\'importance économique du niébé à l\\'Est de l\\'Uganda et à l\\'Est de la République Démocratique du Congo. Le perce-oreille commun, Forficula auricularia (Dermaptera : Forficulidae) est un prédateur fréquemment rencontré dans ...

  18. A Molecular Phylogeny of Hemiptera Inferred from Mitochondrial Genome Sequences

    Science.gov (United States)

    Song, Nan; Liang, Ai-Ping; Bu, Cui-Ping

    2012-01-01

    Classically, Hemiptera is comprised of two suborders: Homoptera and Heteroptera. Homoptera includes Cicadomorpha, Fulgoromorpha and Sternorrhyncha. However, according to previous molecular phylogenetic studies based on 18S rDNA, Fulgoromorpha has a closer relationship to Heteroptera than to other hemipterans, leaving Homoptera as paraphyletic. Therefore, the position of Fulgoromorpha is important for studying phylogenetic structure of Hemiptera. We inferred the evolutionary affiliations of twenty-five superfamilies of Hemiptera using mitochondrial protein-coding genes and rRNAs. We sequenced three mitogenomes, from Pyrops candelaria, Lycorma delicatula and Ricania marginalis, representing two additional families in Fulgoromorpha. Pyrops and Lycorma are representatives of an additional major family Fulgoridae in Fulgoromorpha, whereas Ricania is a second representative of the highly derived clade Ricaniidae. The organization and size of these mitogenomes are similar to those of the sequenced fulgoroid species. Our consensus phylogeny of Hemiptera largely supported the relationships (((Fulgoromorpha,Sternorrhyncha),Cicadomorpha),Heteroptera), and thus supported the classic phylogeny of Hemiptera. Selection of optimal evolutionary models (exclusion and inclusion of two rRNA genes or of third codon positions of protein-coding genes) demonstrated that rapidly evolving and saturated sites should be removed from the analyses. PMID:23144967

  19. Link Between Deployment Factors and Parenting Stress in Navy Families

    Science.gov (United States)

    2016-04-11

    spiritual experiences and psychological well -being among US adults. Social Indicators Research, 88(2), 247-271. doi:10.1007/s11205- 007-9187-2...Psychiatric Services, 62(1), 28-34. Hamlin-Glover, D. L. (2009). Spirituality , religion , and resilience among military families (Doctoral...study was two-fold: 1) to look at parenting stress in Navy active duty fathers; and 2) to evaluate spirituality and social support in both civilian

  20. Photochemical Transformation of Munitions Constituents in Marine Waters

    Science.gov (United States)

    2012-05-01

    solutions or natural marine systems. Nitroaromatic compounds (TNT, DNT) absorb electromagnetic radiation in the ultraviolet (UV) range of 200...under the 395 nm filter as shown in Figure 5 for 2,4-DNT and 2,6-DNT. This shows that the effective wavelengths for photolysis are in the ultraviolet ...Environ. Sci. Technol. 32: 3004-3010. Burlinson, N. E., Sitzmann, M. E., Glover, D. J., Kaplan, L. A. 1979. Photochemistry of TNT and related

  1. Management of ports and maritime trade of Orissa and Andhra Pradesh during the historical period

    Digital Repository Service at National Institute of Oceanography (India)

    Tripati, S.

    Bengal as well as Assam. Similarly, Rouletted ware and Knobbed ware have been reported from Bali, Bangladesh, Java, Malaysia, Sri Lanka, Thailand and Vietnam (Schenk 2006 and Glover 1996). The occurrence of Northern Black Polished ware and silver punch... marked coins along the port and coastal sites of the east coast of India indicate the existence of coastal trade (Sila Tripati 2002). Semi- precious stone beads have even been reported from Thailand, Indonesia, Burma, Malaysia and Philippines...

  2. Filamentous Growth in Eremothecium Fungi

    DEFF Research Database (Denmark)

    Oskarsson, Therese

    The fungal kingdom encompasses a diverse group of organisms some of which have a great impact on human lives, either as domesticated benefactors or as human and crop pathogens. Using the filamentous fungus Ashbya gossypii and its close relative Eremothecium cymbalariae as model organisms, this th...... of molecular tools for E. cymbalariae to enable a faster and more efficient approach for genetic comparisons between Eremothecium genus fungi.......-regulatory activity of AgGts1, the protein could have additional actin organizing properties. In the second and third part, this thesis addresses the use of A. gossypii and its relative E. cymbalariae as model organisms for filamentous growth. A series of assays analyzed the capability of Eremothecium genus fungi...

  3. Allelopathic potential and chemical constituents of volatiles from Ageratum conyzoides under stress.

    Science.gov (United States)

    Kong, Chuihua; Hu, Fei; Xu, Xiaohua

    2002-06-01

    The allelopathic potential of Ageratum conyzoides was investigated under different environmental stress conditions, including nutrient deficiency. physical damage, 2.4-D treatment, competition with Bidens pilosa, infection with Erysiphe cichoracearum, and feeding by Aphiids gossypii. The inhibitory effects of A. conyzoides volatiles on peanut (Arachis hypogaea), redroot amaranth (Amaranthus retroflexus), cucumber (Cucumis sativus), and ryegrass (Lolium multiforum) increased when plants were grown under nutrient-deficient conditions or in competition with B. pilosa; however, there was no difference with physical damage or 2.4-D treatment. Phytoinhibitory effects decreased under fungal infection and aphid feeding. Volatiles from A. conyzoides plants infected with E. cichoracearum or exposed to A. gossypii feeding inhibited or killed fungi and insects. Precocenes and their derivatives, monoterpenes, and sesquiterpenes were the major volatile components of A. conyzoides.

  4. Infeksi Cucumber mosaic virus dan Chilli veinal mottle virus pada Cabai di Kabupaten Rejang Lebong, Bengkulu

    Directory of Open Access Journals (Sweden)

    Mimi Sutrawati

    2013-04-01

    Full Text Available Mosaic disease caused by Cucumber mosaic virus (CMV and Chilli veinal mottle Virus (ChiVMV has been distributed widely in chilli in Indonesia and considered as important disease. A research was conducted to investigate the spread and incidence of CMV and ChiVMV in Rejang Lebong, Bengkulu and to identify its insect vector. Symptomatic and asymptomatic leaf samples were collected systematically from several chillipepper fields for further detection by DAS-ELISA (Double antibody sandwich-enzyme linked immunosorbant assay using specific antibody for CMV and ChiVMV. The result showed that infection of both CMV and ChiVMV was found with disease incidence reached 20-50%, whereas infection only by ChiVMV or CMV were 50-80% and 20-50%, respectively. One species of aphid, i.e. Aphis gossypii was found from the fields.Key words: Aphis gossypii, CMV, ChiVMV, disease incidence

  5. Bacterial Communities of Two Parthenogenetic Aphid Species Cocolonizing Two Host Plants across the Hawaiian Islands ▿

    Science.gov (United States)

    Jones, Ryan T.; Bressan, Alberto; Greenwell, April M.; Fierer, Noah

    2011-01-01

    Aphids (Hemiptera: Aphididae) have been the focus of several studies with respect to their interactions with inherited symbionts, but bacterial communities of most aphid species are still poorly characterized. In this research, we used bar-coded pyrosequencing to characterize bacterial communities in aphids. Specifically, we examined the diversity of bacteria in two obligately parthenogenetic aphid species (the melon aphid, Aphis gossypii, and the cardamom aphid, Pentalonia caladii) cocolonizing two plant species (taro, Colocasia esculenta, and ginger, Alpinia purpurata) across four Hawaiian Islands (Hawaii, Kauai, Maui, and Oahu). Results from this study revealed that heritable symbionts dominated the bacterial communities for both aphid species. The bacterial communities differed significantly between the two species, and A. gossypii harbored a more diverse bacterial community than P. caladii. The bacterial communities also differed across aphid populations sampled from the different islands; however, communities did not differ between aphids collected from the two host plants. PMID:21965398

  6. Bacterial communities of two parthenogenetic aphid species cocolonizing two host plants across the Hawaiian Islands.

    Science.gov (United States)

    Jones, Ryan T; Bressan, Alberto; Greenwell, April M; Fierer, Noah

    2011-12-01

    Aphids (Hemiptera: Aphididae) have been the focus of several studies with respect to their interactions with inherited symbionts, but bacterial communities of most aphid species are still poorly characterized. In this research, we used bar-coded pyrosequencing to characterize bacterial communities in aphids. Specifically, we examined the diversity of bacteria in two obligately parthenogenetic aphid species (the melon aphid, Aphis gossypii, and the cardamom aphid, Pentalonia caladii) cocolonizing two plant species (taro, Colocasia esculenta, and ginger, Alpinia purpurata) across four Hawaiian Islands (Hawaii, Kauai, Maui, and Oahu). Results from this study revealed that heritable symbionts dominated the bacterial communities for both aphid species. The bacterial communities differed significantly between the two species, and A. gossypii harbored a more diverse bacterial community than P. caladii. The bacterial communities also differed across aphid populations sampled from the different islands; however, communities did not differ between aphids collected from the two host plants.

  7. Filamentous Growth in Eremothecium Fungi

    DEFF Research Database (Denmark)

    Oskarsson, Therese

    , this thesis deals with some of the aspects of hyphal growth, which is an important virulence factor for pathogenic fungi infecting both humans and plants. Hyphal establishment through continuous polar growth is a complex process, requiring the careful coordination of a large subset of proteins involved...... in polarity establishment and maintenance, cytoskeleton dynamics and intracellular transport. The first part of this thesis addresses the A. gossypii Arf3 small GTPase and its GEF- and GAP regulators; Yel1 and Gts1, which has been implicated in polar growth in a wide range of organisms. We could demonstrate......-regulatory activity of AgGts1, the protein could have additional actin organizing properties. In the second and third part, this thesis addresses the use of A. gossypii and its relative E. cymbalariae as model organisms for filamentous growth. A series of assays analyzed the capability of Eremothecium genus fungi...

  8. Nuclear anarchy: asynchronous mitosis in multinucleated fungal hyphae.

    Science.gov (United States)

    Gladfelter, Amy S

    2006-12-01

    Multinucleated cells are found in diverse contexts and include filamentous fungi, developing insect embryos, skeletal muscle and metastasizing tumor cells. Some multinucleated cells such as those in muscles arise from cell fusion events, but many are formed through specialized cell cycles in which nuclear and cell division are uncoupled. Recent work in the fungus Ashbya gossypii illustrates how unique spatial and temporal regulation of conserved cell cycle regulators directs mitosis in multinucleated cells.

  9. Introduced sap-feeding insect pests of crop plants in the Maltese Islands

    OpenAIRE

    Mifsud, David; Watson, Gillian W.

    1999-01-01

    Sap-feeding insects within Hemiptera and Thysanoptera are some of the most important crop pests world-wide. Apart from the loss of yield they cause by sap depletion, saliva toxicity and soiling of the leaves, some species transmit serious plant virus diseases. Important sap-feeding species that have been introduced to the Maltese Islands include the whitefly Bemisia tabaci; the scale insects Pseudo coccus !ongispinus, Planococcus citri and lcerya purchasi; the aphids Aphis gossypii, Aphis spi...

  10. Carboxylesterase-mediated insecticide resistance: Quantitative increase induces broader metabolic resistance than qualitative change.

    Science.gov (United States)

    Cui, Feng; Li, Mei-Xia; Chang, Hai-Jing; Mao, Yun; Zhang, Han-Ying; Lu, Li-Xia; Yan, Shuai-Guo; Lang, Ming-Lin; Liu, Li; Qiao, Chuan-Ling

    2015-06-01

    Carboxylesterases are mainly involved in the mediation of metabolic resistance of many insects to organophosphate (OP) insecticides. Carboxylesterases underwent two divergent evolutionary events: (1) quantitative mechanism characterized by the overproduction of carboxylesterase protein; and (2) qualitative mechanism caused by changes in enzymatic properties because of mutation from glycine/alanine to aspartate at the 151 site (G/A151D) or from tryptophan to leucine at the 271 site (W271L), following the numbering of Drosophila melanogaster AChE. Qualitative mechanism has been observed in few species. However, whether this carboxylesterase mutation mechanism is prevalent in insects remains unclear. In this study, wild-type, G/A151D and W271L mutant carboxylesterases from Culex pipiens and Aphis gossypii were subjected to germline transformation and then transferred to D. melanogaster. These germlines were ubiquitously expressed as induced by tub-Gal4. In carboxylesterase activity assay, the introduced mutant carboxylesterase did not enhance the overall carboxylesterase activity of flies. This result indicated that G/A151D or W271L mutation disrupted the original activities of the enzyme. Less than 1.5-fold OP resistance was only observed in flies expressing A. gossypii mutant carboxylesterases compared with those expressing A. gossypii wild-type carboxylesterase. However, transgenic flies universally showed low resistance to OP insecticides compared with non-transgenic flies. The flies expressing A. gossypii W271L mutant esterase exhibited 1.5-fold resistance to deltamethrin, a pyrethroid insecticide compared with non-transgenic flies. The present transgenic Drosophila system potentially showed that a quantitative increase in carboxylesterases induced broader resistance of insects to insecticides than a qualitative change. Copyright © 2014 Elsevier Inc. All rights reserved.

  11. Resource Provisioning as a Habitat Manipulation Tactic to Enhance the Aphid Parasitoid, Aphidius colemani Viereck (Hymenoptera: Braconidae: Aphidiinae), and the Plant-Mediated Effects of a Systemic Insecticide, Imidacloprid

    OpenAIRE

    Charles-Tollerup, Jennifer Jean

    2012-01-01

    Resource provisioning as a habitat manipulation tactic to control the melon aphid, Aphis gossypii, by the polyphagous aphid parasitoid, Aphidius colemani, was investigated in the ornamental, potted-plant nursery using the shrub Photinia x fraseri as a plant host. Floral food resources from an invasive, Conium maculatum, an ornamental, P. x fraseri, and a native, Salvia apiana considerably improved the longevity and fecundity of A. colemani in laboratory experiments. Additionally, floral nec...

  12. Impact of Vat resistance in melon on viral epidemics and genetic structure of virus populations.

    Science.gov (United States)

    Schoeny, Alexandra; Desbiez, Cécile; Millot, Pauline; Wipf-Scheibel, Catherine; Nozeran, Karine; Gognalons, Patrick; Lecoq, Hervé; Boissot, Nathalie

    2017-09-15

    Cultivar choice is at the heart of cropping systems and resistant cultivars should be at the heart of disease management strategies whenever available. They are the easiest, most efficient and environmentally friendly way of combating viral diseases at the farm level. Among the melon genetic resources, Vat is a unique gene conferring resistance to both the melon aphid Aphis gossypii and the viruses it carries. The 'virus side' of this pleiotropic phenotype is seldom regarded as an asset for virus control. Indeed, the effect of Vat on virus epidemics in the field is expected to vary according to the composition of aphid populations in the environment and long-term studies are needed to draw a correct trend. Therefore, the first objective of the study was to re-evaluate the potential of Vat to reduce viral diseases in melon crops. The second objective was to investigate the potential of Vat to exert a selection pressure on virus populations. We monitored the epidemics of Cucurbit aphid-borne yellows virus (CABYV), Cucumber mosaic virus (CMV), Watermelon mosaic virus (WMV) and Zucchini yellow mosaic virus (ZYMV) in two melon lines having a common genetic background, a resistant line (R) and a susceptible line (S), in eight field trials conducted in southeastern France between 2011 and 2015. Vat had limited impact if any on WMV epidemics probably because A. gossypii is not the main vector of WMV in the field, but a favorable impact on CMV, yet of variable intensity probably related to the importance of A. gossypii in the total aphid population. Vat had a significant impact on CABYV epidemics with mean incidence reduction exceeding 50% in some trials. There was no effect of Vat on the structure of virus populations, both for the non-persistent WMV transmitted by numerous aphid species and for the persistent CABYV transmitted predominantly by A. gossypii. Copyright © 2017 Elsevier B.V. All rights reserved.

  13. Aphid honeydew quality as a food source for parasitoids is maintained in Bt cotton.

    Science.gov (United States)

    Hagenbucher, Steffen; Wäckers, Felix L; Romeis, Jörg

    2014-01-01

    Bt-transgenic cotton has proven to be highly efficient in controlling key lepidopteran pests. One concern with the deployment of Bt cotton varieties is the potential proliferation of non-target pests. We previously showed that Bt cotton contained lower concentrations of insecticidal terpenoids as a result of reduced caterpillar damage, which benefited the aphid Aphis gossypii. It is thus important that non-target herbivores are under biological control in Bt cotton fields. The induction or lack of induction of terpenoids could also influence the quality of aphid honeydew, an important food source for beneficial insects. We therefore screened A. gossypii honeydew for cotton terpenoids, that are induced by caterpillars but not the aphids. We then tested the influence of induced insect-resistance of cotton on honeydew nutritional quality for the aphid parasitoid Lysiphlebus testaceipes and the whitefly parasitoid Eretmocerus eremicus. We detected the cotton terpenoids gossypol and hemigossypolone in A. gossypii honeydew. Although a feeding assay demonstrated that gossypol reduced the longevity of both parasitoid species in a non-linear, dose-dependent manner, the honeydew was capable of sustaining parasitoid longevity and reproduction. The level of caterpillar damage to Bt and non-Bt cotton had no impact on the quality of honeydew for the parasitoids.These results indicate that the nutritional quality of honeydew is maintained in Bt cotton and is not influenced by induced insect resistance.

  14. Aphid honeydew quality as a food source for parasitoids is maintained in Bt cotton.

    Directory of Open Access Journals (Sweden)

    Steffen Hagenbucher

    Full Text Available Bt-transgenic cotton has proven to be highly efficient in controlling key lepidopteran pests. One concern with the deployment of Bt cotton varieties is the potential proliferation of non-target pests. We previously showed that Bt cotton contained lower concentrations of insecticidal terpenoids as a result of reduced caterpillar damage, which benefited the aphid Aphis gossypii. It is thus important that non-target herbivores are under biological control in Bt cotton fields. The induction or lack of induction of terpenoids could also influence the quality of aphid honeydew, an important food source for beneficial insects. We therefore screened A. gossypii honeydew for cotton terpenoids, that are induced by caterpillars but not the aphids. We then tested the influence of induced insect-resistance of cotton on honeydew nutritional quality for the aphid parasitoid Lysiphlebus testaceipes and the whitefly parasitoid Eretmocerus eremicus. We detected the cotton terpenoids gossypol and hemigossypolone in A. gossypii honeydew. Although a feeding assay demonstrated that gossypol reduced the longevity of both parasitoid species in a non-linear, dose-dependent manner, the honeydew was capable of sustaining parasitoid longevity and reproduction. The level of caterpillar damage to Bt and non-Bt cotton had no impact on the quality of honeydew for the parasitoids.These results indicate that the nutritional quality of honeydew is maintained in Bt cotton and is not influenced by induced insect resistance.

  15. Vat

    Science.gov (United States)

    Boissot, Nathalie; Schoeny, Alexandra; Vanlerberghe-Masutti, Flavie

    2016-01-01

    We review half a century of research on Cucumis melo resistance to Aphis gossypii from molecular to field levels. The Vat gene is unique in conferring resistance to both A. gossypii and the viruses it transmits. This double phenotype is aphid clone-dependent and has been observed in 25 melon accessions, mostly from Asia. It is controlled by a cluster of genes including CC-NLR, which has been characterized in detail. Copy-number polymorphisms (for the whole gene and for a domain that stands out in the LLR region) and single-nucleotide polymorphisms have been identified in the Vat cluster. The role of these polymorphisms in plant/aphid interactions remains unclear. The Vat gene structure suggests a functioning with separate recognition and response phases. During the recognition phase, the VAT protein is thought to interact (likely indirectly) with an aphid effector introduced during cell puncture by the aphid. A few hours later, several miRNAs are upregulated in Vat plants. Peroxidase activity increases, and callose and lignin are deposited in the walls of the cells adjacent to the stylet path, disturbing aphid behavior. In aphids feeding on Vat plants, Piwi-interacting RNA-like sequences are abundant and the levels of other miRNAs are modified. At the plant level, resistance to aphids is quantitative (aphids escape the plant and display low rates of reproduction). Resistance to viruses is qualitative and local. Durability of NLR genes is highly variable. A. gossypii clones are adapted to Vat resistance, either by introducing a new effector that interferes with the deployment of plant defenses, or by adapting to the defenses it triggered. Viruses transmitted in a non-persistent manner cannot adapt to Vat resistance. At population level, Vat reduces aphid density and genetic diversity. The durability of Vat resistance to A. gossypii populations depends strongly on the agro-ecosystem, including, in particular, the presence of other cucurbit crops serving as

  16. Fluoride removal from rural spring water using wood ash

    CSIR Research Space (South Africa)

    Makhado, R

    2006-05-01

    Full Text Available ). The biology and management of aerial populations of woolly apple aphid, Eriosoma lanigerum (Hausmann) (Homoptera: Aphididae). Ph.D. dissertation, University of Stellenbosch. 12. Pringle K.L. and Heunis J.M. (2001). Woolly apple aphid in South Africa: biology..., seasonal cycles, damage and control. Decid. Fruit Grow. 51, 22?23 and 36. 13 Heunis J.M. and Pringle K.L. (2006). Field biology of woolly apple aphid, Eriosoma lanigerum (Hausmann), and its natural enemy, Aphelinus mali (Hald...

  17. Pengendalian Hayati Afid pada Tanaman Cabai Merah dengan Menochilus sexmaculatus

    OpenAIRE

    Simanjuntak, Dahlia; Wagiman, F. X.; Prabaningrum, Laksminiwati

    2011-01-01

    A field trial on biological control of aphids (Homoptera: Aphididae) with Menochilus sexmaculatus (Coleoptera: Coccinellidae) was conducted at red chilli field in Sleman, Yogyakarta, in the planting season of 2010. Second instar was released at rate of 1 larva/250 aphids. The number of predator per plant varied depending on aphid-population density. The effectiveness of the predator was compared with application of sihalotrin 25 g/l at concentration rate of 2 cc/l as much as 500 l/ha. The res...

  18. Diet of two sympatric insectivores bats (Chiroptera: Vespertilionidae in the Cerrado of Central Brazil Dieta de duas espécies simpátricas de morcegos insetívoros no Cerrado do Brasil Central

    Directory of Open Access Journals (Sweden)

    Ludmilla M. S. Aguiar

    2008-03-01

    Full Text Available We examined food habits of Vespertilionidae bats Myotis nigricans (Schinz, 1821 and Eptesicus furinalis (d'Orbigny, 1847 by fecal analysis in cerrado sensu stricto and gallery forests, within APA - Gama-Cabeça-de-Veado, Brasília, Distrito Federal, Brazil. Out of 20 fecal samples collected, seven were of Eptesicus furinalis and 13 of Myotis nigricans. The diet of E. furinalis included six orders of insects: Coleoptera (5/7 by items presence, Lepidoptera and Hymenoptera (3/7, Diptera, Hemiptera and Homoptera (1/7. The diet of M. nigricans included all the main orders consumed by E. furinalis (6/13, 4/13, 4/13, 3/13, 1/13, and 4/13 respectively and one other order: Orthoptera (1/13. Homoptera, Diptera and Orthoptera were collected only in bats captured in gallery forest. There is 80% of overlap in the diet of these two species. Predation on species of Scarabeidae, Hesperiidae, Sphingidae and Saturniidae families confirms bats potential as biological control agents of pests in agricultural ecosystems.Foi examinado o hábito alimentar das espécies de Vespertilionidae Myotis nigricans (Schinz, 1821 e Eptesicus furinalis (d'Orbigny, 1847 por meio de análise de amostras fecais coletadas em animais capturados em área de cerrado sensu stricto e matas de galeria, na APA - Gama-Cabeça-de-Veado, Brasília, Distrito Federal, Brasil. Um total de 20 amostras fecais foi analisado, sendo sete de E. furinalis e 13 de M. nigricans. A dieta de E. furinalis incluiu seis ordens de insetos: Coleoptera (5/7 (presença na amostra total, Lepidoptera e Hymenoptera (3/7, Diptera, Hemiptera e Homoptera (1/7. A dieta de M. nigricans incluiu todas as ordens consumidas por E. furinalis (6/13, 4/13, 4/13, 3/13, 1/13, and 4/13 respectively e uma ordem a mais: Orthoptera (1/13. Homoptera, Diptera e Orthoptera só foram amostrados para morcegos capturados em mata de galeria. Há 80% de sobreposição na dieta destas duas espécies. A predação sobre espécies das fam

  19. Metaheuristics progress as real problem solvers

    CERN Document Server

    Nonobe, Koji; Yagiura, Mutsunori

    2005-01-01

    Metaheuristics: Progress as Real Problem Solvers is a peer-reviewed volume of eighteen current, cutting-edge papers by leading researchers in the field. Included are an invited paper by F. Glover and G. Kochenberger, which discusses the concept of Metaheuristic agent processes, and a tutorial paper by M.G.C. Resende and C.C. Ribeiro discussing GRASP with path-relinking. Other papers discuss problem-solving approaches to timetabling, automated planograms, elevators, space allocation, shift design, cutting stock, flexible shop scheduling, colorectal cancer and cartography. A final group of methodology papers clarify various aspects of Metaheuristics from the computational view point.

  20. 7th February 2011 - Scottish Cabinet Secretary for Education and Lifelong Learning M. Russell MSP signing the guest book with Beams Department Head P. Collier and Adviser J. Ellis

    CERN Multimedia

    Maximilien Brice

    2011-01-01

    01-17:Scottish Cabinet Secretary for Education and Lifelong Learning M. Russell MSP signing the guest book with Beams Department Head P. Collier and Adviser J. Ellis 18-22: Teachers and Pupils signing the guest book 23-27: visiting the CERN control centre with P. Collier 28-32: visiting the LHCb underground area 33-74: visitng the ATLAS underground area Other members of the delegation: Chief Scientific Adviser to the Scottish Government and Chair in Molecular and Cell Biology at the University of Aberdeen A. Glover; Assistant Private Secretary M. Gallagher; Associate Director Institute for Gravitational Research, University of Glasgow J.Hough.

  1. Selenium in the central nervous system of the rat after exposure to L-selenomethionine

    DEFF Research Database (Denmark)

    Grønbæk, Henning; Thorlacius-Ussing, O.

    1990-01-01

    ~ek and Thorlacius-Ussing 1988). Earlier studies have correlated this selenium accumulation in the anterior pituitary to endocrine dysfunction in selenium-intoxicated animals (Jensen 1975; Glover et al. 1979). Recent results from our laboratory have demonstrated a substantial decrease in growth hormone secretion...... in the anterior pituitary of rats exposed to sodium selenite (Thorlacius-Ussing and Danscher 1985). This histochemical method demonstrates complexes of exogenous selenium and endogenous metal. In the central nervous system and the anterior pituitary, selenium is suggested to form bonds with zinc (Danscher 1984...

  2. [An unpublished contribution of Melanie Klein "On Reassurance"].

    Science.gov (United States)

    Frank, Claudia; Klein, Melanie

    2005-01-01

    Melanie Klein's unpublished paper on reassurance is presented in German translation. The author shows that it was a contribution to Glover's investigation on psychoanalytic technique in the 1930s. The paper is discussed against the background of the technical discussions conducted in London at that time (e. g. M. Schmideberg, J. Strachey) and of Klein's relevant publications. Although Klein consistently considered "correct" interpretation to be the most effective means of reassurance, she occasionally also accepted a non-interpreting approach. In this respect the paper presented here goes further than any other of her writings.

  3. The recombinant pea defensin Drr230a is active against impacting soybean and cotton pathogenic fungi from the genera Fusarium, Colletotrichum and Phakopsora.

    Science.gov (United States)

    Lacerda, Ariane Ferreira; Del Sarto, Rafael Perseghini; Silva, Marilia Santos; de Vasconcelos, Erico Augusto Rosas; Coelho, Roberta Ramos; Dos Santos, Vanessa Olinto; Godoy, Claudia Vieira; Seixas, Claudine Dinali Santos; da Silva, Maria Cristina Mattar; Grossi-de-Sa, Maria Fatima

    2016-06-01

    Plant defensins are antifungal peptides produced by the innate immune system plants developed to circumvent fungal infection. The defensin Drr230a, originally isolated from pea, has been previously shown to be active against various entomopathogenic and phytopathogenic fungi. In the present study, the activity of a yeast-expressed recombinant Drr230a protein (rDrr230a) was tested against impacting soybean and cotton fungi. First, the gene was subcloned into the yeast expression vector pPICZαA and expressed in Pichia pastoris. Resulting rDrr230a exhibited in vitro activity against fungal growth and spore germination of Fusarium tucumaniae, which causes soybean sudden death syndrome, and against Colletotrichum gossypii var. cephalosporioides, which causes cotton ramulosis. The rDrr230a IC 50 corresponding to inhibition of fungal growth of F. tucumaniae and C. gossypii var. cephalosporioides was 7.67 and 0.84 µM, respectively, demonstrating moderate activity against F. tucumaniae and high potency against C. gossypii var. cephalosporioides. Additionally, rDrr230a at 25 ng/µl (3.83 µM) resulted in 100 % inhibition of spore germination of both fungi, demonstrating that rDrr230a affects fungal development since spore germination. Moreover, rDrr230a at 3 µg/µl (460.12 µM) inhibited 100 % of in vitro spore germination of the obligatory biotrophic fungus Phakopsora pachyrhizi, which causes Asian soybean rust. Interestingly, rDrr230a substantially decreased the severity of Asian rust, as demonstrated by in planta assay. To our knowledge, this is the first report of a plant defensin active against an obligatory biotrophic phytopathogenic fungus. Results revealed the potential of rDrr230a as a candidate to be used in plant genetic engineering to control relevant cotton and soybean fungal diseases.

  4. Evaluation de l'incidence des attaques des insectes piqueurs ...

    African Journals Online (AJOL)

    Dans la perspective de contribuer à l'élaboration d'une stratégie de gestion intégrée desprincipaux insectes piqueurs-suceurs (Aphis gossypii et Jacobiella fascialis) rencontrés en culture cotonnière au Togo, un test de résistance variétale a été réalisé sur la station de Kolokopé de juillet à octobre 2016.Huit variétés de ...

  5. Biodiversité fonctionnelle : des bandes fleuries contre les pucerons

    OpenAIRE

    Lambion, Jérôme

    2014-01-01

    Cette présentation fait le bilan des essais concernant les bandes fleuries visant à favoriser les auxiliaires naturels contre les pucerons, qui sont parmi les principaux ravageurs dans le Sud de la France, en particulier sur melon (pour lequel aucun produit phytosanitaire n’est autorisé en AB). Ces essais s'inscrivent dans un réseau d'expérimentations : le CASDAR AGATH (Gestion agro-écologique du puceron Aphis gossypii et du thrips Thrips tabaci en culture de melon ou de poireau) et le CTPS P...

  6. PRODUCT NEEM AZAL T/S - BROAD-SPECTRUM PHYPOPESTICIDE FOR CONTROL OF PESTS ON VEGETABLE CROPS

    Directory of Open Access Journals (Sweden)

    Vinelina Yankova

    2016-09-01

    Full Text Available Experiments for determination of the effectiveness of product Neem Azal T/S (a. i. azadirachtin were conducted at a concentration of 0,3% against some major pests in vegetable crops grown in greenhouses at the Maritsa Vegetable Crops research Institute, Plovdiv during the period 2010-2016. It was established very good insecticidal and acaricidal action of phytopesticide against: cotton aphid (Aphis gossypii Glov.; green peach aphid (Myzus persicae Sulz.; western flower trips (Frankliniella occidentalis Perg.; cotton bollworm (Helicoverpa armigera Hubn.; tomato borer (Tuta absoluta Meyrick and two-spotted spider mite (Tetranichus urticae Koch.. This product is a successful alternative to using chemical insecticides and acaricides.

  7. Pengendalian Hayati Afid pada Tanaman Cabai Merah dengan Menochilus sexmaculatus

    Directory of Open Access Journals (Sweden)

    Dahlia Simanjuntak

    2011-12-01

    Full Text Available A field trial on biological control of aphids (Homoptera: Aphididae with Menochilus sexmaculatus (Coleoptera: Coccinellidae was conducted at red chilli field in Sleman, Yogyakarta, in the planting season of 2010. Second instar was released at rate of 1 larva/250 aphids. The number of predator per plant varied depending on aphid-population density. The effectiveness of the predator was compared with application of sihalotrin 25 g/l at concentration rate of 2 cc/l as much as 500 l/ha. The results showed that effectiveness of the predator application was equal with the insecticide application.   Percobaan lapangan pengendalian hayati Aphis spp. (Homoptera: Aphididae dengan Menochilus sexmaculatus (Coleoptera: Coccinellidae dilakukan di lahan cabai merah di daerah Sleman, Yogyakarta, pada musim tanam tahun 2010. Satu ekor larva instar II dilepas pada populasi 250 ekor afid. Banyaknya predator per tanaman bervariasi tergantung kepadatan populasi afid. Keefektifan aplikasi predator dibandingkan dengan perlakuan sihalotrin 25 g/l, konsentrasi 2 cc/l sebanyak 500 l/ha. Hasil kajian menunjukkan bahwa keefektifan aplikasi predator setara dengan aplikasi insektisida

  8. Assessing the effects of cultivating genetically modified glyphosate-tolerant varieties of soybeans (Glycine max (L.) Merr.) on populations of field arthropods.

    Science.gov (United States)

    Imura, Osamu; Shi, Kun; Iimura, Keiji; Takamizo, Tadashi

    2010-01-01

    We assessed the effects of cultivating two genetically modified (GM) glyphosate-tolerant soybean varieties (Glycine max (L.) Merr.) derived from Event 40-3-2 and a Japanese conventional variety on arthropods under field conditions, with weed control using glyphosate and conventional weed control for two years. Plant height and dry weight of the conventional variety were significantly larger than those of the GM varieties, but the GM varieties bore more pods than the conventional variety. We found arthropods of nine taxonomic orders (Araneae, Acari, Thysanoptera, Homoptera, Heteroptera, Coleoptera, Diptera, Lepidoptera, and Hymenoptera) on the plants. The arthropod incidence (number per plant unit weight pooled for each taxonomic order) on the soybean stems and leaves generally did not differ significantly between the GM and conventional varieties. However, the incidence of Thysanoptera and total incidence (all orders combined) were greater on the GM variety in the second year. The weed control regimes had no significant influence on the arthropod incidence on the soybean stems and leaves. The number of flower-inhabiting Thysanoptera (the dominant arthropod in the flowers) was not significantly different between the GM and conventional varieties. Asphondylia yushimai (Diptera, Cecidomyiidae) was more numerous on the pods of the GM variety in both years. Neither the soybean variety nor the weed control regime significantly affected the density of soil macro-organisms. However, the glyphosate weed control affected arthropods between the rows of plants by decreasing the abundances of Homoptera, Heteroptera, Coleoptera and Lepidoptera, and diversity of arthropods. © ISBR, EDP Sciences, 2011.

  9. Evaluation of simplified stream-aquifer depletion models for water rights administration

    Science.gov (United States)

    Sophocleous, Marios; Koussis, Antonis; Martin, J.L.; Perkins, S.P.

    1995-01-01

    We assess the predictive accuracy of Glover's (1974) stream-aquifer analytical solutions, which are commonly used in administering water rights, and evaluate the impact of the assumed idealizations on administrative and management decisions. To achieve these objectives, we evaluate the predictive capabilities of the Glover stream-aquifer depletion model against the MODFLOW numerical standard, which, unlike the analytical model, can handle increasing hydrogeologic complexity. We rank-order and quantify the relative importance of the various assumptions on which the analytical model is based, the three most important being: (1) streambed clogging as quantified by streambed-aquifer hydraulic conductivity contrast; (2) degree of stream partial penetration; and (3) aquifer heterogeneity. These three factors relate directly to the multidimensional nature of the aquifer flow conditions. From these considerations, future efforts to reduce the uncertainty in stream depletion-related administrative decisions should primarily address these three factors in characterizing the stream-aquifer process. We also investigate the impact of progressively coarser model grid size on numerically estimating stream leakage and conclude that grid size effects are relatively minor. Therefore, when modeling is required, coarser model grids could be used thus minimizing the input data requirements.

  10. Familial predictors of childhood shyness: a study of the United Arab Emirates population.

    Science.gov (United States)

    Eapen, V; Ghubash, R; Salem, M O; Sabri, S

    2005-01-01

    Phobic anxiety disorders generally breed true. In this regard, family studies have suggested an association between childhood shyness and maternal social phobia. In this study, the relationship between childhood shyness and maternal social anxiety was examined. 203 5-year-old children from an Arabian Gulf community and their mothers were evaluated. The children were assessed in stage 1 using the shyness scale of Stevenson-Hinde and Glover and the Preschool Behavior Checklist (PBCL), while mothers completed the Liebowitz Social Anxiety Scale. In the second stage, blind clinical interviews were carried out to ascertain the diagnosis of psychiatric diagnoses, if any, using DSM-IV criteria. 27% of the children were identified as shy using the shyness scale of Stevenson-Hinde and Glover and 19% scored above the cutoff for behavioral disturbance on the PBCL. Child shyness was associated with female gender and maternal social anxiety as indicated by scores on the Liebowitz Social Anxiety Scale, while an inverse relationship was noted with behavioral disturbance. The odds of the child having a high shyness score was increased if the mother had social anxiety (odds ratio = 2.14) and the child lived in a family that was 'not socially active' (odds ratio = 1.42). Our initial findings suggest that there may be a complex interaction between maternal social anxiety and family sociability in childhood shyness. Prospective longitudinal work is indicated. Copyright 2005 S. Karger AG, Basel.

  11. Handbook of metaheuristics

    CERN Document Server

    Potvin, Jean-Yves

    2010-01-01

    “… an excellent book if you want to learn about a number of individual metaheuristics." (U. Aickelin, Journal of the Operational Research Society, Issue 56, 2005, on the First Edition) The first edition of the Handbook of Metaheuristics was published in 2003 under the editorship of Fred Glover and Gary A. Kochenberger. Given the numerous developments observed in the field of metaheuristics in recent years, it appeared that the time was ripe for a second edition of the Handbook. When Glover and Kochenberger were unable to prepare this second edition, they suggested that Michel Gendreau and Jean-Yves Potvin should take over the editorship, and so this important new edition is now available. Through its 21 chapters, this second edition is designed to provide a broad coverage of the concepts, implementations and applications in this important field of optimization. Original contributors either revised or updated their work, or provided entirely new chapters. The Handbook now includes updated chapters on the b...

  12. Characteristics of Watermelon Mosaic Virus Transmission Occurring in Korean Ginseng

    Directory of Open Access Journals (Sweden)

    Seung-Kook Choi

    2014-09-01

    Full Text Available Korean ginseng (Panax ginseng is the most popular herb for medical purpose in Korea. Recently, viral diseases from Korean ginseng showing various degrees of severe mottling, variegation and mosaic symptoms have caused quantity losses of Korean ginseng in a large number of farms. Watermelon mosaic virus (named WMVgin was identified as a causal agent for the disease of Korean ginseng. Interestingly, WMV-gin failed to infect both Korean ginseng plant and susceptible host species including cucurbitaceous plants by mechanical inoculation. However, WMV-gin could successfully infect Korean ginseng by transmission of two aphid species (Myzus persicae and Aphis gossypii. It is likely that transmission of WMV-gin was done by both the aphid species during feeding behavior of the two aphid species on Korean ginseng, though the aphids dislike feeding in Korea ginseng. Similarly, a strain of WMV (WMV-wm isolated from watermelon was transmitted successfully to Korean ginseng plant by the two aphid species, but not by mechanical inoculations. Transmission assays using M. persicae and A. gossypii clearly showed both WMV-gin and WMV-wm were not transmitted from infected Korean ginseng plant to cucurbit species that are good host species for WMV. These results suggest WMV disease occurring in Korean ginseng plant can be controlled by ecological approaches.

  13. miRNA-mediated auxin signalling repression during Vat-mediated aphid resistance in Cucumis melo.

    Science.gov (United States)

    Sattar, Sampurna; Addo-Quaye, Charles; Thompson, Gary A

    2016-06-01

    Resistance to Aphis gossypii in melon is attributed to the presence of the single dominant R gene virus aphid transmission (Vat), which is biologically expressed as antibiosis, antixenosis and tolerance. However, the mechanism of resistance is poorly understood at the molecular level. Aphid-induced transcriptional changes, including differentially expressed miRNA profiles that correspond to resistance interaction have been reported in melon. The potential regulatory roles of miRNAs in Vat-mediated aphid resistance were further revealed by identifying the specific miRNA degradation targets. A total of 70 miRNA:target pairs, including 28 novel miRNA:target pairs, for the differentially expressed miRNAs were identified: 11 were associated with phytohormone regulation, including six miRNAs that potentially regulate auxin interactions. A model for a redundant regulatory system of miRNA-mediated auxin insensitivity is proposed that incorporates auxin perception, auxin modification and auxin-regulated transcription. Chemically inhibiting the transport inhibitor response-1 (TIR-1) auxin receptor in susceptible melon tissues provides in vivo support for the model of auxin-mediated impacts on A. gossypii resistance. © 2016 John Wiley & Sons Ltd.

  14. Dry entrapment of enzymes by epoxy or polyester resins hardened on different solid supports.

    Science.gov (United States)

    Barig, Susann; Funke, Andreas; Merseburg, Andrea; Schnitzlein, Klaus; Stahmann, K-Peter

    2014-06-10

    Embedding of enzymes was performed with epoxy or polyester resin by mixing in a dried enzyme preparation before polymerization was started. This fast and low-cost immobilization method produced enzymatically active layers on different solid supports. As model enzymes the well-characterized Thermomyces lanuginosus lipase and a new threonine aldolase from Ashbya gossypii were used. It was shown that T. lanuginosus lipase recombinantly expressed in Aspergillus oryzae is a monomeric enzyme with a molecular mass of 34kDa, while A. gossypii threonine aldolase expressed in Escherichia coli is a pyridoxal-5'-phosphate binding homotetramer with a mass of 180kDa. The enzymes were used freeze dried, in four different preparations: freely diffusing, adsorbed on octyl sepharose, as well as cross-linked enzyme aggregates or as suspensions in organic solvent. They were mixed with standard two-component resins and prepared as layers on solid supports made of different materials e.g. metal, glass, polyester. Polymerization led to encapsulated enzyme preparations showing activities comparable to literature values. Copyright © 2014 Elsevier Inc. All rights reserved.

  15. Food habits of Nyctinomops macrotis at a maternity roost in New Mexico, as indicated by analysis of guano

    Science.gov (United States)

    Sparks, D.W.; Valdez, E.W.

    2003-01-01

    We examined 56 fecal pellets from under a maternity colony of big free-tailed bats (Nyctinomops macrotis) in the Jemez Mountains of northern New Mexico. The most important food items, listed in order of decreasing percent volume, were Cicadellidae, leafhoppers (26.7% volume, 58.9% frequency); Ichneumonidae, Ichneumon wasps (19.3% volume, 35.7% frequency); and Lepidoptera, moths (17.2% volume, 82.1% frequency). Overall, the most important orders as prey consumed, listed by decreasing percent volume, were Homoptera (27.6% volume, 62.5% frequency), Hymenoptera (19.5% volume, 37.5% frequency), Lepidoptera (17.2% volume, 82.1% frequency), Hemiptera (11.7% volume, 37.5% frequency), and Diptera (10.6% volume, 50.0% frequency). Our study documents an unusually varied diet, as previous studies indicated that these bats fed almost exclusively on moths.

  16. Food habits of introduced rodents in high-elevation shrubland of Haleakala National Park, Maui, Hawai'i

    Science.gov (United States)

    Cole, F. Russell; Loope, Lloyd L.; Medeiros, Arthur C.; Howe, Cameron E.; Anderson, Laurel J.

    2000-01-01

    Mus musculus and Rattus rattus are ubiquitous consumers in the high-elevation shrubland of Haleakala National Park. Food habits of these two rodent species were determined from stomach samples obtained by snaptrapping along transects located at four different elevations during November 1984 and February, May, and August 1985. Mus musculus fed primarily on fruits, grass seeds, and arthropods. Rattus rattus ate various fruits, dicot leaves, and arthropods. Arthropods, many of which are endemic, were taken frequently by Mus musculus throughout the year at the highest elevation where plant food resources were scarce. Araneida, Lepidoptera (primarily larvae), Coleoptera, and Homoptera were the main arthropod taxa taken. These rodents, particularly Mus musculus, exert strong predation pressure on populations of arthropod species, including locally endemic species on upper Haleakala Volcano.

  17. Índice de diversidade para entomofauna da bracatinga (Mimosa scabrella Benth.).

    OpenAIRE

    Ervandil Corrêa Costa; Dionisio Link; Liliana D. de Medina

    2009-01-01

    No período de abril de 1983 a setembro de 1984, efetuou-se o levantamento da entomofauna da bracatinga, em Almirante Tamandaré, PR. Os levantamentos foram efetuados quinzenalmente em copas de talhões com 8, 42 e 60 meses de idade, através da rede de copa e, de seus respectivos sub-bosques com rede de varredura. Para o cálculo do índice de diversidade utilizou-se a fórmula  alfa = (S-1)/log N. Para a tabulação dos dados, optou-se pelas ordens Homoptera, Hemíptera e Coleóptera que apresentar...

  18. ÍNDICE DE DIVERSIDADE PARA ENTOMOFAUNA DA BRACATINGA (Mimosa scabrella Benth.)

    OpenAIRE

    Liliana D. de Medina; Dionísio Link; Ervandil Correa Costa

    1993-01-01

    No período de abril de 1983 a setembro de 1984, efetuou-se o levantamento da entomofauna da bracatinga, em Almirante Tamandaré, PR. Os levantamentos foram efetuados quinzenalmente em copas de talhões com 8, 42 e 60 meses de idade, através da rede de copa e, de seus respectivos sub-bosques com rede de varredura. Para o cálculo do índice de diversidade utilizou-se a fórmula alfa = (S-1)/log N. Para a tabulação dos dados, optou-se pelas ordens Homoptera, Hemíptera e Coleóptera que apresentaram m...

  19. Foraging, Mating, and Thermoregulatory Behavior of Cyrtopogon willistoni Curran (Diptera: Asilidae

    Directory of Open Access Journals (Sweden)

    Kevin M. O'Neill

    1995-01-01

    Full Text Available The robber fly Cyrtopogon willistoni Curran was studied in SW Montana, where it was an opportunistic predator of relatively small insects from 25 families in 7 orders. The most common prey were Diptera (44% and Homoptera (21%, with Cicadellidae, Bibionidae, and Formicidae comprising 44% of the prey. The elaborate courtship behavior of males included audible airborne visual displays that made use of silvery-white combs of hairs on the males' foretarsi. While perching, the flies exhibited both lateral and dorsal basking postures, and were apparently capable of strong flight only when direct sunlight was available. I compare the foraging and courtship behaviors of C. willistoni to those of other Cyrtopogon, and their thermal responses to those of other robber flies in the same habitat.

  20. [Anthropoentomophagic biodiversity of the Zongolica region, Veracruz, Mexico].

    Science.gov (United States)

    Ramos-Elorduy, Julieta; Landero-Torres, Ivonne; Murguía-González, Joaquín; Pino, José M M

    2008-03-01

    Anthropoentomophagic biodiversity of the Zongolica region, Veracruz, Mexico. During two and a half years (2003-2005) we recorded the insect species used as food at Zongolica, Veracruz State, Mexico. Interviews were made among people (200) of this municipality to know which insects they consumed. The total of registered species was 57 (Orthoptera, Hemiptera, Homoptera, Megaloptera, Coleoptera, Lepidoptera and Hymenoptera). The Orthoptera was the most frequently ingested. Twenty-four of these species were new records for edible insects of Mexico. They are eaten in immature stages or as adults, generally only roasted. Consumption is seasonal. Some species are commercialized in the "tianguis" (little town markets) and/or in the larger Zongolica market. There is a "protoculture" of three species, one cockroach (Periplaneta australasiae Fabricius) and two moths (Latebraria amphipyroides Guenée and Arsenura armida armida Cramer). In Zongolica, anthropoentomophagy is an ancestral habit.

  1. DIVERSITAS SERANGGA PERMUKAAN TANAH PADA PERTANIAN HORTIKULTURA ORGANIK DI BANJAR TITIGALAR, DESA BANGLI, KECAMATAN BATURITI, KABUPATEN TABANAN-BALI

    Directory of Open Access Journals (Sweden)

    Samsul Ma'arif

    2015-02-01

    Full Text Available Penelitian ini bertujuan untuk mengetahui diversitas serangga permukaan tanah pada pertanian hortikultura organik di Banjar Titigalar, Desa Bangli, Kecamatan Baturiti, Kabupaten Tabanan-Bali. Penelitian dilaksanakan dari bulan Oktober-Desember 2013. Sampel diambil menggunakan Pitfall Trap. Analisa data dilakukan dengan metode deskriptif yaitu dengan mendeskripsikan serangga yang ditemukan dan kemudian diidentifikasi sampai ke tingkat Genus. Hasil penelitian menunjukkan, terdapat 3.066 individu serangga yang termasuk ke dalam 20 genus, 17 famili dan 7 ordo.  Keseluruhan Ordo serangga yang ditemukan adalah Hymenoptera, Orthoptera, Collembola, Coleoptera, Hemiptera, Homoptera, dan Diptera. Diversitas serangga tertinggi ditemukan pada bulan Oktober dengan nilai Indeks Diversitas (H’=1,5821 pada malam hari, dan H’=1,3978 pada siang hari, dibandingkan yang paling rendah terjadi pada bulan Desember dengan indseks diversitas H’= 0,5829 pada malam hari dan H’= 0,9223 pada siang hari.

  2. Insecticidal activity of three plants extracts against Myzus persicae (Sulzer, 1776 and their phytochemical screening

    Directory of Open Access Journals (Sweden)

    Billal NIA

    2015-11-01

    Full Text Available To reduce the use of synthetic pesticides and their negative effects on the environment, leaves extracts of Artemisia herba-alba Asso, Eucalyptus camaldulensis Dehnh and Rosmarinus officinalis L. were obtained with petroleum ether, ethanol and distilled water as solvents. These extracts were evaluated under laboratory conditions for their insecticidal effect against 3 to 4 days-old Myzus persicae individuals (Homoptera: Aphididae at 1, 2.5, 5, and 10 %. We made observations after 24 hours. Etheric extract of all plants was effective and caused mortalities (100 %, 53 % and 60 % respectively at the highest concentration. However, ethanolic and aqueous extracts did not show any significant insecticidal effect. The phytochemical screening showed the richness of etheric extract in terpenes. The results obtained suggest that we can make bioinsecticides based on leaves etheric extracts from these plants for use in integrated pest management.

  3. Etude morphologique et biologique de la coccinelle Scymnus couturieri Chazeau (Coleoptera-Coccinellidae prédatrice de la cochenille farineuse du manioc Phenacoccus manihoti Matile-Ferrero

    Directory of Open Access Journals (Sweden)

    Obame Minko, D.

    1999-01-01

    Full Text Available Morphological and Biological Study of Scymnus couturieri Chazeau (Coleoptera-Coccinellidae, Predator of Cassava Mealybug Phenacoccus manihoti Matile-Ferrero (Homoptera-Pseudococcidae in Ivory Coast. Scymnus couturieri is a coccinellidae which was first described from Ivory Coast (2. But that morphological description was just based on the adult. The trophic action developed by Scymnus couturieri in the regulation of the abundance of the cassava mealybug led us to precise that description and to extend our knowledge of the coccinellidae by studying the morphological aspects and the biological parameters. The study brings to the fore the holometaboly development, the low fecondity and the long-lasting biological cycle of the predator.

  4. What do spring migrants reveal about sex and host selection in the melon aphid?

    Directory of Open Access Journals (Sweden)

    Thomas Sophie

    2012-04-01

    Full Text Available Abstract Background Host plants exert considerable selective pressure on aphids because the plants constitute their feeding, mating and oviposition sites. Therefore, host specialisation in aphids evolves through selection of the behavioural and chemical mechanisms of host-plant location and recognition, and through metabolic adaptation to the phloem content of the host plant. How these adaptive traits evolve in an aphid species depends on the complexity of the annual life cycle of that species. The purpose of this field study was to determine how winged spring-migrant populations contribute to the evolution and maintenance of host specialisation in Aphis gossypii through host-plant choice and acceptance. We also assessed whether host-specialised genotypes corresponded exclusively to anholocyclic lineages regardless of the environmental conditions. Results The spring populations of cotton-melon aphids visiting newly planted melon crops exhibited an unexpectedly high level of genetic diversity that contrasted with the very low diversity characterising the host-specialised populations of this aphid species. This study illustrated in natura host-plant-selection pressure by showing the great differences in genetic diversity between the spring-migrant populations (alate aphids and the melon-infesting populations (the apterous offspring of the alate aphids. Moreover, an analysis of the genetic composition of these alate and apterous populations in four geographic regions suggested differences in life-history strategies, such as host choice and reproductive mode, and questioned the common assertion that A. gossypii is an anholocyclic species throughout its distribution area, including Europe. Conclusions Our results clearly demonstrate that the melon plant acts as a selective filter against the reproduction of non-specialised individuals. We showed that olfactory cues are unlikely to be decisive in natura for host recognition by spring-migrant aphid

  5. Biological control of fruit flies (Diptera: Tephritidae) through parasitoid augmentative releases: Current status

    International Nuclear Information System (INIS)

    Montoya, Pablo; Liedo, Pablo

    2000-01-01

    Fruit flies are among the main pests affecting the world fruit industry (Aluja 1993). Bait sprays have traditionally been used successfully to control them; however, the side effects on the environment and health hazards commonly associated with pesticides, have resulted in strong public opposition to the use of bait sprays. This is particularly so when sprays are applied in urban areas or in coffee plantations where, although Medflies are present, they do not pose a danger to crops. Alternative methods that are effective and environmental friendly to suppress fruit fly populations are highly desirable. Biological control, the use of natural enemies to suppress pest populations, represents such an alternative. Some of the most successful cases of biological control are the control of Iceria purchasi Maskell (Homoptera: Margarodidae) by Rodolia cardinalis Mulsant (Coleoptera: Coccinellidae) in California (De Bach 1968, van den Bosch et al. 1982), and the control of Aleurocanthus woglumi Ashby (Homoptera: Aleyrodidae) mainly by Encarsia (=Prospaltella) opulenta Silv. (Hymenoptera: Aphelinidae) in Mexico (Jimenez 1961, 1971), both using the classical approach. However, this approach has been limited to certain conditions of environmental stability and biodiversity which are only found in a few ecosystems. Other factors, such as types of pests, the economic threshold and product quality requirements represent additional limitations. The best option in many cases could be augmentative biological control, which could overcome some of the deficiencies of the classical approach (Sivinski 1996). According to Knipling (1992) and Barclay (1987), augmentative biological control can be considered as a formal alternative for suppressing pest populations and even for use in eradication programmes, after integration with the sterile insect technique (SIT). In this approach, mass production of natural enemies is required and this production has to be cost effective

  6. Comparative analysis of Solanum stoloniferum responses to probing by the green peach aphid Myzus persicae and the potato aphid Macrosiphum euphorbiae.

    Science.gov (United States)

    Alvarez, Adriana E; Broglia, Viviana G; Alberti D'Amato, Anahí M; Wouters, Doret; van der Vossen, Edwin; Garzo, Elisa; Tjallingii, W Fred; Dicke, Marcel; Vosman, Ben

    2013-04-01

    Plants protect themselves against aphid attacks by species-specific defense mechanisms. Previously, we have shown that Solanum stoloniferum Schlechtd has resistance factors to Myzus persicae Sulzer (Homoptera: Aphididae) at the epidermal/mesophyll level that are not effective against Macrosiphum euphorbiae Thomas (Homoptera: Aphididae). Here, we compare the nymphal mortality, the pre-reproductive development time, and the probing behavior of M. persicae and M. euphorbiae on S. stoloniferum and Solanum tuberosum L. Furthermore, we analyze the changes in gene expression in S. stoloniferum 96 hours post infestation by either aphid species. Although the M. euphorbiae probing behavior shows that aphids encounter more probing constrains on phloem activities-longer probing and salivation time- on S. stoloniferum than on S. tuberosum, the aphids succeeded in reaching a sustained ingestion of phloem sap on both plants. Probing by M. persicae on S. stoloniferum plants resulted in limited feeding only. Survival of M. euphorbiae and M. persicae was affected on young leaves, but not on senescent leaves of S. stoloniferum. Infestation by M. euphorbiae changed the expression of more genes than M. persicae did. At the systemic level both aphids elicited a weak response. Infestation of S. stoloniferum plants with a large number of M. persicae induced morphological changes in the leaves, leading to the development of pustules that were caused by disrupted vascular parenchyma and surrounding tissue. In contrast, an infestation by M. euphorbiae had no morphological effects. Both plant species can be regarded as good host for M. euphorbiae, whereas only S. tuberosum is a good host for M. persicae and S. stoloniferum is not. Infestation of S. stoloniferum by M. persicae or M. euphorbiae changed the expression of a set of plant genes specific for each of the aphids as well as a set of common genes. © 2012 The Authors Insect Science © 2012 Institute of Zoology, Chinese Academy of

  7. Power, command and violence in von Trier’s Manderlay. A political and philosophical analysis of pseudo-democracies.

    Directory of Open Access Journals (Sweden)

    Sara Marino

    2016-10-01

    Full Text Available Alabama, 1933. A caravan of limousines carrying gangsters arrives in Manderlay, a small village where slavery still exists as an institution. Mam (Lauren Bacall rules the plantation assisted by her foreman Wilhelm (Danny Glover, a slave who believes his people are not ready for the responsibilities of freedom. Driving up to the gates of the plantation, Grace (Bryce Dallas Howard declares that the slaves must be informed how to enjoy freedom and thus becoming good citizens. Drawing on a textual and visual analysis of Manderlay, the article explores how democracy arises from the exercise of violence and power, as well as the inability of Western societies to deal with the dogma of difference.

  8. PHYCAA: Data-driven measurement and removal of physiological noise in BOLD fMRI

    DEFF Research Database (Denmark)

    Churchill, Nathan W.; Yourganov, Grigori; Spring, Robyn

    2012-01-01

    challenge for identifying and removing such artifact. This paper presents a multivariate, data-driven method for the characterization and removal of physiological noise in fMRI data, termed PHYCAA (PHYsiological correction using Canonical Autocorrelation Analysis). The method identifies high frequency......, autocorrelated physiological noise sources with reproducible spatial structure, using an adaptation of Canonical Correlation Analysis performed in a split-half resampling framework. The technique is able to identify physiological effects with vascular-linked spatial structure, and an intrinsic dimensionality...... with physiological noise, and real data-driven model prediction and reproducibility, for both block and event-related task designs. This is demonstrated compared to no physiological noise correction, and to the widely used RETROICOR (Glover et al., 2000) physiological denoising algorithm, which uses externally...

  9. Plastic flow and failure in single point incremental forming of PVC sheets

    Directory of Open Access Journals (Sweden)

    P. A. F. Martins

    2014-05-01

    Full Text Available This paper presents an innovative and effective methodology to characterize plastic flow and failure in single point incremental forming (SPIF of polymers that allows determining the stresses and the accumulated values of ductile damage directly from the experimental values of strain at various positions over the deformed polymer sheets. The approach traces the deformation path of material elements in conical and pyramidal SPIF parts, undergoing linear strain loading paths from beginning until failure, and is built upon the generalization of the analytical framework conditions assumed by Glover et al. [1] to the pressure-sensitive yield surfaces of polymers under incompressible, non-associated, plastic flow. Experimentation in conventional and multi-stage SPIF of Polyvinylchloride (PVC sheets confirms the effectiveness of the proposed methodology and demonstrates that standard non-coupled damage models currently utilized in sheet metal forming are inapplicable to describe failure in polymers. Instead fracture forming limit lines (FFL’s should be employed.

  10. RETHINKING THE ROLE OF SMALL-GROUP COLLABORATORS AND ADVERSARIES IN THE LONDON KLEINIAN DEVELOPMENT (1914-1968).

    Science.gov (United States)

    Aguayo, Joseph; Regeczkey, Agnes

    2016-07-01

    The authors historically situate the London Kleinian development in terms of the small-group collaborations and adversaries that arose during the course of Melanie Klein's career. Some collaborations later became personally adversarial (e.g., those Klein had with Glover and Schmideberg); other adversarial relationships forever remained that way (with A. Freud); while still other long-term collaborations became theoretically contentious (such as with Winnicott and Heimann). After the Controversial Discussions in 1944, Klein marginalized one group of supporters (Heimann, Winnicott, and Riviere) in favor of another group (Rosenfeld, Segal, and Bion). After Klein's death in 1960, Bion maintained loyalty to Klein's ideas while quietly distancing his work from the London Klein group, immigrating to the United States in 1968. © 2016 The Psychoanalytic Quarterly, Inc.

  11. Diet reconstruction and resource partitioning of a Caribbean marine mesopredator using stable isotope bayesian modelling.

    Directory of Open Access Journals (Sweden)

    Alexander Tilley

    Full Text Available The trophic ecology of epibenthic mesopredators is not well understood in terms of prey partitioning with sympatric elasmobranchs or their effects on prey communities, yet the importance of omnivores in community trophic dynamics is being increasingly realised. This study used stable isotope analysis of (15N and (13C to model diet composition of wild southern stingrays Dasyatis americana and compare trophic niche space to nurse sharks Ginglymostoma cirratum and Caribbean reef sharks Carcharhinus perezi on Glovers Reef Atoll, Belize. Bayesian stable isotope mixing models were used to investigate prey choice as well as viable Diet-Tissue Discrimination Factors for use with stingrays. Stingray δ(15N values showed the greatest variation and a positive relationship with size, with an isotopic niche width approximately twice that of sympatric species. Shark species exhibited comparatively restricted δ(15N values and greater δ(13C variation, with very little overlap of stingray niche space. Mixing models suggest bivalves and annelids are proportionally more important prey in the stingray diet than crustaceans and teleosts at Glovers Reef, in contrast to all but one published diet study using stomach contents from other locations. Incorporating gut contents information from the literature, we suggest diet-tissue discrimination factors values of Δ(15N ≈ 2.7‰ and Δ(13C ≈ 0.9‰ for stingrays in the absence of validation experiments. The wide trophic niche and lower trophic level exhibited by stingrays compared to sympatric sharks supports their putative role as important base stabilisers in benthic systems, with the potential to absorb trophic perturbations through numerous opportunistic prey interactions.

  12. Biological and behavior aspects of Chrysoperla externa (Hagen, 1861 on cotton plantsAspectos biológicos e comportamentais de Chrysoperla externa (Hagen, 1861 em algodoeiro

    Directory of Open Access Journals (Sweden)

    Luciano Pacelli Medeiros Macedo

    2010-02-01

    Full Text Available It was aimed to study biological and behavior aspects of larvae and adults of Chrysoperla externa in greenhouse, on cotton plants. Recently hatched larvae were released on the upper third of cotton plants, which were previously infested with Aphis gossypii,. After emergence, adults were separated by sex and packed in cylindrical PVC recipients with cotton plant. We evaluated the duration of each larval, pre-pupal and pupal periods, pre-oviposition, oviposition, effective oviposition and post-oviposition periods, male and female logevity, daily and total oviposition capacity. The behavior of pupal stage was also evaluated, which released three larvae of the 3rd instar per cotton plant and they were put on the lower, medium and upper sections. As treatments, it was used naked soil, dried leaves from cotton plant, crushed rock nº 1; and crushed rock nº 1 + dried leaves. Larvae from different instars were released on the upper section of the cotton plants infested with A. gossypii to verify the search timing that marked the period the prey was exposed to the predator. C. externa larvae passed through all the phases of their biological cycle and there was no significant influence on the type of the soil covering used on pupal stage, since all of them were significantly higher on naked soil. There was no significative difference on the prey search by C. externa larvae.Objetivou-se estudar aspectos biológicos e comportamentais de larvas e adultos de Chrysoperla externa em casa-de-vegetação, em plantas de algodão. Larvas recém eclodidas foram liberadas no terço superior de plantas de algodão previamente infestadas com Aphis gossypii, onde permaneceram até a pupação. Após a emergência, adultos foram separados por sexo, acondicionados em recipientes cilíndricos de PVC contendo uma planta de algodoeiro. Avaliaram-se a duração de cada ínstar, dos períodos larval, pré-pupal e pupal, dos períodos de pré-oviposição, oviposi

  13. Dicty_cDB: AHB355 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AH (Link to library) AHB355 (Link to dictyBase) - - - Contig-U16408-1 - (Link to Original site) - - AHB...355Z 686 - - - - Show AHB355 Library AH (Link to library) Clone ID AHB355 (Link to dicty...iol.tsukuba.ac.jp/CSM/AH/AHB3-C/AHB355Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >AHB355 (AHB355Q) /CSM/AH/AHB3-C/AHB355Q.Seq.d/ XXXXXXXXXXATAAGAT...ana Unknown prote... 33 7.6 AE016819_111( AE016819 |pid:none) Ashbya gossypii (= Eremothecium ... 33 9.9 ( P

  14. Fungal model systems and the elucidation of pathogenicity determinants.

    Science.gov (United States)

    Perez-Nadales, Elena; Nogueira, Maria Filomena Almeida; Baldin, Clara; Castanheira, Sónia; El Ghalid, Mennat; Grund, Elisabeth; Lengeler, Klaus; Marchegiani, Elisabetta; Mehrotra, Pankaj Vinod; Moretti, Marino; Naik, Vikram; Oses-Ruiz, Miriam; Oskarsson, Therese; Schäfer, Katja; Wasserstrom, Lisa; Brakhage, Axel A; Gow, Neil A R; Kahmann, Regine; Lebrun, Marc-Henri; Perez-Martin, José; Di Pietro, Antonio; Talbot, Nicholas J; Toquin, Valerie; Walther, Andrea; Wendland, Jürgen

    2014-09-01

    Fungi have the capacity to cause devastating diseases of both plants and animals, causing significant harvest losses that threaten food security and human mycoses with high mortality rates. As a consequence, there is a critical need to promote development of new antifungal drugs, which requires a comprehensive molecular knowledge of fungal pathogenesis. In this review, we critically evaluate current knowledge of seven fungal organisms used as major research models for fungal pathogenesis. These include pathogens of both animals and plants; Ashbya gossypii, Aspergillus fumigatus, Candida albicans, Fusarium oxysporum, Magnaporthe oryzae, Ustilago maydis and Zymoseptoria tritici. We present key insights into the virulence mechanisms deployed by each species and a comparative overview of key insights obtained from genomic analysis. We then consider current trends and future challenges associated with the study of fungal pathogenicity. Copyright © 2014 The Authors. Published by Elsevier Inc. All rights reserved.

  15. Fungal model systems and the elucidation of pathogenicity determinants

    Science.gov (United States)

    Perez-Nadales, Elena; Almeida Nogueira, Maria Filomena; Baldin, Clara; Castanheira, Sónia; El Ghalid, Mennat; Grund, Elisabeth; Lengeler, Klaus; Marchegiani, Elisabetta; Mehrotra, Pankaj Vinod; Moretti, Marino; Naik, Vikram; Oses-Ruiz, Miriam; Oskarsson, Therese; Schäfer, Katja; Wasserstrom, Lisa; Brakhage, Axel A.; Gow, Neil A.R.; Kahmann, Regine; Lebrun, Marc-Henri; Perez-Martin, José; Di Pietro, Antonio; Talbot, Nicholas J.; Toquin, Valerie; Walther, Andrea; Wendland, Jürgen

    2014-01-01

    Fungi have the capacity to cause devastating diseases of both plants and animals, causing significant harvest losses that threaten food security and human mycoses with high mortality rates. As a consequence, there is a critical need to promote development of new antifungal drugs, which requires a comprehensive molecular knowledge of fungal pathogenesis. In this review, we critically evaluate current knowledge of seven fungal organisms used as major research models for fungal pathogenesis. These include pathogens of both animals and plants; Ashbya gossypii, Aspergillus fumigatus, Candida albicans, Fusarium oxysporum, Magnaporthe oryzae, Ustilago maydis and Zymoseptoria tritici. We present key insights into the virulence mechanisms deployed by each species and a comparative overview of key insights obtained from genomic analysis. We then consider current trends and future challenges associated with the study of fungal pathogenicity. PMID:25011008

  16. Bioproduction of riboflavin: a bright yellow history.

    Science.gov (United States)

    Revuelta, José Luis; Ledesma-Amaro, Rodrigo; Lozano-Martinez, Patricia; Díaz-Fernández, David; Buey, Rubén M; Jiménez, Alberto

    2017-05-01

    Riboflavin (vitamin B 2 ) is an essential nutrient for humans and animals that must be obtained from the diet. To ensure an optimal supply, riboflavin is used on a large scale as additive in the food and feed industries. Here, we describe a historical overview of the industrial process of riboflavin production starting from its discovery and the need to produce the vitamin in bulk at prices that would allow for their use in human and animal nutrition. Riboflavin was produced industrially by chemical synthesis for many decades. At present, the development of economical and eco-efficient fermentation processes, which are mainly based on Bacillus subtilis and Ashbya gossypii strains, has replaced the synthetic process at industrial scale. A detailed account is given of the development of the riboflavin overproducer strains as well as future prospects for its improvement.

  17. Biosynthesis of riboflavin: mechanism of formation of the ribitylamino linkage

    International Nuclear Information System (INIS)

    Keller, P.J.; Van, Q.L.; Kim, S.U.; Bown, D.H.; Chen, H.C.; Kohnle, A.; Bacher, A.; Floss, H.G.

    1988-01-01

    Feeding experiments with Ashbya gossypii followed by NMR analysis of the resulting riboflavin showed incorporation of deuterium from D-[2- 2 H]ribose at C-2' and from D-[1- 2 H] ribose in the pro-R position at C-1' of the ribityl side chain. The results rule out an Amadori rearrangement mechanism for the reduction of the ribosylamino to the ribitylamino linkage and point to formation of a Schiff base that is reduced stereospecifically opposite to the face from which the oxygen has departed. As prerequisite for the analysis, the 1 H NMR signals for the pro-R and pro-S hydrogens at C-1' of 6,7-dimethyl-8-ribityllumazine and riboflavin and its tetraacetate were assigned with the aid of synthetic stereospecifically deuteriated samples

  18. AcEST: BP914040 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_B12 523 Adiantum capillus-veneris mRNA. clone: YMU001_000039_B12. BP914040 - Show BP914040...is mRNA. clone: YMU001_000039_B12. Accession BP914040 Tissue type prothallium Developmental stage - Contig I...d BLAST and PSI-BLAST: a new generation of protein database search programs, Nucl...eic Acids Res. 25:3389-3402. Query= BP914040|Adiantum capillus-veneris mRNA, clone: YMU001_000039_B12. (523 ... ... 33 1.1 sp|Q758T8|SWC3_ASHGO SWR1-complex protein 3 OS=Ashbya gossypii G... 32 1.8 sp|P32583|SRP40_YEAST

  19. Guanine nucleotide binding to the Bateman domain mediates the allosteric inhibition of eukaryotic IMP dehydrogenases

    Science.gov (United States)

    Buey, Rubén M.; Ledesma-Amaro, Rodrigo; Velázquez-Campoy, Adrián; Balsera, Mónica; Chagoyen, Mónica; de Pereda, José M.; Revuelta, José L.

    2015-11-01

    Inosine-5'-monophosphate dehydrogenase (IMPDH) plays key roles in purine nucleotide metabolism and cell proliferation. Although IMPDH is a widely studied therapeutic target, there is limited information about its physiological regulation. Using Ashbya gossypii as a model, we describe the molecular mechanism and the structural basis for the allosteric regulation of IMPDH by guanine nucleotides. We report that GTP and GDP bind to the regulatory Bateman domain, inducing octamers with compromised catalytic activity. Our data suggest that eukaryotic and prokaryotic IMPDHs might have developed different regulatory mechanisms, with GTP/GDP inhibiting only eukaryotic IMPDHs. Interestingly, mutations associated with human retinopathies map into the guanine nucleotide-binding sites including a previously undescribed non-canonical site and disrupt allosteric inhibition. Together, our results shed light on the mechanisms of the allosteric regulation of enzymes mediated by Bateman domains and provide a molecular basis for certain retinopathies, opening the door to new therapeutic approaches.

  20. A genetic map of melon (Cucumis melo L.) with RFLP, RAPD, isozyme, disease resistance and morphological markers.

    Science.gov (United States)

    Baudracco-Arnas, S; Pitrat, M

    1996-07-01

    One hundred and ten markers were analysed for linkage in 218 F2 plants derived from two divergent cultivars ('Védrantais' and 'Songwhan Charmi') of Cucumis melo (L.). Thirty-four RFLPs, 64 RAPDs, one isozyme, four disease resistance markers and one morphological marker were used to construct a genetic map spanning 14 linkage groups covering 1390 cM of the melon genome. RAPD and RFLP markers detected similar polymorphism levels. RFLPs were largely due to base substitutions rather than insertion/deletions. Twelve percent of markers showed distorted segregation. Phenotypic markers consisted of two resistance genes against Fusarium wilt (Fom-1 and Fom-2), one gene (nsv) controlling the resistance to melon necrotic spot virus, one gene (Vat) conferring resistance to Aphis gossypii, and a recessive gene for carpel numbers (3 vs 5 carpels: p).

  1. Ocorrência de afídeos causando danos em mangueira (Mangifera indica L., no Vale do São Francisco

    Directory of Open Access Journals (Sweden)

    FERREIRA RACHEL GONÇALVES

    2002-01-01

    Full Text Available Observaram-se em pomares de mangueiras (Mangifera indica L., no semi-árido nordestino, altas infestações de afídeos causando danos às folhas novas e brotações da planta. Diversas amostras foram coletadas, tendo sido identificadas três espécies: Aphis craccivora, Aphis gossypii e Toxoptera aurantii. As duas primeiras espécies estão sendo relatadas pela primeira vez como pragas, em mangueiras, no Brasil. Espécimens de referência encontram-se depositados no Laboratório de Entomologia da Embrapa Semi-Árido, localizada em Petrolina-PE.

  2. Characterization of a new potyvirus causing mosaic and flower variegation in Catharanthus roseus in Brazil

    Directory of Open Access Journals (Sweden)

    Sheila Conceição Maciel

    2011-12-01

    Full Text Available Catharanthus roseus is a perennial, evergreen herb in the family Apocynaceae, which is used as ornamental and for popular medicine to treat a wide assortment of human diseases. This paper describes a new potyvirus found causing mosaic symptom, foliar malformation and flower variegation in C. roseus. Of 28 test-plants inoculated mechanically with this potyvirus, only C. roseus and Nicotiana benthamiana developed systemic mosaic, whereas Chenopodium amaranticolor and C. quinoa exhibited chlorotic local lesions. The virus was transmitted by Aphis gossypii and Myzus nicotianae. When the nucleotide sequence of the CP gene (768nt was compared with other members of the Potyviridae family, the highest identities varied from 67 to 76 %. For the 3' UTR (286nt, identities varied from 16.8 to 28.6 %. The name Catharanthus mosaic virus (CatMV is proposed for this new potyvirus.

  3. A phylogenetic analysis of the sugar porters in hemiascomycetous yeasts.

    Science.gov (United States)

    Palma, Margarida; Goffeau, André; Spencer-Martins, Isabel; Baret, Philippe V

    2007-01-01

    A total of 214 members of the sugar porter (SP) family (TC 2.A.1.1) from eight hemiascomycetous yeasts: Saccharomyces cerevisiae, Candida glabrata, Kluyveromyces lactis, Ashbya (Eremothecium) gossypii, Debaryomyces hansenii, Yarrowia lipolytica, Candida albicans and Pichia stipitis, were identified. The yeast SPs were classified in 13 different phylogenetic clusters. Specific sugar substrates could be allocated to nine phylogenetic clusters, including two novel TC clusters that are specific to fungi, i.e. the glycerol:H(+) symporter (2.A.1.1.38) and the high-affinity glucose transporter (2.A.1.1.39). Four phylogenetic clusters are identified by the preliminary fifth number Z23, Z24, Z25 and Z26 and the substrates of their members remain undetermined. The amplification of the SP clusters across the Hemiascomycetes reflects adaptation to specific carbon and energy sources available in the habitat of each yeast species. (c) 2007 S. Karger AG, Basel.

  4. Predatory behavior of Pseudodorus clavatus (Diptera, Syrphidae on aphids tended by ants

    Directory of Open Access Journals (Sweden)

    Alexandra Bächtold

    2013-12-01

    Full Text Available Predatory behavior of Pseudodorus clavatus (Diptera, Syrphidae on aphids tended by ants. In this study, we examined the interactions between myrmecophilous aphids, their ant-guards and a predatory syrphid species, Pseudodorus clavatus (F.. Larvae of this predator were found in the colonies of three aphid species: Aphis gossypii, A. spiraecola and Toxoptera sp., which were tended by eight ant species, especially Camponotus. Hoverfly larvae managed to infiltrate the aphid colonies and consume nymphs. Predator larvae exhibited inconspicuous movements and were not detected by ants which were commonly observed touching and antennating the larvae they come into contact. These results suggest that behavioral and chemical cues are involved in the infiltration and on the successful predation of syrphids upon aphids.

  5. Occurrence, Distribution and Properties of Alfalfa Mosaic Virus

    Directory of Open Access Journals (Sweden)

    A.D. Zadjaii

    2002-01-01

    Full Text Available Alfalfa Mosaic Virus (AlflMV was recorded on 21 hosts comprising of four field crops, 14 vegetables, one ornamental plant and two new weed species (Heliotropium europaeum and Ammi majus belonging to nine families. The virus was identified and confirmed on the basis of its biological, serological (ELISA and physical properties. The leaves, stem and crown from systemically infected alfalfa plant contained high concentration of the virus. It was nonpersistently transmitted by cotton aphids (Aphis gossypii. The wide host range, including virus reservoirs, seed-borne infection and insect transmission account for high incidence and distribution of AlfMV in the country. The virus isolate had a dilution end point between 1 x 10-3 to l x 10-4, 65-67 °C thermal inactivation point and a few days in-vitro longevity and appears to be similar to the AlfMV-S strain.

  6. The tri-trophic interactions hypothesis: interactive effects of host plant quality, diet breadth and natural enemies on herbivores.

    Directory of Open Access Journals (Sweden)

    Kailen A Mooney

    Full Text Available Several influential hypotheses in plant-herbivore and herbivore-predator interactions consider the interactive effects of plant quality, herbivore diet breadth, and predation on herbivore performance. Yet individually and collectively, these hypotheses fail to address the simultaneous influence of all three factors. Here we review existing hypotheses, and propose the tri-trophic interactions (TTI hypothesis to consolidate and integrate their predictions. The TTI hypothesis predicts that dietary specialist herbivores (as compared to generalists should escape predators and be competitively dominant due to faster growth rates, and that such differences should be greater on low quality (as compared to high quality host plants. To provide a preliminary test of these predictions, we conducted an empirical study comparing the effects of plant (Baccharis salicifolia quality and predators between a specialist (Uroleucon macolai and a generalist (Aphis gossypii aphid herbivore. Consistent with predictions, these three factors interactively determine herbivore performance in ways not addressed by existing hypotheses. Compared to the specialist, the generalist was less fecund, competitively inferior, and more sensitive to low plant quality. Correspondingly, predator effects were contingent upon plant quality only for the generalist. Contrary to predictions, predator effects were weaker for the generalist and on low-quality plants, likely due to density-dependent benefits provided to the generalist by mutualist ants. Because the TTI hypothesis predicts the superior performance of specialists, mutualist ants may be critical to A. gossypii persistence under competition from U. macolai. In summary, the integrative nature of the TTI hypothesis offers novel insight into the determinants of plant-herbivore and herbivore-predator interactions and the coexistence of specialist and generalist herbivores.

  7. Ultrastructure of compatible and incompatible interactions in phloem sieve elements during the stylet penetration by cotton aphids in melon.

    Science.gov (United States)

    Garzo, Elisa; Fernández-Pascual, Mercedes; Morcillo, Cesar; Fereres, Alberto; Gómez-Guillamón, M Luisa; Tjallingii, W Fred

    2017-02-18

    Resistance of the melon line TGR-1551 to the aphid Aphis gossypii is based on preventing aphids from ingesting phloem sap. In electrical penetration graphs (EPGs), this resistance has been characterized with A. gossypii showing unusually long phloem salivation periods (waveform E1) mostly followed by pathway activities (waveform C) or if followed by phloem ingestion (waveform E2), ingestion was not sustained for more than 10 min. Stylectomy with aphids on susceptible and resistant plants was performed during EPG recording while the stylet tips were phloem inserted. This was followed by dissection of the penetrated leaf section, plant tissue fixation, resin embedding, and ultrathin sectioning for transmission electron microscopic observation in order to study the resistance mechanism in the TGR. The most obvious aspect appeared to be the coagulation of phloem proteins inside the stylet canals and the punctured sieve elements. Stylets of 5 aphids per genotype were amputated during sieve element (SE) salivation (E1) and SE ingestion (E2). Cross-sections of stylet bundles in susceptible melon plants showed that the contents of the stylet canals were totally clear and also, no coagulated phloem proteins occurred in their punctured sieve elements. In contrast, electron-dense coagulations were found in both locations in the resistant plants. Due to calcium binding, aphid saliva has been hypothesized to play an essential role in preventing/suppressing such coagulations that cause occlusion of sieves plate and in the food canal of the aphid's stylets. Doubts about this role of E1 salivation are discussed on the basis of our results. © 2017 Institute of Zoology, Chinese Academy of Sciences.

  8. Seasonal phenology and species composition of the aphid fauna in a northern crop production area.

    Directory of Open Access Journals (Sweden)

    Sascha M Kirchner

    Full Text Available BACKGROUND: The species diversity of aphids and seasonal timing of their flight activity can have significant impacts on crop production, as aphid species differ in their ability to transmit plant viruses and flight timing affects virus epidemiology. The aim of the study was to characterise the species composition and phenology of aphid fauna in Finland in one of the northernmost intensive crop production areas of the world (latitude 64°. METHODOLOGY/PRINCIPAL FINDINGS: Flight activity was monitored in four growing seasons (2007-010 using yellow pan traps (YPTs placed in 4-8 seed potato fields and a Rothamsted suction trap. A total of 58,528 winged aphids were obtained, identified to 83 taxa based on morphology, and 34 species were additionally characterised by DNA barcoding. Seasonal flight activity patterns analysed based on YPT catch fell into three main phenology clusters. Monoecious taxa showed early or middle-season flight activity and belonged to species living on shrubs/trees or herbaceous plants, respectively. Heteroecious taxa occurred over the entire potato growing season (ca. 90 days. Abundance of aphids followed a clear 3-year cycle based on suction trap data covering a decade. Rhopalosiphum padi occurring at the end of the potato growing season was the most abundant species. The flight activity of Aphis fabae, the main vector of Potato virus Y in the region, and Aphis gossypii peaked in the beginning of potato growing season. CONCLUSIONS/SIGNIFICANCE: Detailed information was obtained on phenology of a large number aphid species, of which many are agriculturally important pests acting as vectors of plant viruses. Aphis gossypii is known as a pest in greenhouses, but our study shows that it occurs also in the field, even far in the north. The novel information on aphid phenology and ecology has wide implications for prospective pest management, particularly in light of climate change.

  9. Traits underlying community consequences of plant intra-specific diversity.

    Directory of Open Access Journals (Sweden)

    Luis Abdala-Roberts

    Full Text Available A plant's performance and interactions with other trophic levels are recorgnized to be contingent upon plant diversity and underlying associational dynamics, but far less is known about the plant traits driving such phenomena. We manipulated diversity in plant traits using pairs of plant and a substitutive design to elucidate the mechanisms underlying diversity effects operating at a fine spatial scale. Specifically, we measured the effects of diversity in sex (sexual monocultures vs. male and female genotypes together and growth rate (growth rate monocultures vs. fast- and slow-growing genotypes together on growth of the shrub Baccharis salicifolia and on above- and belowground consumers associated with this plant. We compared effects on associate abundance (# associates per plant vs. density (# associates per kg plant biomass to elucidate the mechanisms underlying diversity effects; effects on abundance but not density suggest diversity effects are mediated by resource abundance (i.e. plant biomass alone, whereas effects on density suggest diversity effects are mediated by plant-based heterogeneity or quality. Sexual diversity increased root growth but reduced the density (but not abundance of the dietary generalist aphid Aphis gossypii and its associated aphid-tending ants, suggesting sex mixtures were of lower quality to this herbivore (e.g. via reduced plant quality, and that this effect indirectly influenced ants. Sexual diversity had no effect on the abundance or density of parasitoids attacking A. gossypii, the dietary specialist aphid Uroleucon macolai, or mycorrhizae. In contrast, growth rate diversity did not influence plant growth or any associates except for the dietary specialist aphid U. macolai, which increased in both abundance and density at high diversity, suggesting growth rate mixtures were of higher quality to this herbivore. These results highlight that plant associational and diversity effects on consumers are contingent

  10. Biodiversidad antropoentomofágica de la región de Zongolica, Veracruz, México

    Directory of Open Access Journals (Sweden)

    Julieta Ramos-Elorduy

    2008-03-01

    Full Text Available Durante dos años y medio (2003-2005 se rastrearon a los insectos que se ingieren en el área de Zongolica, Veracruz: para ello se entrevistó a la gente de ese municipio (200, para conocer cuáles especies ingerían. El total de especies registradas, ascendió a 57 distribuidas en los órdenes Orthoptera, Hemiptera, Homoptera, Megaloptera, Coleoptera, Lepidoptera e Hymenoptera, correspondiendo el mayor consumo al primer orden. De las especies registradas, 24 son nuevos registros de insectos comestibles para México. Estos se consumen tanto en estado inmaduro como en estado adulto y generalmente se ingieren asados. Hay una secuenciación estacional en el consumo de las diferentes especies y algunas de ellas (las cucarachas, la cuetla, la cuecla, los chapulines, los toritos, etc. se comercializan en los tianguis (puestos de venta callejeros informales que se realizan un día a la semana en diversos lugares del país o en el día de mercado en Zongolica. Existe el "protococultivo" de tres especies: una cucaracha (Periplaneta australasiae Fabricius y dos mariposas (Latebraria amphipyroides Guenée y Arsenura armida armida Cramer. La antropoentomofagía es un hábito ancestral en Zongolica.Anthropoentomophagic biodiversity of the Zongolica region, Veracruz, Mexico. During two and a half years (2003-2005 we recorded the insect species used as food at Zongolica, Veracruz State, Mexico. Interviews were made among people (200 of this municipality to know which insects they consumed. The total of registered species was 57 (Orthoptera, Hemiptera, Homoptera, Megaloptera, Coleoptera, Lepidoptera and Hymenoptera. The Orthoptera was the most frequently ingested. Twenty-four of these species were new records for edible insects of Mexico. They are eaten in immature stages or as adults, generally only roasted. Consumption is seasonal. Some species are commercialized in the "tianguis" (little town markets and/or in the larger Zongolica market. There is a

  11. Electrical and seismic mixing rules for detecting changes in ground ice content in permafrost studies

    Science.gov (United States)

    Hauck, Christian; Hilbich, Christin

    2017-04-01

    Geophysical methods are now widely used in permafrost research to detect and monitor frozen ground and potentially quantify the ground ice content in the soil. Hereby, often a combination of different methods is used to reduce the ambiguities inherent with the indirect nature of geophysical surveys. Geophysical mixing rules and petrophysical relationships originally developed by exploration industry may help to quantitatively relate geophysical variables such as the electrical resistivity or the seismic P-wave velocity to the physical properties of the subsurface. Two of these mixing rules were combined by Hauck et al. (2011) in a so-called 4-phase model to attempt to quantify the ground ice, air- and water content and their changes with time in permafrost environments (e.g. Pellet et al. 2016). However, these mixing rules are often either empirically derived (making use of a large number of borehole samples) or based on a simplified mixing model, i.e. an equal weighting of each phase component (ice, water, soil/rock, air) depending on the actual fractional content of each phase. There is thus no obvious 'best choice' model from the available geophysical approaches. Stimulated by recent theoretical work by Glover (2010), who analysed the relationships between the empirical and theory-derived mixing models, this contribution aims to analyse the applicability of various mixing models for electrical and seismic data sets in the context of detecting and monitoring permafrost degradation. Input data stem from various geophysical surveys around the world and ground truth data for validation is available from corresponding permafrost boreholes from the PERMOS and GTN-P data bases. Glover, P. W. (2010). A generalized Archie's law for n phases. Geophysics, 75(6), E247-E265. Hauck, C., Böttcher, M. and Maurer, H. (2011): A new model for estimating subsurface ice content based on combined electrical and seismic data sets. The Cryosphere, 5, 453-468. Pellet C., Hilbich C

  12. Combined phylogeny and neighborhood analysis of the evolution of the ABC transporters conferring multiple drug resistance in hemiascomycete yeasts

    Directory of Open Access Journals (Sweden)

    Goffeau André

    2009-10-01

    Full Text Available Abstract Background Pleiotropic Drug Resistant transporters (PDR are members of the ATP-Binding Cassette (ABC subfamily which export antifungals and other xenobiotics in fungi and plants. This subfamily of transmembrane transporters has nine known members in Saccharomyces cerevisiae. We have analyzed the complex evolution of the pleiotropic drug resistance proteins (Pdrp subfamily where gene duplications and deletions occur independently in individual genomes. This study was carried out on 62 Pdrp from nine hemiascomycetous species, seven of which span 6 of the 14 clades of the Saccharomyces complex while the two others species, Debaryomyces hansenii and Yarrowia lipolytica, are further apart from an evolutive point of view. Results Combined phylogenetic and neighborhood analyses enabled us to identify five Pdrp clusters in the Saccharomyces complex. Three of them comprise orthologs of the Pdrp sensu stricto, Pdr5p, Pdr10p, Pdr12p, Pdr15p, Snq2p and YNR070wp. The evolutive pathway of the orthologs of Snq2 and YNR070w is particularly complex due to a tandem gene array in Eremothecium gossypii, Kluyveromyces lactis and Saccharomyces (Lachancea kluyveri. This pathway and different cases of duplications and deletions were clarified by using a neighborhood analysis based on synteny. For the two distant species, Yarrowia lipolytica and Debaryomyces hansenii, no neighborhood evidence is available for these clusters and many homologs of Pdr5 and Pdr15 are phylogenetically assigned to species-based clusters. Two other clusters comprise the orthologs of the sensu lato Pdrp, Aus1p/Pdr11p and YOL075cp respectively. The evolutionary pathway of these clusters is simpler. Nevertheless, orthologs of these genes are missing in some species. Conclusion Numerous duplications were traced among the Hemiascomycetous Pdrp studied. The role of the Whole Genome Duplication (WGD is sorted out and our analyses confirm the common ancestrality of Pdr5p and Pdr15p. A tandem

  13. Combined phylogeny and neighborhood analysis of the evolution of the ABC transporters conferring multiple drug resistance in hemiascomycete yeasts.

    Science.gov (United States)

    Seret, Marie-Line; Diffels, Julie F; Goffeau, André; Baret, Philippe V

    2009-10-01

    Pleiotropic Drug Resistant transporters (PDR) are members of the ATP-Binding Cassette (ABC) subfamily which export antifungals and other xenobiotics in fungi and plants. This subfamily of transmembrane transporters has nine known members in Saccharomyces cerevisiae. We have analyzed the complex evolution of the pleiotropic drug resistance proteins (Pdrp) subfamily where gene duplications and deletions occur independently in individual genomes. This study was carried out on 62 Pdrp from nine hemiascomycetous species, seven of which span 6 of the 14 clades of the Saccharomyces complex while the two others species, Debaryomyces hansenii and Yarrowia lipolytica, are further apart from an evolutive point of view. Combined phylogenetic and neighborhood analyses enabled us to identify five Pdrp clusters in the Saccharomyces complex. Three of them comprise orthologs of the Pdrp sensu stricto, Pdr5p, Pdr10p, Pdr12p, Pdr15p, Snq2p and YNR070wp. The evolutive pathway of the orthologs of Snq2 and YNR070w is particularly complex due to a tandem gene array in Eremothecium gossypii, Kluyveromyces lactis and Saccharomyces (Lachancea) kluyveri. This pathway and different cases of duplications and deletions were clarified by using a neighborhood analysis based on synteny. For the two distant species, Yarrowia lipolytica and Debaryomyces hansenii, no neighborhood evidence is available for these clusters and many homologs of Pdr5 and Pdr15 are phylogenetically assigned to species-based clusters. Two other clusters comprise the orthologs of the sensu lato Pdrp, Aus1p/Pdr11p and YOL075cp respectively. The evolutionary pathway of these clusters is simpler. Nevertheless, orthologs of these genes are missing in some species. Numerous duplications were traced among the Hemiascomycetous Pdrp studied. The role of the Whole Genome Duplication (WGD) is sorted out and our analyses confirm the common ancestrality of Pdr5p and Pdr15p. A tandem gene array is observed in Eremothecium gossypii. One

  14. Rizobactérias no controle da mancha angular do algodoeiro Rhizobacteria to control cotton bacterial blight

    Directory of Open Access Journals (Sweden)

    Alessandra Keiko Nakasone Ishida

    2008-02-01

    Full Text Available Avaliou-se o potencial de rizobactérias na indução de resistência do algodoeiro à Xanthomonas axonopodis pv. malvacearum. Após o isolamento das rizobactérias, foram selecionados os isolados capazes de reduzir os sintomas da mancha angular bacteriana em casa de vegetação, os quais foram aplicados espacialmente separados do patógeno desafiador. Os melhores isolados foram testados quanto à capacidade de reduzir os sintomas da ramulose e da murcha de Verticillium e de inibir diretamente os patógenos in vitro. Do total de 123 isolados de rizobactérias foram selecionados cinco, L2-1 (Bacillus cereus, MT5-6 (Bacillus cereus, L2-2 (Achromobacter xylosoxidans, MT5-5 (Bacillus cereus e MT5-11 (Brevibacterium sp., os quais apresentaram controle da mancha angular acima de 40%, em relação à testemunha. Nenhum isolado reduziu a severidade da ramulose e da murcha de Verticillium em relação à testemunha, nem apresentou efeito inibitório direto in vitro a X. axonopodis pv. malvacearum e Colletotrichum gossypii var. cephalosporioides. Para V. dahliae, apenas o isolado L2-1 apresentou efeito inibitório.The potential of rhizobacteria was evaluated for resistance induction against Xanthomonas axonopodis pv. malvacearum. After isolation, the rhizobacteria were screened for the reduction of angular leaf spot severity under greenhouse conditions. They were spatially separated from the challenging pathogen. The best isolates were tested for the capacity to reduce ramulose and Verticillium wilt severity and directly inhibit pathogens in vitro. From a total of 123 rhizobacterial isolates, five were selected, L2-1 (Bacillus cereus, MT5-6 (Bacillus cereus, L2-2 (Achromobacter xylosoxidans, MT5-5 (Bacillus cereus and MT5-11 (Brevibacterium sp., which showed angular leaf spot control above 40% as compared to the control. The tested isolates neither reduced the severity of ramulose and verticillium wilt compared to the control nor showed in vitro direct

  15. The effect of insecticide applications to melon crop on melon aphid and its natural enemies

    International Nuclear Information System (INIS)

    Guerra, J.; Gonzalez, J.E.; Ceballos, J.; Checa, B.

    1999-01-01

    Melons are an important export crop for Panama and are cultivated on more than 1000 ha of land. Long growing season, extending well into January, allows several generations and build up of heavy populations of an important insect pest, Aphis gossypii, the melon aphid. Growers find it difficult to cultivate melons without several applications of insecticides. Although the insecticide applications control the aphids, they may also have adverse effects on the natural enemies of the aphid, in particular the two predatory insects Cycloneda sanguinea and Chrysoperla carnea. The purpose of this research was to evaluate the impact of insecticide applications on these insects and on the yield of melons, and to estimate residues of the applied insecticides in soil. The insecticides were applied as four different type of treatments to melon crop. The treatments were (i) three periodic applications of endosulfan (Thiodan 35EC), each at 0.52 kg a.i./ha, (ii) three applications of fenitrothion (Sumithion 50WP), each at 0.35 kg a.i./ha, (iii) two applications of fenitrothion and one of endosulfan, and (iv) grower's treatment, which included applications of six different insecticides. The effect of the insecticide applications was evaluated by estimating numbers of each of the three type of insects before and within 72 hours after the applications and estimating yield of melons. All insecticide treatments reduced the populations of Aphis gossypii, but they also reduced the numbers of the benificial insects. Endosulfan was somewhat less toxic to C. carnea than the other insecticides were, since greater number of C. carnea were recorded from the plots treated with endosulfan than the other treated plots. The best yield of melons was recorded in the plots which were sprayed with fenitrothion, followed by the plots sprayed with endosulfan. and then those with grower's insecticides. Soon after the application of endosulfan the residue in the soil was 0.2 mg/kg, but it declined to less

  16. Mutualisme pucerons – fourmis : étude des bénéfices retirés par les colonies d'Aphis fabae en milieu extérieur

    Directory of Open Access Journals (Sweden)

    Verheggen F.

    2009-01-01

    Full Text Available Aphid – ant mutualism: an outdoor study of the benefits for Aphis fabae. Aphid – ant relationships are common examples of mutualism. Aphids are indeed submitted to predation and therefore require protection, while ants are continuously looking for new sugar sources. The present work aimed to study the benefits that a mutualistic relationship with Lasius niger (Hymenoptera, Formicidae could bring to the black bean aphid Aphis fabae (Homoptera, Aphididae. Several parameters were observed in the field, on broad bean plants infested with an initial amount of 100 A. fabae and in presence or not of a L. niger colony. More aphids were observed on plants being visited by ants as well as a higher proportion of winged individuals. One explanation is that fewer predators were observed on plants being visited by ants, demonstrating their protective role. However, the number of parasitized aphids was not reduced in presence of L. niger. On the other hand, fewer different aphid species were present on plants foraged by ants, what suggests that they could exert a predation on unattended aphids. Our observations do not allow to conclude on any impact of L. niger on the fitness of the aphid host plant, although fewer exuvia and honeydew spots were observed when they were present. All these results confirm that L. niger increase the fitness of A. fabae colonies mainly by decreasing the number of predators and by reducing competition from aphid species unattended by ants.

  17. Molecular and Insecticidal Characterization of a Novel Cry-Related Protein from Bacillus Thuringiensis Toxic against Myzus persicae

    Science.gov (United States)

    Palma, Leopoldo; Muñoz, Delia; Berry, Colin; Murillo, Jesús; Ruiz de Escudero, Iñigo; Caballero, Primitivo

    2014-01-01

    This study describes the insecticidal activity of a novel Bacillus thuringiensis Cry-related protein with a deduced 799 amino acid sequence (~89 kDa) and ~19% pairwise identity to the 95-kDa-aphidicidal protein (sequence number 204) from patent US 8318900 and ~40% pairwise identity to the cancer cell killing Cry proteins (parasporins Cry41Ab1 and Cry41Aa1), respectively. This novel Cry-related protein contained the five conserved amino acid blocks and the three conserved domains commonly found in 3-domain Cry proteins. The protein exhibited toxic activity against the green peach aphid, Myzus persicae (Sulzer) (Homoptera: Aphididae) with the lowest mean lethal concentration (LC50 = 32.7 μg/mL) reported to date for a given Cry protein and this insect species, whereas it had no lethal toxicity against the Lepidoptera of the family Noctuidae Helicoverpa armigera (Hübner), Mamestra brassicae (L.), Spodoptera exigua (Hübner), S. frugiperda (J.E. Smith) and S. littoralis (Boisduval), at concentrations as high as ~3.5 μg/cm2. This novel Cry-related protein may become a promising environmentally friendly tool for the biological control of M. persicae and possibly also for other sap sucking insect pests. PMID:25384108

  18. ON THE PALEOFAUNA INVERTEBRATES (MOLLUSCA, ARTROPODA; INSECTA OF DIATOMITE DEPOSITS OF SHAMB–1 LOCALITY (SISIAN SUITE, EARLY PLEISTOCENE, ARMENIA

    Directory of Open Access Journals (Sweden)

    М. A. Маrjanyan

    2016-01-01

    Full Text Available Aim. The study of fossil insects from diatomaceous sediments of Shamb-1 locality of Sisian Suite (Early Pleistocene. The collection of fossils plants and animals of Institute of Botany of NAS RA and authors' findings served as material for study.Methods. The material is processed and prepared for study by conventional methods in paleontology for prints and fossils of insects from diatomaceous sediments. There are 654 samples studied: 2 samples were with mollusks’ imprints and 652 samples with imprints of insects, from which preserved marks on 291samples allowed to identify them up to order, family, genus and species.Results. The studied material refers to the Mollusca and Arthropoda (Insecta types. Insects are represented by species of orders Orthoptera (2 fam., Homoptera (1 fam., Heteroptera (2 fam., Coleoptera (15 fam., Hymenoptera (2 fam., Diptera (1 fam.. Coleopteras dominate among them and are presented with following species of the family – Carabidae, Dytiscidae, Hydrophilidae, Histeridae, Staphylinidae, Silphidae, Elateridae, Buprestidae, Lampyridae, Scarabaeidae, Chrysomelidae, Tenebrionidae, Coccinellidae, Cerambycidae, Curculionidae.Main conclusions. An analysis of the taxonomic composition of paleofauna was done, which corresponds to the recent fauna and with considering modern ecological characteristics of systematical groups and species. In the investigated location of Shamb-1 a version is suggested about the palaeolandscapes and palaeoclimate in the Early Pleistocene.

  19. Doppler radar detection of exceptional mass-migration of aphids into Finland

    Science.gov (United States)

    Nieminen, M.; Leskinen, Matti; Helenius, Juha

    Our objective was to detect mass migrations of insects of economic significance by insect traps and a Doppler weather radar. Migrants were sampled by suction traps, tow nets and light traps in the Helsinki region. We used radar to observe the migrating insects, and trajectories to backtrack mass migrations of aphids (Homoptera, Aphididae) in spring 1988. The aphid migrations were clearly observed in trap catches and by radar. The first migration, mainly involving Euceraphis betulae, occurred on 18 May and was tracked back to northern Poland. The second migration, mainly of Rhopalosiphum padi (a serious pest of small-grain cereals), occurred 3 days later and was tracked back to a large area covering Latvia and western Russia south of St Petersburg. The third migration included both E. betulae and R. padi, and took place on 30 May. It originated from Estonia. Neither trap nor radar data provide exact quantitative information on migrations. Trapping efficiency depends strongly on wind speed and insect size. Radar echo intensity is very strongly related to the sizes of insects in the large volume of air measured, and the sizes are not known accurately. Weather data, especially temperature, can be used in predicting the development of aphids, and air-parcel trajectories in estimating the source areas of migrants. These methods for forecasting aphid migrations, combined with radar observations, are useful for warning purposes and to intensify insect trapping. This would contribute to more efficient agricultural pest management.

  20. Weed host specificity of the aphid, Aphis spiraecola: developmental and reproductive performance of aphids in relation to plant growth and leaf chemicals of the Siam weed, Chromolaena odorata.

    Science.gov (United States)

    Agarwala, B K; Das, Jhuma

    2012-01-01

    Density, distribution, and nutritional quality of plants are the causal basis of host plant selection in aphids. Nutritional qualities of a plant vary according to its growth stage and also in response to seasonal variation. How host plant growth stages shape aphid performance was studied in Aphis spiraecola Patch (Homoptera: Aphididae) on the perennial Siam weed, Chromolaena odorata (L.) King and Robinson (Asterales: Asteraceae). This plant species is the preferred host in the hot and humid tropical parts of northeast and southern India. Variations in developmental and reproductive performances in apterous viviparous female aphids were recorded in relation to differences in leaf chemicals in different growth stages of C. odorata. Aphids reproduced at higher rates in the vegetative stage of C. odorata when developmental time was shortest, and fecundity was higher in a longer reproductive time. Intrinsic rate of increase and net reproductive rate were also recorded to be higher in the vegetative stage of the weed host. In the vegetative stage, leaves contained higher quantity of proteins and nitrogen, which are vital for insect reproduction. Results of this study have demonstrated that A spiraecola showed synchronization of its developmental and reproductive performances to growth stages of C. odorata, which occur in high abundance in the study area.

  1. Entomofauna associated to horticultural crops under organic and conventional practices in Cordoba, Argentina; Entomofauna asociada a cultivos horticolas organicos y convencionales en Cordoba, Argentina

    Energy Technology Data Exchange (ETDEWEB)

    Zalazar, Laura; Salvo, Adriana [Universidade Nacional de Cordoba (Argentina). Facultad de Ciencias Exactas Fisicas y Naturales. Centro de Investigaciones Entomologicas de Cordoba (CIEC)

    2007-09-15

    Farming practices and the addition of chemical synthetic substances in conventional agroecosystems are detrimental mainly to natural enemies of phytophagous insects, diminishing the natural regulation of pest insects. On the other hand, in organic agriculture, biological processes and care of the environment are favoured, hence an increase in insect biodiversity is predicted in this type of systems. In this work, abundance, richness of insects and proportion of functional groups were compared through a single quantitative sampling of insects in horticultural crop fields, three under organic and three under conventional management practices. Insect species richness, total and for guilds (phytophagous and entomophagous insects) were significantly higher in organic orchards, and also was the abundance of entomophagous insects. Richness and abundance of all insect orders (with exception of Homoptera abundance), were higher in orchards under organic management, being significant the differences for richness of Coleoptera and richness and abundance of Hymenoptera. Similar tendencies were observed in data obtained through sweep net in weeds. These results suggest that organic practices increase the diversity of species, particularly that of natural enemies. (author)

  2. ECOLOGICAL MANAGEMENT SYSTEM FOR PROTECTION AND PRODUCTION OF BLACKCURRANT (RIBES NIGRUM L. IN SOUTH OF ROMANIA (I

    Directory of Open Access Journals (Sweden)

    Irina IONESCU-MĂLĂNCUŞ

    2013-12-01

    Full Text Available The formulation of agricultural policies in Romania, starting with the European ones will lead to the development of sustainable agriculture, which will take into account the environmental component, but also the protection of consumers. Creating a sustainable agriculture may not be a feasible approach without an interdisciplinary contribution, firstly without implementation of biotechnology to reduce the impact of disruptive and command for the removal of certain risk factors that may be present in certain points of the food chain. The activities undertaken in the framework of the study achieved the overall goal: to present the pilot-phase of agricultural technology to the culture of Ribes nigrum, with the goal of obtaining and use of plant biomass in the pharmaceutical and food industries in line with EU criteria relating to food safety and security. The methodology developed in the framework of the theme was particularly complex but can be synthesized according to the objectives pursued, the life cycle of a case study in populations and of the factors involved in developing ecological management for control in working methods for biological field studies (life cycle study methods and control of the main pest Aphis grossulariae Sulz. (Homoptera:Aphididae and the main pathogenic fungus Mycosphaerella grossulariae (Auers. Lind. The main results obtained from research carried out refer to the implementing of the ecological management system model.

  3. Dietary analysis of Homonota darwini (Squamata: Gekkoni-dae in Northern Patagonia

    Directory of Open Access Journals (Sweden)

    Marcelo E. KUN, Carla PIANTONI, John D. KRENZ, Nora R. IBARGÜENGOYTÍA

    2010-08-01

    Full Text Available Our study investigated the diet of the southernmost gecko in the world, Homonota darwini. Fifty-three specimens were captured during spring and summer in four locations in Patagonia, Argentina. The stomach contents of the specimens were identified, and we found that prey consisted of six main groups: Coleoptera, Hymenoptera, Homoptera and Araneae, and the adults and larvae of moth Lepidoptera. Lepidoptera was the major dietary component. The presence of ants and moths as common prey suggests an ambush feeding strategy. In spring, females consumed more ants than males although no other dietary differences between males and females were evident. We found nine geckos with empty stomachs and six parasitized by nematodes. Presence of empty stomachs corroborates previous observations of other nocturnal geckos and non-gecko lizards. Reduced foraging success of nocturnal lizards could be due to difficulty in prey detection due to dim light, reduced or erratic activity of insect prey at night, or shorter activity times of geckos relative to diurnal success. Sex and season were not associated with the incidence of empty stomachs. Principal component analysis showed that four food alternatives correlated with season. The constraint of nocturnality, coupled with low night-time temperatures restricting feeding to only a few hours after sunset, appear to have caused a generality of diet which may limit energy acquisition. We conclude that H. darwini is an arthropod generalist and likely an ambush forager, as are many other nocturnal gekkonids [Current Zoology 56 (4: 406–410, 2010].

  4. Food habits of the southwestern willow flycatcher during the nesting season

    Science.gov (United States)

    Drost, Charles A.; Paxton, Eben H.; Sogge, Mark K.; Whitfield, Mary J.

    2003-01-01

    The food habits and prey base of the endangered Southwestern Willow Flycatcher (Empidonax traillii extimus) are not well known. We analyzed prey remains in 59 fecal samples from an intensively-studied population of this flycatcher at the Kern River Preserve in southern California. These samples were collected during the nesting season in 1996 and 1997 from adults caught in mist nets, and from nestlings temporarily removed from the nest for banding. A total of 379 prey individuals were identified in the samples. Dominant prey taxa, both in total numbers and in percent occurrence, were true bugs (Hemiptera), flies (Diptera), and beetles (Coleoptera). Leafhoppers (Homoptera: Cicadellidae), spiders (Araneae), bees and wasps (Hymenoptera), and dragonflies and damselflies (Odonata) were also common items. Diet composition was significantly different between years, due to a large difference in the numbers of spiders between 1996 and 1997. There was also a significant difference between the diet of young and adults, with the diet of young birds having significantly higher numbers of odonates and beetles. There was a trend toward diet differences between males and females, but this was not significant at the P = 0.05 level.

  5. Temporal and spatial changes in the diet of Hyla pulchella (Anura, Hylidae in southern Uruguay

    Directory of Open Access Journals (Sweden)

    Inés da Rosa

    2004-12-01

    Full Text Available In this article we report the diet of a population of the hylid frogHyla pulchella from southeastern Uruguay. We collected the specimens in ponds, where we identified microenvironments defined by the invertebrate assemblage, during one year divided into two seasons (warm and cold. We taxonomically determined 10365 invertebrates belonging to 21 categories in the digestive tracts of frogs. Weestimated the diversity of the diet and alimentary preference according to microenvironments and seasons. We estimated the expected richness of both diet and prey availability using a null model based on the hypergeometric distribution. We performed Discriminant Analyses and Kruskal-Wallis tests to detect changes in prey availability among microenvironments and between seasons. The overall diet in terms of frequencies was composed primarily of arthropods (mainly Araneae, Diptera, Hymenoptera, and Coleoptera and in terms of volume, by larvae. The most relevantitems to study the microenvironmental and seasonal variation in the available preys were Araneae, Collembola, Homoptera, Hymenoptera, Diptera, Dictioptera, Lepidoptera, Coleoptera, and larvae. Based on the null model curves and preference indexes we inferred positive selection by larvae, Isopoda, Dictioptera, Lepidoptera, and Diptera, and negative selection by Collembola and Hymenoptera. The diversityof diet and the null model curves indicated that the diet changes among microenvironments and seasons. This frog may be considered as a middle generalist predator, with some selective behavior and a combined search strategy (active and sit-and-wait. We conclude that the knowledge about the availability of preys is a relevant tool for trophic studies.

  6. ÍNDICE DE DIVERSIDADE PARA ENTOMOFAUNA DA BRACATINGA (Mimosa scabrella Benth.

    Directory of Open Access Journals (Sweden)

    Liliana D. de Medina

    1993-12-01

    Full Text Available No período de abril de 1983 a setembro de 1984, efetuou-se o levantamento da entomofauna da bracatinga, em Almirante Tamandaré, PR. Os levantamentos foram efetuados quinzenalmente em copas de talhões com 8, 42 e 60 meses de idade, através da rede de copa e, de seus respectivos sub-bosques com rede de varredura. Para o cálculo do índice de diversidade utilizou-se a fórmula alfa = (S-1/log N. Para a tabulação dos dados, optou-se pelas ordens Homoptera, Hemíptera e Coleóptera que apresentaram maior consistência quali-quantitativa. De acordo com os resultados obtidos ficou evidenciado que com o aumento da idade da planta e de seu respectivo sub-bosque ocorre um aumento concomitante e gradativo da diversidade das espécies. Com relação aos dois ecossistemas estudados o sub-bosque apresentou um valor maior para o índice de diversidade e no que se refere a diversidade das espécies entre famílias, separadamente, Chrysomelidae destacou-se com o mais alto índice para o ecossistema formado pelas copas e, entre os diferentes sub-bosques destacou-se a família Curculionidae.

  7. Comparison of seed yielding performance of deltamethrin unprotected and protected plants of five cowpea cultivars at Foumbot, Cameroon

    Directory of Open Access Journals (Sweden)

    Parh, LA.

    1991-01-01

    Full Text Available Losses in seed yields due to damage by seed insect pests were studied on unsprayed and sprayed cowpea plants at Foumbot, located in the western highland savanna zone of Cameroon, in 1988 and 1989. Major pests recorded in the study site were Melanagromyza vignalis Spencer (Diptera : Agromyzidae, Marucatestulalis Geyer (Lepidoptera : Pyralidae, Cydia ptychora Meyrick (Lepidoptera : Tortricidae, Heliothis armigera Hubner (Lepidoptera : Noctuidae, Aphis craccivora Koch (Homoptera : Aphididae, Apion species (Coleoptera : Curculionidae, Coreid bugs (Heteroptera : Coreidae, and Bruchids (Coleoptera : Bruchidae. Yields of undamaged cowpea seeds from unsprayed and sprayed plants of local cultivars acquired from Badun, Melong, Foumbot and Befang were comparable with those from MA 2/1, an improved cultivar from the International Institute for Tropical Agriculture that has been released in Cameroon by the Institute for Agronomie Research. Melanagromyza, Maruca and Coreid bugs caused 70-80 % of seed damage on unsprayed and sprayed plants. Fortnightly spraying of plants with deltamethrin at 12.5g. a. i./ha, significantly reduced yield loss due to damage by Maruca sp., the overall loss in seed yields/ha and % loss of potential seed yield, in all five cowpea cultivars used in this study. However, deltamethrin appeared ineffective in reducing seed yield loss caused by Melanagromyza and Coreid bugs.

  8. Use of biorational for the vegetable pest control in the north of Sinaloa

    Directory of Open Access Journals (Sweden)

    María Berenice González Maldonado

    2012-09-01

    Full Text Available In Sinaloa the vegetable and cucurbits production are important agricultural activities, so each year a high volume of chemicalinsecticides are applied to pest control that attack these crops. This paper present the main pests insects in the region, as wellas an analysis about effects of biorational insecticides on these pests. Was found that for control of Bemisia argentifolii Bellows & Perring (Hemiptera: Aleyrodidae is used Neem oil 0.2%., for kill nymphs of Bactericera cockerelli Sulc. (Homoptera: Psyllidae soursop Annona muricata L. (Annonales: Annonaceae at doses of 2500-5000 mg/L., for Liriomyza trifolii Burgess (Diptera: Agromyzidae neem seeds 2%., to Myzus persicae Sulzer (Hemiptera: Aphididae rapeseed oil at doses 920 g/L (2% v/v., to Frankliniella occidentalis Pergande (Thysanoptera: Thripidae spinosad (Conserve® 48-60 mg/L., and for Phthorimaea operculella Zeller (Lepidoptera: Gelechiidae granular viruses (105 OBs/mL combined with neem (DalNeem TM emulsifiable oil and NeemAzal TM -T/S at doses of 8 mg/L, everyone. The use of these products and the dose depends on the type of pest and crop. In general these products cause insect mortality greater than 95%, besides having low toxicity on natural enemies, so that these can be used individually or in combination in integrated pest control schemes against vegetable pests, and also for disease vectors insects in the northern of Sinaloa.

  9. Búsqueda y reconocimiento de los enemigos naturales y hospedantes alternos de las principales plagas. En flores bajo invernadero en la sabana de Bogotá

    Directory of Open Access Journals (Sweden)

    Martha E. Andrade

    1989-01-01

    Full Text Available Las plagas que atacan cultivos de llores bajo invernadero son cada vez más importantes por la gravedad de su daño y por la alta densidad con que suelen presentarse. Para su control se ha acudido principalmente a la utilización de productos químicos, lo cual conduce a un aumento en los costos de producción, a contaminar el medio ambiente, a afectar la salud humana y a crear resistencia de los insectos a los insecticidas. Debido a esto, es necesario incluír dentro de los programas de control a los reguladores naturales de las plagas: parasitoides, depredadores y microorganismos entornógenos. En el presente trabajo se registran los enemigos naturales más importantes de las principales plagas en llores bajo invernadero (crisantemo, rosa y clavel: Liriomyza huidobrensis Blanchard, L. trifolii Burgess (Diptera: Agrornyzídae; Myzuz persicae Sulzer (Homoptera: Aphididae; Tetranychus urticae Koch y T. cinnabarinus Boísduval (Acarina: Tetranychidae; también se señalan las plantas hospedantes alternas presentes en las localidades donde se realizó la investigación.

  10. Are cicadas (Diceroprocta apache) both a "keystone" and a "critical-link" species in lower Colorado River riparian communities?

    Science.gov (United States)

    Andersen, Douglas C.

    1994-01-01

    Apache cicada (Homoptera: Cicadidae: Diceroprocta apache Davis) densities were estimated to be 10 individuals/m2 within a closed-canopy stand of Fremont cottonwood (Populus fremontii) and Goodding willow (Salix gooddingii) in a revegetated site adjacent to the Colorado River near Parker, Arizona. Coupled with data drawn from the literature, I estimate that up to 1.3 cm (13 1/m2) of water may be added to the upper soil layers annually through the feeding activities of cicada nymphs. This is equivalent to 12% of the annual precipitation received in the study area. Apache cicadas may have significant effects on ecosystem functioning via effects on water transport and thus act as a critical-link species in this southwest desert riverine ecosystem. Cicadas emerged later within the cottonwood-willow stand than in relatively open saltcedar-mesquite stands; this difference in temporal dynamics would affect their availability to several insectivorous bird species and may help explain the birds' recent declines. Resource managers in this region should be sensitive to the multiple and strong effects that Apache cicadas may have on ecosystem structure and functioning.

  11. Predation of the Peach Aphid Myzus persicae by the mirid Predator Macrolophus pygmaeus on Sweet Peppers: Effect of Prey and Predator Density

    Directory of Open Access Journals (Sweden)

    Lara De Backer

    2015-06-01

    Full Text Available Integrated Pest Management strategies are widely implemented in sweet peppers. Aphid biological control on sweet pepers includes curative applications of parasitoids and generalist predators, but with limited efficiency. Macrolophus pygmaeus is a zoophytophagous predator which has been reported to predate on aphids, but has traditionally been used to control other pests, including whiteflies. In this work, we evaluate the effectiveness of M. pygmaeus in controlling Myzus persicae (Homoptera: Aphididae by testing different combinations of aphid and predator densities in cage-experiments under greenhouse conditions. The impact of the presence of an alternative factitious prey (E. kuehniella eggs was also investigated. Macrolophus pygmaeus, at densities of four individuals/plant, caused rapid decline of newly established aphid populations. When aphid infestations were heavy, the mirid bug reduced the aphid numbers but did not fully eradicate aphid populations. The availability of a factitious prey did not influence M. pygmaeus predation on aphids. Based on our data, preventive application of M. pygmaeus, along with a supplementary food source , is recommended to control early infestations of aphids.

  12. Anagrus breviphragma Soyka Short Distance Search Stimuli

    Directory of Open Access Journals (Sweden)

    Elisabetta Chiappini

    2015-01-01

    Full Text Available Anagrus breviphragma Soyka (Hymenoptera: Mymaridae successfully parasitises eggs of Cicadella viridis (L. (Homoptera: Cicadellidae, embedded in vegetal tissues, suggesting the idea of possible chemical and physical cues, revealing the eggs presence. In this research, three treatments were considered in order to establish which types of cue are involved: eggs extracted from leaf, used as a control, eggs extracted from leaf and cleaned in water and ethanol, used to evaluate the presence of chemicals soluble in polar solvents, and eggs extracted from leaf and covered with Parafilm (M, used to avoid physical stimuli due to the bump on the leaf surface. The results show that eggs covered with Parafilm present a higher number of parasitised eggs and a lower probing starting time with respect to eggs washed with polar solvents or eggs extracted and untreated, both when the treatments were singly tested or when offered in sequence, independently of the treatment position. These results suggest that the exploited stimuli are not physical due to the bump but chemicals that can spread in the Parafilm, circulating the signal on the whole surface, and that the stimuli that elicit probing and oviposition are not subjected to learning.

  13. Molecular and Insecticidal Characterization of a Novel Cry-Related Protein from Bacillus Thuringiensis Toxic against Myzus persicae

    Directory of Open Access Journals (Sweden)

    Leopoldo Palma

    2014-11-01

    Full Text Available This study describes the insecticidal activity of a novel Bacillus thuringiensis Cry-related protein with a deduced 799 amino acid sequence (~89 kDa and ~19% pairwise identity to the 95-kDa-aphidicidal protein (sequence number 204 from patent US 8318900 and ~40% pairwise identity to the cancer cell killing Cry proteins (parasporins Cry41Ab1 and Cry41Aa1, respectively. This novel Cry-related protein contained the five conserved amino acid blocks and the three conserved domains commonly found in 3-domain Cry proteins. The protein exhibited toxic activity against the green peach aphid, Myzus persicae (Sulzer (Homoptera: Aphididae with the lowest mean lethal concentration (LC50 = 32.7 μg/mL reported to date for a given Cry protein and this insect species, whereas it had no lethal toxicity against the Lepidoptera of the family Noctuidae Helicoverpa armigera (Hübner, Mamestra brassicae (L., Spodoptera exigua (Hübner, S. frugiperda (J.E. Smith and S. littoralis (Boisduval, at concentrations as high as ~3.5 μg/cm2. This novel Cry-related protein may become a promising environmentally friendly tool for the biological control of M. persicae and possibly also for other sap sucking insect pests.

  14. Predatory potential of Chrysoperla carnea and Cryptolaemus montrouzieri larvae on different stages of the mealybug, Phenacoccus solenopsis: a threat to cotton in South Asia.

    Science.gov (United States)

    Khan, Hafiz Azhar Ali; Sayyed, Ali H; Akram, Waseem; Raza, Sabtain; Ali, Muhammad

    2012-01-01

    The outbreaks of mealybug, Phenacoccus solenopsis Tinsley (Homoptera: Pseudococcidae), have created problems to cotton crops in South Asia in the recent years. To control this menace, predatory potential of Chrysoperla carnea and Cryptolaemus montrouzieri larvae were investigated under laboratory conditions (27 ± 5° C and 65 ± 5% RH). The experiments were conducted in no choice (only first, second, or third instar larvae of mealybug were offered at a time) and choice (first, second, and third instar larvae were offered simultaneously) feeding tests. Both predators had high consumption rates, with C. montrouzeiri being the most voracious feeder. In the no choice feeding tests, third instar larvae of C. montrouzeiri devoured the highest mean number of first instar P. solenopsis (439.38) In the choice feeding tests, a similar number of first instar nymphs (410) were consumed. In both feeding tests, C. carnea devoured relatively fewer numbers of P. solenopsis than C. montrouzeiri. Manly's preference index suggested that the both predators preferred first instar nymphs of P. solenopsis over second or third instar nymphs. Furthermore, studies on developmental rate and fecundity revealed that first instar nymphs of P. solenopsis significantly reduced development time but increased the fecundity of both predators.

  15. Biological control of citrus mealybug, Planococcus citri (Risso) using coccinellid predator, Cryptolaemus montrouzieri Muls.

    Science.gov (United States)

    Afifi, Amal I; El Arnaouty, Said A; Attia, Angel R; Abd Alla, Asmaa El-Metwally

    2010-03-01

    The coccinellid predator, Cryptolaemus montrouzieri Mulsant (Coleoptera: Coccinellidae) was used to control the citrus mealybug, Planococcus citri (Risso) (Homoptera: Pseudococcidae) on the croton ornamental shrubs, Codiaeum variegatum L. at Giza governorate, Egypt. Cryptolaemus montrouzieri Mulsant, 50 adults/Croton shrub, were released once on October 27, 2008 in the open field. Obtained results indicated that percentages of reduction among the egg masses, nymphs and adults of P. citri, one month after releasing the predator reached to 41.5, 42.3 and 57.5%, respectively. Two months later, the corresponding rates were 80.6, 86.5 and 91.5%. Finally, after three months of releasing the predator, reduction rates reached to 100% for all stages of the pest. The associated natural enemies in the field were consisted of three predaceous insects and one parasitic species. The insect predators secured were the hemerobiid predator, Sympherobius amicus Navas; the coccinellid predator, Scymnus syriacus (Mars.) and the chrysopid predator, Chrysoperla carnea (Stephens). The parasitic species was the encyrtid, Coccidoxenoides peregrinus (Timberlake). The aforementioned natural enemies were found feeding on the citrus mealybug, Planococcus citri infesting croton shrubs. In the second season, 2009 there is no mealybug, P. citri individuals were found on the croton shrubs.

  16. Spatial succession modeling of biological communities: a multi-model approach.

    Science.gov (United States)

    Zhang, WenJun; Wei, Wu

    2009-11-01

    Strong spatial correlation may exist in the spatial succession of biological communities, and the spatial succession can be mathematically described. It was confirmed by our study on spatial succession of both plant and arthropod communities along a linear transect of natural grassland. Both auto-correlation and cross-correlation analyses revealed that the succession of plant and arthropod communities exhibited a significant spatial correlation, and the spatial correlation for plant community succession was stronger than arthropod community succession. Theoretically it should be reasonable to infer a site's community composition from the last site in the linear transect. An artificial neural network for state space modeling (ANNSSM) was developed in present study. An algorithm (i.e., Importance Detection Method (IDM)) for determining the relative importance of input variables was proposed. The relative importance for plant families Gramineae, Compositae and Leguminosae, and arthropod orders Homoptera, Diptera and Orthoptera, were detected and analyzed using IDM. ANNSSM performed better than multivariate linear regression and ordinary differential equation, while ordinary differential equation exhibited the worst performance in the simulation and prediction of spatial succession of biological communities. A state transition probability model (STPM) was proposed to simulate the state transition process of biological communities. STPM performed better than multinomial logistic regression in the state transition modeling. We suggested a novel multi-model framework, i.e., the joint use of ANNSSM and STPM, to predict the spatial succession of biological communities. In this framework, ANNSSM and STPM can be separately used to simulate the continuous and discrete dynamics.

  17. Aphid wing induction and ecological costs of alarm pheromone emission under field conditions.

    Directory of Open Access Journals (Sweden)

    Eduardo Hatano

    2010-06-01

    Full Text Available The pea aphid, Acyrthosiphon pisum Harris, (Homoptera: Aphididae releases the volatile sesquiterpene (E-beta-farnesene (EBF when attacked by a predator, triggering escape responses in the aphid colony. Recently, it was shown that this alarm pheromone also mediates the production of the winged dispersal morph under laboratory conditions. The present work tested the wing-inducing effect of EBF under field conditions. Aphid colonies were exposed to two treatments (control and EBF and tested in two different environmental conditions (field and laboratory. As in previous experiments aphids produced higher proportion of winged morphs among their offspring when exposed to EBF in the laboratory but even under field conditions the proportion of winged offspring was higher after EBF application (6.84+/-0.98% compared to the hexane control (1.54+/-0.25%. In the field, the proportion of adult aphids found on the plant at the end of the experiment was lower in the EBF treatment (58.1+/-5.5% than in the control (66.9+/-4.6%, in contrast to the climate chamber test where the numbers of adult aphids found on the plant at the end of the experiment were, in both treatments, similar to the numbers put on the plant initially. Our results show that the role of EBF in aphid wing induction is also apparent under field conditions and they may indicate a potential cost of EBF emission. They also emphasize the importance of investigating the ecological role of induced defences under field conditions.

  18. Comparison of the ionizing radiation effects on cochineal, annatto and turmeric natural dyes

    International Nuclear Information System (INIS)

    Cosentino, Helio M.; Takinami, Patricia Y.I.; Mastro, Nelida L. del

    2016-01-01

    As studies on radiation stability of food dyes are scarce, commercially important natural food grade dyes were evaluated in terms of their sensitivity against gamma ionizing radiation. Cochineal, annatto and turmeric dyes with suitable concentrations were subjected to increasing doses up to 32 kGy and analyzed by spectrophotometry and capillary electrophoresis. The results showed different pattern of absorbance versus absorbed dose for the three systems. Carmine, the glucosidal coloring matter from the scale insect Coccus cacti L., Homoptera (cochineal) remained almost unaffected by radiation up to doses of about 32 kGy (absorbance at 494 nm). Meanwhile, at that dose, a plant-derived product annatto or urucum (Bixa orellana L.) tincture presented a nearly 58% reduction in color intensity. Tincture of curcumin (diferuloylmethane) the active ingredient in the eastern spice turmeric (Curcuma longa) showed to be highly sensitive to radiation when diluted. These data shall be taken in account whenever food products containing these food colors were going to undergo radiation processing. - Highlights: • Comparison of radiosensitivity of food colors was performed. • Carmine showed the highest resistance to radiation. • Annatto and turmeric behaved sensitive to radiation when diluted. • Turmeric was the most affected by ionizing radiation.

  19. Comparison of the ionizing radiation effects on cochineal, annatto and turmeric natural dyes

    Science.gov (United States)

    Cosentino, Helio M.; Takinami, Patricia Y. I.; del Mastro, Nelida L.

    2016-07-01

    As studies on radiation stability of food dyes are scarce, commercially important natural food grade dyes were evaluated in terms of their sensitivity against gamma ionizing radiation. Cochineal, annatto and turmeric dyes with suitable concentrations were subjected to increasing doses up to 32 kGy and analyzed by spectrophotometry and capillary electrophoresis. The results showed different pattern of absorbance versus absorbed dose for the three systems. Carmine, the glucosidal coloring matter from the scale insect Coccus cacti L., Homoptera (cochineal) remained almost unaffected by radiation up to doses of about 32 kGy (absorbance at 494 nm). Meanwhile, at that dose, a plant-derived product annatto or urucum (Bixa orellana L.) tincture presented a nearly 58% reduction in color intensity. Tincture of curcumin (diferuloylmethane) the active ingredient in the eastern spice turmeric (Curcuma longa) showed to be highly sensitive to radiation when diluted. These data shall be taken in account whenever food products containing these food colors were going to undergo radiation processing.

  20. New record for Woldstedtius flavolineatus (Ichneumonidae: Diplazontinae), a hymenopteran parasitoid of syrphid flies in Hawaii

    Science.gov (United States)

    Cappadonna, Justin; Euaparadorn, Melody; Peck, Robert W.; Banko, Paul C.

    2009-01-01

    The parasitoid wasp Woldstedtius flavolineatus (Gravenhorst) (Ichneumonidae) attacks the larvae of syrphid flies (Syrphidae). Woldstedtius flavolineatus was collected in Hawaii for the first time during an extensive malaise trap-based survey of parasitoids in Hawaiian forests. Since its initial collection on Hawaii Island in January 2006, it has been collected at five additional sites on Hawaii Island and at one site each on Maui and Oahu. Malaise trap results from Hakalau Forest National Wildlife Refuge showed a strong seasonal pattern of abundance, with peak population levels reached during July–September. Rearing of its host, Allograpta obliqua (Say), collected from koa (Acacia koa Gray) at Hakalau over two days, revealed a parasitism rate of approximately 95%. Broader impacts of this alien wasp are unknown, but a reduction in host syrphid abundance could result in an increase in numbers of psyllids and aphids (Homoptera) that are preyed upon by syrphid larvae. Furthermore, a reduction in adult syrphids could impact the reproductive success of some of the plants they pollinate.

  1. Aspectos biológicos y poblacionales de Nasonovia ribisnigri y Aulacorthum solani sobre lechuga

    Directory of Open Access Journals (Sweden)

    Vasicek Araceli

    2002-01-01

    Full Text Available Se estimó la influencia de los cultivares Criolla Blanca, Cuatro Estaciones y Gallega, sobre la biología y los parámetros poblacionales de Nasonovia ribisnigri y Aulacorthum solani (Homoptera: Aphidoidea a 10±1ºC y HR de 90%. Los períodos ninfal, pre-reproductivo y post-reproductivo de N. ribisnigri fueron más largos sobre Cuatro Estaciones, no así el reproductivo. En A. solani el período ninfal fue más largo sobre Criolla Blanca y Cuatro Estaciones resultando el reproductivo mayor sobre Cuatro Estaciones. Las tasas intrínsecas de crecimiento natural (r m de N. ribisnigri y A. solani fueron mayores sobre Criolla Blanca y Gallega, respectivamente. De acuerdo a la especie predominante convendría utilizar Cuatro Estaciones para N. ribisnigri y Criolla Blanca para A. solani, en épocas frías.

  2. Evaluation of the attractive effect of coloured sticky traps for Aleurocanthus spiniferus (Quaintance and its monitoring method in tea garden in China

    Directory of Open Access Journals (Sweden)

    Y. Wang

    2015-12-01

    Full Text Available Aleurocanthus spiniferus (Quaintance, namely tea spiny whitefly (TSW, belongs to the family Aleyrodidae in the order Homoptera, widespread in tea trees and fruit trees in many countries or regions. In this study, the preference of TSW for different colours was evaluated in tea gardens. Yellow was the colour most preferred by TSW, followed by pink, red, white and other colours. The controlling technologies about the number of sticky traps in a certain area of tea garden and the height of sticky traps above tea canopy were also evaluated, the results indicated that the attractive effect of 20 traps/667 m2 of trials area and the height of 10 cm above tea canopy were significantly higher than others treatments. In addition, more TSW was caught at 11:00-15:00, followed by 7:00-11:00, and 15:00-19:00 in a daytime; higher activity level of male adults was at 7:00-11:00 and 11:00-15:00 in day time (95.13% and 94.97% of caught TSW, indicating a higher activity level for male adult.

  3. Arthropod prey of imported fire ants (Hymenoptera: Formicidae) in Mississippi sweetpotato fields.

    Science.gov (United States)

    Rashid, Tahir; Chen, Jian; Vogt, James T; McLeod, Paul J

    2013-08-01

    The red imported fire ants, Solenopsis invicta (Buren), are generally considered pests. They have also been viewed as beneficial predators feeding on other insect pests of various agroecosystems. This study documents the foraging habits of fire ants in a sweetpotato field in Mississippi. Fire ant foraging trails connecting outside colonies to a sweetpotato field were exposed and foraging ants moving out of the field toward the direction of the colony were collected along with the solid food particles they were carrying. The food material was classified as arthropod or plant in origin. The arthropod particles were identified to orders. Fire ant foragers carried more arthropods than plant material. Coleoptera and Homoptera were the most abundant groups preyed upon. These insect orders contain various economically important pests of sweetpotato. Other major hexapod groups included the orders Hemiptera, Diptera and Collembola. The quantity of foraged material varied over the season. No damage to sweetpotato roots could be attributed to fire ant feeding. Imported fire ant foraging may reduce the number of insect pests in sweetpotato fields. © 2012 Institute of Zoology, Chinese Academy of Sciences.

  4. Lebensspuren holzzerstörender Organismen an fossilen Hölzern aus dem Tertiär der Insel Lesbos, Griechenland

    Directory of Open Access Journals (Sweden)

    H. Süss

    2001-01-01

    Full Text Available Lebensspuren (Schadbilder holzzerstörender Organismen an fossilen Holzresten aus dem Untermiozän von Lesbos (Griechenland werden beschrieben. Von pflanzlichen Holzzerstörern konnten Bakterien, imperfekte Pilze, Weiß- und Braunfäulepilze und in das Holz eingewachsene Wurzeln nachgewiesen werden. Von tierischen Holzzerstörern wurden Termitenfraß, durch Pflanzensauger (Homopteren verursachtes Wundgewebe, Larvenfraß der Kambium-Minierfliege Palaeophytobia (Agromyzidae, Diptera und Fraßgänge mit Koprolithen verschiedener Käferarten (Anobiiden? und Milben (Acari gefunden. Außerdem werden durch Kristallisationsvorgänge im Holz verursachte kugelförmige Gebilde beschrieben. Traces of wood destroying organisms on fossil wood from the Lower Miocene of Lesbos (Greece are described. Among nonanimal wood destroyers evidence is presented of bacteria, Fungi imperfecti, whiterot and brownrot fungus and penetrating roots. Animal wood destroyers include termite feeding traces, wound tissues produced by plant suckers (Homoptera, larval feeding traces of the cambium miner Palaeophytobia (Agromyzidae, Diptera and feeding channels, with coprolites, of several beetle species (Anobiidae? and Mites (Acari. In addition globe-like structures produced in the wood through crystallization processes are described. doi:10.1002/mmng.20010040105

  5. A survey of syrphid predators of Nasonovia ribisnigri in organic lettuce on the central coast of California.

    Science.gov (United States)

    Smith, Hugh A; Chaney, William E

    2007-02-01

    Organic lettuce, Lactuca sativa L., producers on California's Central Coast rely on endemic syrphid flies (Diptera: Syrphidae) to suppress populations of Nasonovia ribisnigri Mosley (Homoptera: Aphididae) and other aphids affecting lettuce. Growers are using various forms of habitat manipulation to enhance biological control. We surveyed syrphids collected from organic romaine in and around the Salinas Valley from March through September 2005 to gain a better understanding of the species responsible for aphid suppression and to examine possible implications for biocontrol. The primary species of syrphid fly reared were Toxomerus marginatus (Say) (39%), Platycheirus stegnus (Say) (27%), Sphaerophoria sulfuripes (Thomson) (13%), and Allograpta obliqua (Say) (10%). Syrphus opinator Osten Sacken (2%), Toxomerus occidentalis (Curran) (1.3%), and Eupeodes volucris Osten Sacken (1%) were less common. Sphaerophoria pyrrhina Bigot, Scaeva pyrastri (L.), Platycheirus obscurus Say, Allograpta exotica Wiedemann, and Eupeodes americanus Wiedemann each made up aphids. P. stegnus was observed to deposit in clusters of eggs, and was only reared in significant numbers from highly infested fields. Approximately 5% of syrphid larvae overall were parasitized by either Diplazon sp. (Hymenoptera: Ichneumonidae) or Pachyneuron sp. (Hymenoptera: Pteromalidae).

  6. Variation in the species composition and mean body size of an avian foliage-gleaning guild along an elevational gradient: correlation with arthropod body size.

    Science.gov (United States)

    Janes, Stewart W

    1994-08-01

    The composition of an avian foliage-gleaning guild was analyzed with respect to body size at nine sites along an elevational gradient in the Oregon Cascades. Mean body size decreased from 20.5 g near the lower forest boundary where it meets the grassland at about 775 m to 9.3 g near timberline at about 1720 m. Both the loss of larger species and the gain of smaller species contributed to the change. Mean volume of the foliage-dwelling arthropods also decreased with increasing elevation by two orders of magnitude along the same gradient. A significant decrease in body size occurred in three arthropod groups, larval Lepidoptera, Homoptera, and spiders, and of these, larval Lepidoptera dominated the overall size trend among arthropods. Both developmental differences (higher elevation sites are delayed seasonally on the same calendar date) and taxonomic differences contributed to the change in mean arthropod size. Mean bird size was positively correlated (r=0.93) with the body size of foliage-dwelling arthropods. A similar pattern was suggested for other avian guilds dependent directly or indirectly upon foliage-dwelling arthropods, but not for guilds independent of foliage-dwelling arthropods.

  7. Analysis of the feeding habits of the swallow-tailed hummingbird, Eupetomena macroura (Gmelin, 1788, in an urban park in southeastern Brazil

    Directory of Open Access Journals (Sweden)

    MCB. Toledo

    Full Text Available The aim of this work was to observe and describe the feeding habits and available food resources of the swallow-tailed hummingbird, Eupetomena macroura. The study was carried out in a municipal park located in the city of Taubaté, in the state of São Paulo. The observations took place between December 2003 and October 2004, recording the following variables: 1 the plant species visited for feeding and territorial defense; 2 the kinds of food resources; and 3 the kinds of flight to procure and obtain food. E. macroura visited 12 plant species. For territorial defense, Mangifera indica was the most visited, whereas Malvaviscus arboreus was most visited for feeding. The foliage was the plant part that received the most frequent visits. In order to obtain nectar, the only species visited was M. arboreus; to obtain arthropods, the species most visited were Mangifera indica and Hymenaea stilbocarpa. In the dry season, the hummingbirds visited flowers, whereas in the rainy season they visited leaves to acquire food. The arthropod groups most frequently found on leafy branches were Homoptera and Psocoptera. Finally, the results of the type of flight analysis showed that flight used to capture food was more often observed than were flights to search for food. In conclusion, these observations suggest that E. macroura shows plasticity in feeding behavior, which can help it to persist in urban areas.

  8. The Effects of Dispersal and Predator Density on Prey Survival in an Insect-Red Clover Metacommunity.

    Science.gov (United States)

    Stasek, David J; Radl, James N; Crist, Thomas O

    2018-01-01

    Trophic interactions are often studied within habitat patches, but among-patch dispersal of individuals may influence local patch dynamics. Metacommunity concepts incorporate the effects of dispersal on local and community dynamics. There are few experimental tests of metacommunity theory using insects compared to those conducted in microbial microcosms. Using connected experimental mesocosms, we varied the density of the leafhopper Agallia constricta Van Duzee (Homoptera: Cicadellidae) and a generalist insect predator, the damsel bug (Nabis spp., Heteroptera: Nabidae), to determine the effects of conspecific and predator density and varying the time available to dispersal among mesocosms on predation rates, dispersal rates, and leafhopper survival. Conspecific and damsel bug density did not affect dispersal rates in leafhoppers, but this may be due to leafhoppers' aversion to leaving the host plants or the connecting tubes between mesocosms hindering leafhopper movement. Leafhopper dispersal was higher in high-dispersal treatments. Survival rates of A. constricta were also lowest in treatments where dispersal was not limited. This is one of the first experimental studies to vary predator density and the time available to dispersal. Our results indicate that dispersal is the key to understanding short-term processes such as prey survival in predator-prey metacommunities. Further work is needed to determine how dispersal rates influence persistence of communities in multigenerational studies. © The Author(s) 2017. Published by Oxford University Press on behalf of Entomological Society of America.

  9. Fungi associated with the hemlock woolly adelgid, Adelges tsugae, and assessment of entomopathogenic isolates for management.

    Science.gov (United States)

    Reid, W R; Parker, B L; Gouli, S Y; Skinner, M; Gouli, V V; Teillon, H B

    2010-01-01

    Fungi associated with the hemlock wooly adelgid, Adelges tsugae Annand (Hemiptera: Adelgidae), were collected throughout the eastern USA and southern China. Twenty fungal genera were identified, as were 79 entomopathogenic isolates, including: Lecanicillium lecanii (Zimmermann) (Hypocreales: Insertae sedis), Isaria farinosa (Holm: Fries.) (Cordycipitaceae), Beauveria bassiana (Balasamo) (Hyphomycetes), and Fusarium spp (Nectriaceae). The remaining fungal genera associated with insect cadavers were similar for both the USA and China collections, although the abundance of Acremonium (Hypocreaceae) was greater in China. The entomopathogenic isolates were assayed for efficacy against Myzus persicae (Sulzer) (Homoptera: Aphididae) and yielded mortality ranging from 3 to 92%. Ten isolates demonstrating the highest efficacy were further assessed for efficacy against field-collected A. tsugae under laboratory conditions. Overall, two B. bassiana, one L. lecanii, and a strain of Metarhizium anisopliae (Metchnikoff) (Hypocreales: Clavicipitaceae), demonstrated significantly higher efficacy against A. tsugae than the others. Isolates were further evaluated for conidial production, germination rate and colony growth at four temperatures representative of field conditions. All isolates were determined to be mesophiles with optimal temperature between 25-30 degrees C. In general, conidial production increased with temperature, though two I. farinosa produced significantly more conidia at cooler temperatures. When efficacy values were compared with conidial production and temperature tolerances, Agricultural Research Service Collection of Entomopathogenic Fungi (ARSEF) 1080, 5170, and 5798 had characteristics comparable to the industrial B. bassiana strain GHA.

  10. Entomofauna associated to horticultural crops under organic and conventional practices in Cordoba, Argentina

    International Nuclear Information System (INIS)

    Zalazar, Laura; Salvo, Adriana

    2007-01-01

    Farming practices and the addition of chemical synthetic substances in conventional agroecosystems are detrimental mainly to natural enemies of phytophagous insects, diminishing the natural regulation of pest insects. On the other hand, in organic agriculture, biological processes and care of the environment are favoured, hence an increase in insect biodiversity is predicted in this type of systems. In this work, abundance, richness of insects and proportion of functional groups were compared through a single quantitative sampling of insects in horticultural crop fields, three under organic and three under conventional management practices. Insect species richness, total and for guilds (phytophagous and entomophagous insects) were significantly higher in organic orchards, and also was the abundance of entomophagous insects. Richness and abundance of all insect orders (with exception of Homoptera abundance), were higher in orchards under organic management, being significant the differences for richness of Coleoptera and richness and abundance of Hymenoptera. Similar tendencies were observed in data obtained through sweep net in weeds. These results suggest that organic practices increase the diversity of species, particularly that of natural enemies. (author)

  11. Biodiversidad del complejo de artrópodos asociados al follaje de la vegetación del norte de Chile, II región Biodiversity of the canopy arthropods associated to vegetation of the north of Chile, II region

    Directory of Open Access Journals (Sweden)

    FRANCISCO SAIZ

    2000-12-01

    , estableciéndose el siguiente gradiente decreciente: DL > DI > TM > TA. El contenido de cenizas de hojas y tallos también varía considerablemente y sigue el mismo patrón de variación que el contenido de agua. El contenido de nitrógeno foliar en las distintas zonas ecológicas estudiadas no varía tanto como el de agua, a excepción de TA en que son marcadamente inferiores. En cambio, en tallos es poco variable y no sigue el patrón de distribución foliar de este elemento, ni los patrones de distribución de los otros nutrientes considerados. En un enfoque global de las cuatro zonas se establece un gradiente decreciente de contenidos de agua, nitrógeno y cenizas desde el DL hasta la zona TA, concordante con el incremento en altitud, especialmente en lo referente a hojas. La familia Asteraceae muestra un definido gradiente decreciente del contenido de agua desde la costa a la alta cordillera. En cuanto al contenido foliar de cenizas difiere significativamente sólo entre DL y TM. En tallos no difiere significativamente. En total se colectaron 12.893 individuos de artrópodos asociados al follaje, distribuidos en 464 morfoespecies y 19 grupos zoológicos, considerando aparte a los antiguos Homoptera. Este grupo, junto a Hemiptera y larvas de Lepidoptera, destaca en cuanto a abundancia de especies dentro de los insectos fitófagos, así como Hymenoptera dentro de los parasitoides y Araneae entre los depredadores. En cuanto a las zonas ecológicas, el DL y TM presentan la mayor abundancia de artrópodos, tanto en especies como en individuos, así como de especies de plantas sobre las cuales se colectaron. La similaridad de la artropodofauna entre zonas ecológicas es mínima desde el punto de vista de la presencia de especies; en cambio, considerando sus abundancias, se detecta una tendencia a asociarse DI con TM y a aislarse el DL, al igual que ocurre con la vegetación. Desde el punto de vista de las diversidades específicas globales (H´ de los artrópodos se

  12. Mechanical properties of simulated Mars materials: gypsum-rich sandstones and lapilli tuff

    Science.gov (United States)

    Morrow, Carolyn; Lockner, David; Okubo, Chris

    2013-01-01

    Observations by the Mars Exploration Rover (MER) Opportunity, and other recent studies on diagenesis in the extensive equatorial layered deposits on Mars, suggest that the likely lithologies of these deposits are gypsum-rich sandstones and tuffaceous sediments (for example, Murchie and others, 2009; Squyres and others, 2012; Zimbelman and Scheidt, 2012). Of particular interest is how the diagenesis history of these sediments (degree of cementation and composition) influences the strength and brittle behavior of the material. For instance, fractures are more common in lower porosity materials under strain, whereas deformation bands, characterized by distributed strain throughout a broader discontinuity in a material, are common in higher porosity sedimentary materials. Such discontinuities can either enhance or restrict fluid flow; hence, failure mode plays an important role in determining the mechanics of fluid migration through sediments (Antonellini and Aydin, 1994; 1995; Taylor and Pollard, 2000; Ogilvie and Glover, 2001). As part of a larger study to characterize processes of fault-controlled fluid flow in volcaniclastic and gypsum-rich sediments on Mars, we have completed a series of laboratory experiments to focus on how gypsum clast content and degree of authigenic cementation affects the strength behavior of simulated Mars rocks. Both axial deformation and hydrostatic pressure tests were done at room temperature under dry conditions.

  13. International Conference on Recent Developments in Operator Theory and Its Applications

    CERN Document Server

    Lancaster, P; Shivakumar, P

    1996-01-01

    The present volume contains the proceedings of the International Conference on Ap­ plications of Operator Theory held in Winnipeg, Canada (October 2nd to 6th, 1994), which was organized by the Institute of Industrial Mathematical Sciences (IIMS) of the University of Manitoba. At this conference 92 participants representing 15 countries par­ ticipated, and 64 papers were presented. This meeting was the second of a linked pair. The first was a program of advanced instruction held at the Fields Institute, Ontario, followed by a research conference. The first of these events gave rise to the volume "Lectures on Operator Theory and its Applications", published by the American Mathematical Society for the Fields Institute in 1995. These two events were the creation of the following Program Committee: M. A. Dahleh (M. I. T. ) P. A. Fillmore (Dalhousie) B. A. Francis (Toronto) F. Ghahramani (Manitoba) K. Glover (Cambridge) I. Gohberg (Tel Aviv) T. Kailath (Stanford) P. Lancaster (Calgary), Chair H. Langer (Vienna) ...

  14. Araucaria forest management by the liocourt method, Painel municipality, SC

    Directory of Open Access Journals (Sweden)

    André Felipe Hess

    2014-12-01

    Full Text Available The aim of this study was to describe the diameter distribution and calculate the value of the Liocourt quotient 'q' for the species Araucaria angustifolia (Bertol. Kuntze in natural forest, as well as evaluating competition indexes in a fragment with an area of 74.2 ha. Fixed area sample plots of 400 m2 were used in this study, totaling one hectare sampling area. Trees with DBH > 10 cm were measured in all plots and later distributed in diameter classes for the calculation of the density probability function and competition index. The forest showed a density of 228 trees per hectare and basal area of 19.49 m2·ha-1. The value of the "q" quotient for the forest was 1.1, indicating that the recruitment and mortality rates are in equilibrium. The calculated competition indices showed that the forest is in a competition stage, with Glover and Holl index of 0.9798 and 0.7069 m2 for the BALmod.

  15. The birth of intracardiac surgery: a semicentennial tribute (June 10, 1948-1998)

    Science.gov (United States)

    Dávila, J C

    1998-06-01

    On June 10, 1948, Charles Philamore Bailey, of Philadelphia, auspiciously performed the first anatomically conceived and digitally guided operation inside the heart: the first successful intracardiac operation. The patient, Claire Ward, was a 24-year-old woman afflicted with severe mitral stenosis. Dwight E. Harken and Russell C. Brock performed their own mitral operations very soon after Bailey, using new variations of methods that had been discarded about two decades earlier; they soon adopted the logical anatomic approach. This threesome, with the added contributions of Robert P. Glover--Bailey's partner at the time, in the role of respected and convincing teacher--opened the floodgates upon a decade of so-called closed heart surgery. These accomplishments, added to the earlier successes with the patent ductus, aortic coarctation, and "blue babies," justified and strengthened the demand for precise diagnosis in cardiology--at that time a languishing specialty--and brought to the fore the indisputable requirement to operate inside the heart with maximal control. This essay calls attention to the semicentennial of that seminal event and reviews the origins of surgery for mitral stenosis.

  16. 4th Optimization Day

    CERN Document Server

    Eberhard, Andrew; Ralph, Daniel; Glover, Barney M

    1999-01-01

    Although the monograph Progress in Optimization I: Contributions from Aus­ tralasia grew from the idea of publishing a proceedings of the Fourth Optimiza­ tion Day, held in July 1997 at the Royal Melbourne Institute of Technology, the focus soon changed to a refereed volume in optimization. The intention is to publish a similar book annually, following each Optimization Day. The idea of having an annual Optimization Day was conceived by Barney Glover; the first of these Optimization Days was held in 1994 at the University of Ballarat. Barney hoped that such a yearly event would bring together the many, but widely dispersed, researchers in Australia who were publishing in optimization and related areas such as control. The first Optimization Day event was followed by similar conferences at The University of New South Wales (1995), The University of Melbourne (1996), the Royal Melbourne Institute of Technology (1997), and The University of Western Australia (1998). The 1999 conference will return to Ballarat ...

  17. Dependência tabágica, assertividade e alexitimia em doentes cardíacos

    Directory of Open Access Journals (Sweden)

    Vânia Rocha

    2010-08-01

    Full Text Available O tabagismo é uma das principais causas evitáveis de morte, aumentando acentuadamente o risco de infarto do miocárdio. Este último está associado a certas variáveis psicossociais relacionadas com o tabagismo, nomeadamente a alexitimia e a falta de assertividade. O objetivo do presente artigo foi caracterizar os dois tipos de dependência tabágica (fisiológica e comportamental, a assertividade e a alexitimia, e avaliar a relação das variáveis entre si, em 30 doentes homens internados com infarto. Foram aplicados o Teste de Fagerström, o Questionário de Glover-Nilsson, a Escala de "Rathus" e a TAS-20. Os resultados indicam que a alexitimia encontra-se relacionada com a dependência comportamental e com a assertividade, sugerindo que os sujeitos menos assertivos e com dificuldade em gerir afetos negativos e situações de estresse, podem recorrer ao tabagismo como mecanismo de enfrentamento. Nas intervenções voltadas à interrupção do hábito de fumar em doentes infartados deve-se enfatizar as competências sociais e de regulação emocional.

  18. Putting science at the heart of European policy

    CERN Multimedia

    2015-01-01

    One year ago, the incoming European Commission President Jean-Claude Juncker shocked the scientific world by scrapping the post of Chief Scientific Advisor. This week, the Commission made amends by launching a well-considered Scientific Advisory Mechanism (SAM) that not only puts science back at the heart of policy, but does so in a much more structured and robust way than conferring such responsibility on a single individual.     The SAM has two independent strands: an advisory group of seven scientists, and funding through the Horizon 2020 programme for national academies and learned societies to network and collaborate on policy issues. Both are backed up by a secretariat at Commission headquarters in Brussels. When Mr Juncker scrapped the role of Chief Scientific Advisor, it was against a backdrop of sometimes vitriolic attacks on the incumbent, Anne Glover, due to her outspoken views on GMOs. Mr Juncker’s move was seen by some as simply giving in to a powerful lob...

  19. Scoping Study: Networked Microgrids.

    Energy Technology Data Exchange (ETDEWEB)

    Trinklei, Eddy; Parker, Gordon; Weaver, Wayne; Robinett, Rush; Babe Gauchia, Lucia; Ten, Chee-Wooi; Bower, Ward; Glover, Steven F.; Bukowski, Steve

    2014-10-01

    This report presents a scoping study for networked microgrids which are defined as "Interoperable groups of multiple Advanced Microgrids that become an integral part of the electricity grid while providing enhanced resiliency through self-healing, aggregated ancillary services, and real-time communication." They result in optimal electrical system configurations and controls whether grid-connected or in islanded modes and enable high penetrations of distributed and renewable energy resources. The vision for the purpose of this document is: "Networked microgrids seamlessly integrate with the electricity grid or other Electric Power Sources (EPS) providing cost effective, high quality, reliable, resilient, self-healing power delivery systems." Scoping Study: Networked Microgrids September 4, 2014 Eddy Trinklein, Michigan Technological University Gordon Parker, Michigan Technological University Wayne Weaver, Michigan Technological University Rush Robinett, Michigan Technological University Lucia Gauchia Babe, Michigan Technological University Chee-Wooi Ten, Michigan Technological University Ward Bower, Ward Bower Innovations LLC Steve Glover, Sandia National Laboratories Steve Bukowski, Sandia National Laboratories Prepared by Michigan Technological University Houghton, Michigan 49931 Michigan Technological University

  20. Patronage in the dispute over child analysis between Melanie Klein and Anna Freud--1927-1932.

    Science.gov (United States)

    Aguayo, J

    2000-08-01

    The author investigates the role of patrons and advocates for Melanie Klein's clinical ideas at the British Psycho-Analytical Society against the backdrop of her theoretical and technical differences with Anna Freud from 1927 to 1932. He also outlines the development of Klein and Anna Freud's theories and techniques within the nascent discipline of child psychoanalysis. The London and Viennese patrons/advocates contributed to polarising what initially were clinical differences about how to analyse pre-latency and latency-age children and which technical processes might best facilitate successful treatment. While the author speculates that a diversity of motivations and agendas may have driven the London group's support for Klein--personal and politicised enthusiasm (Jones), genuine conviction (Riviere) and attempts at theoretical rapprochement between the London and Vienna schools (Glover)--he also argues that Freud's diagnosis with cancer in 1923 and suspicion of patricidal son-successors necessitated the choice of a female successor with unquestioning loyalty to his doctrines. From 1932, when Klein's clinical authority was established, her first group of English supporters began to splinter, as she went on to become a training analyst, mentor and patron in her own right to a succeeding generation of adherents who defended her views during the Controversial Discussions.

  1. Interpersonal rivalries, gender and the intellectual and scientific making of psychoanalysis in 1940s Britain.

    Science.gov (United States)

    Shapira, Michal

    2017-05-01

    This article examines the 1940s debates regarding the status and professional orthodoxy of psychoanalysis following Sigmund Freud's death, by exploring the Anna Freud-Melanie Klein Controversial Discussions in the British Psychoanalytical Society. Focusing on the work of now-forgotten analysts Melitta Schmideberg and Edward Glover, and on their relationship with Klein and her supporters, the article reveals how these neglected, yet important, debates were complicated by interpersonal and professional ties, processes of the professionalization, and changing gender norms. Although historians of psychoanalysis have not ignored the jealousies, resentments, and complex relationships between psychoanalysts, these scholars often continue to view these as separate from the processes of creating science. Here, instead, I view the personal and the intellectual in tandem, thus challenging the divide between scientific reason and affect. Rather than imposing a separation between the scientific and the personal, I suggest that we should explore how historical actors negotiated the divide themselves. Indeed, I demonstrate that the study of interpersonal contexts is an invaluable tool for understanding the development of psychological disciplines. (PsycINFO Database Record (c) 2017 APA, all rights reserved).

  2. Choline acetyltransferase: further studies on the reverse reaction

    International Nuclear Information System (INIS)

    Hsu, L.L.; Chao, L.P.

    1982-01-01

    In order to further characterize the reaction mechanism of brain ChAc in its purified form, we have investigated the reverse reaction of ChAc in terms of pH optimum, salt effects, and substrate kinetics using a radiochemical assay. We directly measured the reaction product acetylcoenzyme A which was separated from the substrate ACh by a cation exchange column. Dowex 50W-X8 (Na+ form). The reverse reaction of ChAc was linear with incubation time up to 40 minutes, and with enzyme protein concentration up to 5 micrograms. It had a pH optimum at 7.0. At 0.22 M the monovalent chloride and bromide salts activated the reverse ChAc activity by 23-47% but the fluoride and iodide salts inhibited the reverse enzyme activity by 10-30%. Kinetic studies in the absence of salt showed that KACh was 0.62 +/- 0.06 mM, KCoA . SH was 12.68 +/- 1.21 microM, and Vmax was 11.6 +/- 1.0 nmol AcCoA/mg protein/min. These data are in disagreement with the values reported on partially purified ChAc from bovine brain by Glover and Potter [1971] and Hersh [1980]. This indicates that further investigations are necessary to clarify or resolve these differences

  3. Optical properties of large-area MoS2 thin films grown via magnetron sputtering: Thickness and substrate dependence

    Science.gov (United States)

    Alkabsh, Asma; Samassekou, Hassana; Mazumdar, Dipanjan

    Transition metal dichalcogenides (TMDS) have gained exceptional attention because of their thickness dependent electronic structure which makes them suitable for electronic and optoelectronic applications. MoS2 is among the most promising material in this family. Recently we have successfully developed growth of large-area MoS2 using magnetron sputtering. In this work, we investigated the large-area optical properties of few and bilayer MoS2 grown on different amorphous underlayers (BN and SiO2) using spectroscopic ellipsometry (SE), UV-VIS and Raman spectroscopy. SE spectra provided thickness and optical constants within 1.0-3.0 eV range, whereas broadband (0.5-6.5 eV) transmission and reflectance measurements provided direct measurements of optical constants through Glover-Tinkham analysis. A comprehensive analysis of thickness and substance dependence of optical properties of our large-area films will be presented and compared with existing literature reports and first-principles electronic structure. Also, Raman measurements reveal interesting disorder related effects on our MoS2 films.

  4. The mitochondrial genome of the Russian wheat aphid Diuraphis noxia: large repetitive sequences between trnE and trnF in aphids.

    Science.gov (United States)

    Zhang, Bo; Ma, Chuan; Edwards, Owain; Fuller, Susan; Kang, Le

    2014-01-01

    To characterize aphid mitochondrial genome (mitogenome) features, we sequenced the complete mitogenome of the Russian wheat aphid, Diuraphis noxia. The 15,784-bp mitogenome with a high A+T content (84.76%) and strong C skew (-0.26) was arranged in the same gene order as that of the ancestral insect. Unlike typical insect mitogenomes, D. noxia possessed a large tandem repeat region (644 bp) located between trnE and trnF. Sequencing partial mitogenome of the cotton aphid (Aphis gossypii) further confirmed the presence of the large repeat region in aphids, but with different repeat length and copy number. Another motif (58 bp) tandemly repeated 2.3 times in the control region of D. noxia. All repeat units in D. noxia could be folded into stem-loop secondary structures, which could further promote an increase in copy numbers. Characterization of the D. noxia mitogenome revealed distinct mitogenome architectures, thus advancing our understanding of insect mitogenomic diversities and evolution. © 2013 Elsevier B.V. All rights reserved.

  5. Microbial Production of Food Grade Pigments

    Directory of Open Access Journals (Sweden)

    Laurent Dufossé

    2006-01-01

    Full Text Available The controversial topic of synthetic dyes in food has been discussed for many years. The scrutiny and negative assessment of synthetic food dyes by the modern consumer have raised a strong interest in natural colouring alternatives. Nature is rich in colours (minerals, plants, microalgae, etc., and pigment-producing microorganisms (fungi, yeasts, bacteria are quite common. Among the molecules produced by microorganisms are carotenoids, melanins, flavins, quinones, and more specifically monascins, violacein or indigo. The success of any pigment produced by fermentation depends upon its acceptability on the market, regulatory approval, and the size of the capital investment required to bring the product to market. A few years ago, some expressed doubts about the successful commercialization of fermentation-derived food grade pigments because of the high capital investment requirements for fermentation facilities and the extensive and lengthy toxicity studies required by regulatory agencies. Public perception of biotechnology-derived products also had to be taken into account. Nowadays some fermentative food grade pigments are on the market: Monascus pigments, astaxanthin from Xanthophyllomyces dendrorhous, Arpink Red from Penicillium oxalicum, riboflavin from Ashbya gossypii, b-carotene from Blakeslea trispora. The successful marketing of pigments derived from algae or extracted from plants, both as a food colour and a nutritional supplement, reflects the presence and importance of niche markets in which consumers are willing to pay a premium for »all natural ingredients«.

  6. Survey of aphid population in a yellow passion fruit crop and its relationship on the spread Cowpea aphid-borne mosaic virus in a subtropical region of Brazil.

    Science.gov (United States)

    Garcêz, Renata Maia; Chaves, Alexandre Levi Rodrigues; Eiras, Marcelo; Meletti, Laura Maria Molina; de Azevedo Filho, Joaquim Adelino; da Silva, Leonardo Assis; Colariccio, Addolorata

    2015-01-01

    Passion fruit woodiness may be caused by Cowpea aphid-borne mosaic virus (CABMV) and is currently the major passion fruit disease in Brazil. To assess the virus-vector-host interactions, a newly introduced golden passion fruit plantation located in eastern region of São Paulo State, Brazil, was monitored. Dissemination of CABMV was determined analyzing golden passion fruit plants monthly for 18 months by PTA-ELISA. Seasonality and aphid fauna diversity was determined by identification of the captured species using yellow sticky, yellow water-pan and green tile traps. Population composition of the aphid species was determined using the descriptive index of occurrence, dominance and general classification and overlap of species in the R program. Analyses of species grouping afforded to recognize 14 aphid species. The genus Aphis represented 55.42 % of the species captured. Aphid species formed two distinct clusters, one of which was characterized by the diversity of polyphagous species that presented high potential to spread CABMV. The low abundance and diversity of aphid species did not interfere negatively in the CABMV epidemiology. The genus Aphis, particularly Aphis fabae/solanella and A. gossypii, was crucial in the spread of CABMV in passion fruit orchards in the eastern State of São Paulo.

  7. Prey Acceptability and Preference of Oenopia conglobata (Coleoptera: Coccinellidae, a Candidate for Biological Control in Urban Green Areas

    Directory of Open Access Journals (Sweden)

    Belén Lumbierres

    2018-01-01

    Full Text Available Oenopia conglobata is one of the most common ladybird species in urban green areas of the Mediterranean region. We have obtained data about its prey acceptability and prey preferences. In a laboratory experiment, we investigated the acceptability of seven aphid and one psyllid species as prey for this coccinellid: the aphids Chaitophorus populeti, Aphis gossypii, Aphis craccivora Monelliopsis caryae, Eucallipterus tiliae, Aphis nerii (on white poplar, pomegranate, false acacia, black walnut, lime, and oleander, respectively, and the psyllid Acizzia jamatonica on Persian silk tree. These species are abundant in urban green areas in the Mediterranean region. In addition, we tested the acceptability of Rhopalosiphum padi on barley, an aphid species easily reared in the laboratory. We also tested preferences of the predator in cafeteria experiments with three aphid species and one aphid and the psyllid. Adults and larvae of the coccinellid accepted all of the preys offered, except A. nerii, with a clear preference for M. caryae. The predator also showed preference for M. caryae when it was offered in a cafeteria experiment with other aphid species or with the psyllid. The aphid R. padi obtained a good acceptability and could be used for rearing O. conglobata in the laboratory.

  8. Comparative transcriptional analysis of asexual and sexual morphs reveals possible mechanisms in reproductive polyphenism of the cotton aphid.

    Directory of Open Access Journals (Sweden)

    Li-Jun Liu

    Full Text Available Aphids, the destructive insect pests in the agriculture, horticulture and forestry, are capable of reproducing asexually and sexually upon environmental change. However, the molecular basis of aphid reproductive mode switch remains an enigma. Here we report a comparative analysis of differential gene expression profiling among parthenogenetic females, gynoparae and sexual females of the cotton aphid Aphis gossypii, using the RNA-seq approach with next-generation sequencing platforms, followed by RT-qPCR. At the cutoff criteria of fold change ≥2 and P<0.01, we identified 741 up- and 879 down-regulated genes in gynoparae versus parthenogenetic females, 2,101 up- and 2,210 down-regulated genes in sexual females compared to gynoparae, and 1,614 up- and 2,238 down-regulated genes in sexual females relative to parthenogenetic females. Gene ontology category and KEGG pathway analysis suggest the involvement of differentially expressed genes in multiple cellular signaling pathways into the reproductive mode transition, including phototransduction, cuticle composition, progesterone-mediated oocyte maturation and endocrine regulation. This study forms a basis for deciphering the molecular mechanisms underlying the shift from asexual to sexual reproduction in the cotton aphid. It also provides valuable resources for future studies on this host-alternating aphid species, and the insight into the understanding of reproductive mode plasticity in different aphid species.

  9. Studies on the biosynthesis of vitamin B2 and vitamin B12

    International Nuclear Information System (INIS)

    Chen, H.C.

    1988-01-01

    Feeding experiments with Ashbya gossypii followed by NMR analysis of the resulting riboflavin showed incorporation of deuterium from D-[2- 2 H]ribose at C-2' and from D-[1- 2 H]ribose in the pro-R position at C-1' of the ribityl side chain. The results rule out an Amadori rearrangement mechanism for the reduction of the ribosylamino to the ribitylamino linkage and point to formation of a Schiff base that is reduced stereospecifically opposite to the face from which the oxygen has departed. As prerequisite for the analysis, the 1 H NMR signals for the pro-R and pro-S hydrogens at C-1' of riboflavin and its tetraacetate were assigned with the aid of synthetic stereospecifically deuteriated samples. Feeding experiments with Propionibacterium shermianii followed by NMR analysis of the resulting vitamin B 12 showed: (1) 5-methylbenzimidazole (5MBI) incorporated and only one regioisomer (B6-demethylcyanocobalamin)formed. (2) 8-demethylriboflavin incorporated and the same regioisomer was obtained as 5MBI experiment. (3) [1'- 13 C, 5- 15 N]riboflavin incorporated and 13 C-NMR showed that 13 C at the B2 position of cyanocobalamin coupled to both adjacent nitrogen-15 atoms at about the same ratio

  10. Natural incidence of tomato viruses in the North of Iran

    Directory of Open Access Journals (Sweden)

    Alireza Mohammadi HAJIABADI

    2012-09-01

    Full Text Available A survey was conducted in Qazvin province in the North of Iran, to determine the incidence of tomato viruses including: Tobacco mosaic virus (TMV, Tomato yellow leaf curl virus (TYLCV, Tomato chlorotic spot virus (TCSV, Tomato bushy stunt virus (TBSV, Tomato spotted wilt virus (TSWV, Tomato ring spot virus (ToRSV, Tomato aspermy virus (TAV, Potato virus Y (PVY, Beet curly top virus (BCTV, and Cucumber mosaic virus (CMV. A total of 742 tomato symptomatic samples were collected during the summer of 2007 in five regions of Qazvin province (Qazvin, Takestan, Boeen-Zahra, Alborz and Abiyek and tested by enzyme-linked immunosorbent assay (ELISA. TSWV was detected in Alborz (4.4 % and Abiyek (3.57% regions but TMV and CMV were detected in all five regions. The greatest and least incidence of tomato viruses were recorded in Alborz (40.7 % and Takestan (11.1 %, respectively. The presence of these viruses was also evaluated in the weed hosts as natural sources of plant viruses. The greatest and least incidence of tomato viruses in weed hosts were recorded in Boeen-Zahra (25.6 % and Qazvin (12.8 %, respectively. TSWV was not detected in weeds. Transmission tests demonstrated that Thrips tabaci acts as TSWV carrier and Myzus persicae and Aphis gossypii were CMV carriers. Seed transmission tests were positive for TMV (13 tomato seedlings from 100 seedlings, but no TSWV transmission was observed through the seeds of infected tomato fruits.

  11. Resistance gene homologues in melon are linked to genetic loci conferring disease and pest resistance.

    Science.gov (United States)

    Brotman, Y.; Silberstein, L.; Kovalski, I.; Perin, C.; Dogimont, C.; Pitrat, M.; Klingler, J.; Thompson, A.; Perl-Treves, R.

    2002-05-01

    Genomic and cDNA fragments with homology to known disease resistance genes (RGH fragments) were cloned from Cucumis melo using degenerate-primer PCR. Fifteen homologues of the NBS-LRR gene family have been isolated. The NBS-LRR homologues show high divergence and, based on the partial NBS-fragment sequences, appear to include members of the two major subfamilies that have been described in dicot plants, one that possesses a TIR-protein element and one that lacks such a domain. Genomic organization of these sequences was explored by DNA gel-blot analysis, and conservation among other Cucurbitaceae was assessed. Two mapping populations that segregate for several disease and pest resistance loci were used to map the RGH probes onto the melon genetic map. Several NBS-LRR related sequences mapped to the vicinity of genetic loci that control resistance to papaya ringspot virus, Fusarium oxysporum race 1, F. oxysporum race 2 and to the insect pest Aphis gossypii. The utility of such markers for breeding resistant melon cultivars and for cloning the respective R-genes is discussed.

  12. Transfer of Cry1Ac and Cry2Ab proteins from genetically engineered Bt cotton to herbivores and predators.

    Science.gov (United States)

    Meissle, Michael; Romeis, Jörg

    2017-04-04

    With the cultivation of Bt cotton, the produced insecticidal Cry proteins are ingested by herbivores and potentially transferred along the food chain to natural enemies, such as predators. In laboratory experiments with Bollgard II cotton, concentrations of Cry1Ac and Cry2Ab were measured in Lepidoptera larvae (Spodoptera littoralis, Heliothis virescens), plant bugs (Euschistus heros), aphids (Aphis gossypii), whiteflies (Bemisia tabaci), thrips (Thrips tabaci, Frankliniella occidentalis), and spider mites (Tetranychus urticae). Tritrophic experiments were conducted with caterpillars of S. littoralis as prey and larvae of ladybird beetles (Harmonia axyridis, Adalia bipunctata) and lacewings (Chrysoperla carnea) as predators. Immunological measurements (ELISA) indicated that herbivores feeding on Bt cotton contained 5%-50% of the Bt protein concentrations in leaves except whiteflies and aphids, which contained no or only traces of Bt protein, and spider mites, which contained 7 times more Cry1Ac than leaves. Similarly, predators contained 1%-30% of the Cry protein concentration in prey. For the nontarget risk assessment, this indicates that Bt protein concentrations decrease considerably from one trophic level to the next in the food web, except for spider mites that contain Bt protein concentrations higher than those measured in the leaves. Exposure of phloem sucking hemipterans is negligible. © 2017 Institute of Zoology, Chinese Academy of Sciences.

  13. [Isolation, identification and insecticidal activity of endophyte from Achnatherum inebrians].

    Science.gov (United States)

    Zhang, Xuebing; Shi, Yingwu; Wang, Xiaoxia; Zhang, Wei; Lou, Kai

    2010-04-01

    To study endophyte species of Achnatherum inebrians and to screen strains with insecticidal activity against cotton insect. We isolated endophytic from roots,stems,leaves and seeds of health A. inebrians by grinding separation method and identified by a dual approach of morphological and physiological observation and 16S rDNA gene (for bacteria) and ITS sequence (for fungi) based molecular identification. Then,those endophytes were inoculated into liquid media for fermentation and the crude extracts were used to test insecticidal activities by slide disc immersion and nebulization methods. We isolated bacteria species classified into 8 genera of Bacillus, Streptomyces, Corynebacterium, Phyllobacterium, sphingomonnas, Paenibacillus, Pseudomonas, Acinetobacter and 2 fungi of Claviceps purpure and Claviceps Chaetomium. Of them, the strain Streptomyces rochei (GA) and Claviceps purpurea (PF-2) had more than 85% of mortality to cotton aphis. Two strains of PF-2 and GA associated within the A. inebrians had significant insecticidal activity to cotton aphis (Aphis gossypii), which may provide a new biological resource to explore new microbial insecticide.

  14. Cotton fertilization using PGPR Bacillus amyloliquefaciens FZB42 and compost: Impact on insect density and cotton yield in North Benin, West Africa

    Directory of Open Access Journals (Sweden)

    Thiery B. Charles Alavo

    2015-12-01

    Full Text Available This work has compared the effects of the biofertilizer Bacillus amyloliquefaciens FZB42 with that of compost for cotton production. The population dynamics of pests and predators have been studied in order to check whether the use of both fertilization materials can contribute to pest management in cotton. Three treatments were considered: (i dressing of seeds in rhizobacteria suspension, (ii introduction of rhizobacterial suspension directly in the pocket, same time with the seeds, and (iii fertilization with compost. The study was carried out in northwest Benin (West Africa. Results showed that cotton aphids, Aphis gossypii, pink bollworm, Pectinophora gossypiella, leaf roller, Sylepta derogata, and cotton bugs, Dysdercus sp. are the major insect pests encountered in the experimental plots. Cotton bollworm, Helicoverpa armigera, was present but under the economic threshold. The coccinellid predators, Cheilomenes spp., occurred in the experimental plots and almost suppressed aphid proliferation. Other natural enemies such as chrysopids and ant species also occurred and probably contributed to maintain the cotton bollworm under the economic threshold. The treatment with seeds dressed with the rhizobacteria suspension yielded 39% more cotton compared to the compost fertilization. The use of both fertilization materials without application of chemicals can contribute to pest management in cotton.

  15. Selection of entomopathogenic fungi for aphid control.

    Science.gov (United States)

    Vu, Van Hanh; Hong, Suk Il; Kim, Keun

    2007-12-01

    Twelve strains of entomopathogenic fungi such as Lecanicillium lecanii, Paecilomyces farinosus, Beauveria bassiana, Metarhizium anisopliae, Cordyceps scarabaeicola, and Nomuraea rileyi were screened for aphid control. At 25 degrees C and 75% relative humidity (RH), among tested entomopathogenic fungi, L. lecanii 41185 showed the highest virulent pathogenicity for both Myzus persicae and Aphis gossypii, and their control values were both nearly 100% 5 and 2 d after treatment, respectively. Moreover, at an RH of 45% and in a wide temperature range (20-30 degrees C), L. lecanii 41185 also exhibited the highest virulence to M. persicae. The control value of M. persicae and the 50% lethal time (LT50) decreased significantly as the applied conidial concentration increased. The 50% lethal concentration (LC50) of the conidial suspension of this fungus was determined to be 6.55x10(5) conidia/ml. The control values of M. persicae resulting from the application of 1x10(7) and 1x10(8) conidia/ml were nearly the same and were significantly higher than that of 1x10(6) conidia/ml. The tested entomopathogenic fungi grew in a broad temperature range (15-30 degrees C). Lecanicillium strains showed optimum growth at 25 degrees C. The aerial conidia of Lecanicillium strains also could germinate in a broad temperature range (15-30 degrees C) and L. lecanii 41185 was the only strain with conidial germination at 35 degrees C.

  16. Prey Acceptability and Preference of Oenopia conglobata (Coleoptera: Coccinellidae), a Candidate for Biological Control in Urban Green Areas.

    Science.gov (United States)

    Lumbierres, Belén; Madeira, Filipe; Pons, Xavier

    2018-01-12

    Oenopia conglobata is one of the most common ladybird species in urban green areas of the Mediterranean region. We have obtained data about its prey acceptability and prey preferences. In a laboratory experiment, we investigated the acceptability of seven aphid and one psyllid species as prey for this coccinellid: the aphids Chaitophorus populeti, Aphis gossypii , Aphis craccivora Monelliopsis caryae , Eucallipterus tiliae , Aphis nerii (on white poplar, pomegranate, false acacia, black walnut, lime, and oleander, respectively), and the psyllid Acizzia jamatonica on Persian silk tree. These species are abundant in urban green areas in the Mediterranean region. In addition, we tested the acceptability of Rhopalosiphum padi on barley, an aphid species easily reared in the laboratory. We also tested preferences of the predator in cafeteria experiments with three aphid species and one aphid and the psyllid. Adults and larvae of the coccinellid accepted all of the preys offered, except A. nerii , with a clear preference for M. caryae . The predator also showed preference for M. caryae when it was offered in a cafeteria experiment with other aphid species or with the psyllid. The aphid R. padi obtained a good acceptability and could be used for rearing O. conglobata in the laboratory.

  17. Purification and characterization of a lectin with high hemagglutination property isolated from Allium altaicum.

    Science.gov (United States)

    Upadhyay, Santosh Kumar; Saurabh, Sharad; Singh, Rahul; Rai, Preeti; Dubey, Neeraj Kumar; Chandrashekar, K; Negi, Kuldeep Singh; Tuli, Rakesh; Singh, P K

    2011-08-01

    A lectin was purified from the leaves of Allium altaicum and corresponding gene was cloned. The lectin namely Allium altaicum agglutinin (AAA) was ~24 kDa homodimeric protein and similar to a typical garlic leaf lectin. It was synthesized as 177 amino acid residues pre-proprotein, which consisted of 28 and 43 amino acid long N and C-terminal signal peptides, respectively. The plant expressed this protein more in scapes and flowers in comparison to the bulbs and leaves. Hemagglutination activity (with rabbit erythrocytes) was 1,428 fold higher as compared to Allium sativum leaf agglutinin (ASAL) although, the insecticidal activity against cotton aphid (Aphis gossypii) was relatively low. Glycan array revealed that AAA had higher affinity towards GlcAb1-3Galb as compared to ASAL. Homology analysis showed 57-94% similarity with other Allium lectins. The mature protein was expressed in E. coli as a fusion with SUMO peptide in soluble and biologically active form. Recombinant protein retained high hemagglutination activity.

  18. Surtos populacionais de Bemisia tabaci no estado de São Paulo Outbreaks of Bemisia tabaci in the São Paulo State, Brazil

    Directory of Open Access Journals (Sweden)

    André Luiz Lourenção

    1994-01-01

    Full Text Available A partir de 1991, tem sido observada a presença da mosca-branca Bemisia tabaci (Genn. (Homoptera: Aleyrodidae em altas populações em hortaliças e orna-mentais nos municípios paulistas de Paulínia, Holambra, Jaguariúna e Artur Nogueira. Foram constatadas infestações severas em tomateiro, brócolos, berinjela e aboboreira; nesta última, o sintoma observado em plantas infestadas pela mosca-branca é o prateamento da face superior das folhas, em conjunto com queda drástica da produção. Uma lavoura de tomate severamente infestada por B. tabaci apresentava o sintoma referido colo amadurecimento irregular dos frutos do tomateiro; plantas invasoras presentes nessa área também foram intensamente colonizadas, principalmente Sida rhombifolia L., Sonchus oleraceus L., Solanum viarum Dun. e Ipomoea acuminata Roem. & Schult. Em Holambra, verificaram-se ataques intensos em plantas ornamentais, principalmente crisântemo (Chrysantemum morifolium Ramat. e bico-de-papagaio (Euphorbia pulcherrima Willd.; roseiras foral pouco colonizadas. Nessas hortaliças e nas ornamentais, a aplicação quase diária de inseticidas não reduziu a infestação do inseto. Além dessas plantas, campos de algodão, em Holambra, e de feijão, em Paulínia, também foram infestados por B. tabaci. Nos E.U.A., a capacidade de certas populações de B. tabaci de induzir o prateamento da folha em aboboreira e de colonizar intensamente E. pulcherrima, entre outros fatores, têm levado à distinção do biótipo "B" ou "poinsétia", nome vulgar dessa euforbiácea; todavia, estudos recentes na Califórnia (E.U.A. mostram a possibilidade de se tratar de duas espécies distintas. Dada a similaridade entre as infestações associadas a B. tabaci que vêm ocorrendo naquele país e, mais recentemente, no Brasil, é provável que o biótipo B ou essa nova espécie tenha sido aqui introduzido.Since 1991, an increase in the populations of the whitefly Bemisia tabaci (Genn. (Homoptera

  19. Alimentação e fator de condição de peixes characidiíneos no sistema do Ribeirão Grande, Sudeste do Brasil - DOI: 10.4025/actascibiolsci.v27i3.1336 Feeding and condition factor of characidiin fish in Ribeirão Grande system, Southeastern Brazil - DOI: 10.4025/actascibiolsci.v27i3.1336

    Directory of Open Access Journals (Sweden)

    Francisco Manoel de Souza Braga

    2005-03-01

    Full Text Available Os peixes foram amostrados quatro vezes em cada local, de julho de 2001 a abril de 2002: inverno (julho de 2001, primavera (outubro de 2001, verão (fevereiro de 2002 e outono (abril de 2002. Foram amostrados segmentos de cinco riachos no sistema do Ribeirão Grande (22o 47’ 08’’ S, 45o 28’ 17’’W. Coletas quantitativas foram feitas com um aparelho de pesca-elétrica ligado a um gerador com capacidade máxima de 1.500 V e 8,7 A de 600 Hz de corrente alternada. Alimentação, mudanças na gordura visceral e fator de condição foram comparados em duas espécies de characidiíneos, Characidium lauroi e C. Alipioi do sistema do Ribeirão Grande, sudeste do Brasil. Nas dietas das duas espécies ninfas de Ephemeroptera, foram registradas larvas de Diptera (Chironomidae, Simuliidae, ninfas de Plecoptera, larvas de Trichoptera (Hydroptilidae, Psychoyiidae, insetos terrestres (Coleoptera, Isoptera, Hemiptera [Heteroptera, Homoptera], larvas de Megaloptera (Corydalidae, Arachnida, Ostracoda e restos vegetais. A gordura visceral decresceu em fevereiro, coincidindo com o declínio do fator de condição em ambas as espécies. O aumento da atividade alimentar durante o verão proporciona o acúmulo de gordura. Durante as estações seguintes, esses peixes devem utilizar as reservas de gordura visceral para manutenção e reproduçãoFeeding, seasonal changes in visceral fat and condition factor were compared in two species of characidiin fishes, Characidium lauroi and C. alipioi from Ribeirão Grande system, southeastern Brazil. Five streams of Ribeirão Grande system were sampled (22o 47’ 08’’ S, 45o 28’ 17’’W. The samples were taken four times per site, from July, 2001 to April, 2002: winter (July 2001, spring (October 2001, summer (February 2002 and autumn (April 2002. Quantitative collections were made with an electro-fishing device powered by a generator with maximum capacity of 1,500 V and 8.7 A of 60 Hz alternating current

  20. Shallot aphids, Myzus ascalonicus, in strawberry: biocontrol potential of three predators and three parasitoids.

    Science.gov (United States)

    Enkegaard, Annie; Sigsgaard, Lene; Kristensen, Kristian

    2013-01-01

    The parasitization capacity of 3 parasitoids and the predation capacity of 3 predators towards the shallot aphid, Myzus ascalonicus Doncaster (Homoptera: Aphididae), on strawberry, Fragaria x ananassa Duchesne (Rosales: Rosaceae) cv. Honeoye, were examined in laboratory experiments. In Petri dish assays, both Aphidius colemani Viereck (Hymenoptera: Aphidiidae) and A. ervi Haliday readily stung shallot aphids, with no significant difference in stinging frequency between the two species. A. ervi induced a significantly higher mortality (79.0 ± 7.2%) in terms of stung aphids compared with A. colemani (55.3 ± 4.1%); however, only a minor fraction (2.7 ± 1.8% and 7.1 ± 3.1%, respectively) of the killed aphids resulted in formation of mummies, presumably due to a physiological response to parasitism. The low percentage of mummification precludes the use of either Aphidius species in anything but inundative biocontrol. In similar set-ups, Aphelinus abdominalis (Dalman) (Hymenoptera: Aphelinidae) killed almost half (49.6 ± 5.3%) of the exposed aphids through host feeding. In addition, 23.2 ± 7.3% of non-host-fed aphids developed into mummified aphids, and 38.1 ± 13.2% of non-host-fed aphids died from other parasitoid-induced causes. However, the host feeding rate was reduced to only 1.2 ± 0.8%, and no significant parasitization mortality was observed on strawberry plants, suggesting that host plants interfered with A. abdominalis activity. This parasitoid does not, therefore, seem to be suited to either inoculative or inundative biocontrol of shallot aphids in strawberry. The three predators studied were the green lacewing, Chrysoperla carnea Steph. (Neuroptera: Chrysopidae), the two-spotted lady beetle, Adalia bipunctata L. (Coleoptera: Coccinellidae), and the gall midge Aphidoletes aphidimyza (Rondani) (Diptera: Cecidomyiidae). Third instars of all 3 predators readily preyed upon the shallot aphid in Petri dish set-ups with significant differences in daily

  1. Relationship of coarse woody debris to arthropod Availability for Red-Cockaded Woodpeckers and other bark-foraging birds on loblolly pine boles.

    Energy Technology Data Exchange (ETDEWEB)

    Horn, Scott; Hanula, James, L.

    2008-04-01

    Abstract This study determined if short-term removal of coarse woody debris would reduce prey available to red-cockaded woodpeckers (Picoides borealis Vieillot) and other bark-foraging birds at the Savannah River Site in Aiken and Barnwell counties, SC. All coarse woody debris was removed from four 9-ha plots of mature loblolly pine (Pinus taeda L.) in 1997 and again in 1998. We sampled arthropods in coarse woody debris removal and control stands using crawl traps that captured arthropods crawling up tree boles, burlap bands wrapped around trees, and cardboard panels placed on the ground. We captured 27 orders and 172 families of arthropods in crawl traps whereas 20 arthropod orders were observed under burlap bands and cardboard panels. The most abundant insects collected from crawl traps were aphids (Homoptera: Aphididae) and ants (Hymenoptera: Forrnicidae). The greatest biomass was in the wood cockroaches (Blattaria: Blattellidae), caterpillars (Lepidoptera) in the Family Noctuidae, and adult weevils (Coleoptera: Curculionidae). The most common group observed underneath cardboard panels was lsoptera (termites), and the most common taxon under burlap bands was wood cockroaches. Overall, arthropod abundance and biomass captured in crawl traps was similar in control and removal plots. In contrast, we observed more arthropods under burlap bands (mean & SE; 3,021.5 k 348.6, P= 0.03) and cardboard panels (3,537.25 k 432.4, P= 0.04) in plots with coarse woody debris compared with burlap bands (2325 + 171.3) and cardboard panels (2439.75 + 288.9) in plots where coarse woody debris was removed. Regression analyses showed that abundance beneath cardboard panels was positively correlated with abundance beneath burlap bands demonstrating the link between abundance on the ground with that on trees. Our results demonstrate that short-term removal of coarse woody debris from pine forests reduced overall arthropod availability to bark-foraging birds.

  2. Vitex agnus-castus is a preferred host plant for Hyalesthes obsoletus.

    Science.gov (United States)

    Sharon, Rakefet; Soroker, Victoria; Wesley, S Daniel; Zahavi, Tirtza; Harari, Ally; Weintraub, Phyllis G

    2005-05-01

    Hyalesthes obsoletus Signoret (Homoptera: Cixiidae) is a polyphagous planthopper that transmits stolbur phytoplasma (a causative agent of "yellows" disease) to various weeds, members of the Solanaceae, and wine grapes (Vitis vinifera L.) in Europe and the Middle East. Planthoppers were collected by hand vacuuming eight native plant species. Vitex agnus-castus L., a shrub in the Verbenaceae, hosted the largest number of H. obsoletus, although Olea europaea L. also served as a host for adults. Using a Y-olfactometer, we compared the planthoppers relative preference for V. agnus-castus, Convolvulus arvensis, and V. vinifera. V. agnus-castus was more attractive to both male and female H. obsoletus than the other plants. H. obsoletus antennal response was stronger to volatiles collected from V. agnuscastus than from Cabernet Sauvignon variety of V. vinifera. To determine if V. agnus-castus would serve as a reservoir for the pathogen, H. obsoletus were collected from leaf and stem samples of native V. agnus-castus, and were tested by polymerase chain reaction (PCR) for the presence of phytoplasma DNA. While 14% and 25% (2003 and 2004, respectively) of the insects tested positive for phytoplasma DNA, none of the plant samples tested positive. To determine if V. agnus-castus could serve as a host plant for the development of the planthopper, we placed emergence cages beneath field shrubs and enclosed wild-caught H. obsoletus in a cage with a potted young shrub. We found adult H. obsoletus in the emergence cases and planthopper nymphs in the soil of the potted plant. We concluded that V. agnus-castus is attractive to H. obsoletus, which seems to be refractory to phytoplasma infections and warrants further testing as a trap plant near vineyards.

  3. The interactive effects of pulsed grazing disturbance and patch size vary among wetland arthropod guilds.

    Directory of Open Access Journals (Sweden)

    Anna R Armitage

    Full Text Available Pulse disturbances and habitat patch size can determine community composition independently or in concert, and may be particularly influential on small spatial scales for organisms with low mobility. In a field experiment, we investigated whether the effects of a pulsed disturbance that simulated a grazing event varied with habitat patch size. We focused on the short-term responses of multiple co-occurring emergent salt marsh arthropods with differing levels of mobility and dispersal potential. As part of a marsh restoration project, two types of emergent marsh structures were created: small circular mounds (0.5 m diameter separated by several meters of aquatic habitat, and larger, elongated terraces (>50 m long. Study plots (0.25 m(2 were established on both structures; in a subset of plots, we simulated a pulsed grazing disturbance event by clipping the aboveground tissue of emergent plants, primarily Spartina alterniflora. At the end of the two-month recovery period, Ischnodemus (Hemiptera: Blissidae density was over 50% lower in disturbed treatments within both large (terrace and small (mound patches. Predatory spider treatment responses were similar to Ischnodemus responses, suggesting a trophic relationship between those two arthropod groups. Alternatively, spiders may have been directly affected by the loss of shelter in the disturbed plots. Prokelisia (Homoptera: Delphacidae, which are generally more mobile than Ischnodemus, were not affected by disturbance treatment or by patch size, suggesting the potential for rapid recolonization following disturbance. Larval stem borers decreased by an order of magnitude in disturbed plots, but only in the large patches. In general, the disturbance effects of vegetation removal on arthropod density and community composition were stronger than patch size effects, and there were few interactions between pulsed disturbance and patch size. Rather, emergent marsh arthropod responses to disturbance and

  4. Behavioral responses of the leafhopper, Cicadulina storeyi China, a major vector of maize streak virus, to volatile cues from intact and leafhopper-damaged maize.

    Science.gov (United States)

    Oluwafemi, Sunday; Bruce, Toby J A; Pickett, John A; Ton, Jurriaan; Birkett, Michael A

    2011-01-01

    The chemical ecology of the leafhopper, Cicadulina storeyi China (Homoptera: Cicadellidae), an important vector of Maize Streak Virus (MSV), was studied with a view to developing novel leafhopper control strategies in sub-Saharan Africa. Choice tests using a Y-tube olfactometer revealed that odors from uninfested maize seedlings (Zea mays cv. Delprim) were significantly more attractive to C. storeyi than odors from C. storeyi-infested seedlings. Headspace samples of volatile organic compounds (VOCs) collected from 10 to 12 day-old uninfested seedlings were more attractive than those collected from infested seedlings. While VOCs collected from uninfested maize seedlings were attractive, VOCs collected from C. storeyi-infested seedlings were significantly repellent. Analysis of the collected VOCs by gas chromatography (GC) and coupled GC-mass spectrometry (GC-MS) led to the identification of myrcene, linalool, (E)-2-decen-1-ol, and decanal from uninfested seedlings, and (Z)-3-hexenyl acetate, (E)-4,8-dimethyl-1,3,7-nonatriene (DMNT), methyl salicylate, benzyl acetate, indole, geranyl acetate, (E)-caryophyllene, α-bergamotene, (E)-β-farnesene, β-sesquiphellandrene, and (E,E)-4,8,12-trimethyl-1,3,7,11-tridecatetraene (TMTT) from infested seedlings. Of these, methyl salicylate, (E)-caryophyllene, (E)-β-farnesene, and TMTT were identified previously as volatile semiochemicals involved in plant defense against other sucking insect pests. When tested individually for behavioral activity, all compounds were repellent for C. storeyi. Moreover, when these induced VOCs were added to the blend of VOCs from uninfested maize seedlings, a shift from attraction to repellency was observed. Addition of methyl salicylate, (E)-β-farnesene, or TMTT resulted in a choice for the solvent control (i.e., repulsion), whereas addition of (E)-caryophyllene resulted in no reduction in host VOC attractiveness. These results show that VOCs induced in maize have the potential to be exploited

  5. Comparative Proteomic Analysis of Susceptible and Resistant Rice Plants during Early Infestation by Small Brown Planthopper

    Directory of Open Access Journals (Sweden)

    Yan Dong

    2017-10-01

    Full Text Available The small brown planthopper (Laodelphax striatellus Fallén, Homoptera, Delphacidae-SBPH is one of the major destructive pests of rice (Oryza sativa L.. Understanding on how rice responds to SBPH infestation will contribute to developing strategies for SBPH control. However, the response of rice plant to SBPH is poorly understood. In this study, two contrasting rice genotypes, Pf9279-4 (SBPH-resistant and 02428 (SBPH-susceptible, were used for comparative analysis of protein profiles in the leaf sheath of rice plants in responses to SBPH infestation. One hundred and thirty-two protein spots that were differentially expressed between the resistant and susceptible rice lines were identified with significant intensity differences (≥2-fold, P < 0.05 at 0, 6, and 12 h after SBPH infestation. Protein expression profile analysis in the leaf sheath of SBPH-resistant and SBPH-susceptible rice lines after SBPH infestation showed that proteins induced by SBPH feeding were involved mainly in stress response, photosynthesis, protein metabolic process, carbohydrate metabolic process, energy metabolism, cell wall-related proteins, amino acid metabolism and transcriptional regulation. Gene expression analysis of 24 differentially expressed proteins (DEPs showed that more than 50% DEPs were positively correlated with their mRNA levels. Analysis of some physiological indexes mainly involved in the removal of oxygen reactive species showed that the levels of superoxide dismutase (SOD and glutathione (GSH were considerably higher in Pf9279-4 than 02428 during SBPH infestation. The catalase (CAT activity and hydroxyl radical inhibition were lower in Pf9279-4 than 02428. Analysis of enzyme activities indicates that Pf9279-4 rice plants defend against SBPH through the activation of the pathway of the salicylic acid (SA-dependent systemic acquired resistance. In conclusion, this study provides some insights into the molecular networks involved on cellular and

  6. Introduced and invasive insect species in the Czech Republic and their economic and ecological impact (Insecta

    Directory of Open Access Journals (Sweden)

    Hana Šefrová

    2005-01-01

    Full Text Available A total of 383 alien insect species were registered in the Czech Republic, which represents 1.4% of local fauna. The most numerous taxonomic groups are Homoptera (116 species, 30.3%, Coleoptera (110; 28.7% and Lepidoptera (37; 9.7%. The occurrence of 200 species (52.2% are limited to closed heated spaces, casual aliens (28; 7.3% infiltrate the outdoor environment for a short term only, 36 (9.4% naturalized non-invasive species do not spread from the location of introduction, 50 (13.1% species are post-invasive and 69 (18.0% invasive. From the species registered, 61 (15.9% are stored product pests (especially Coleoptera 36 species, Psocoptera 11, and Lepidoptera 9, 50 (13.1% are plant pests indoors (especially Coccinea 33 species, Aphidinea 7, and Thysanoptera 6, 25 (i.e. 6.5% of aliens are pests in agriculture, forestry, and in ornamental cultures, 15 species (3.9% are important animal parasites, and 5 species (1.3% can affect biodiversity. Of the remaining 227 species (59.3%, no economic or ecological effects were found. The origin of most of the species living eusynanthropically is in the tropics and subtropics; of the 155 naturalized (non-invasive, post-invasive, and invasive species, 42 (27.1% originate from the Mediterranean, 36 (23.2% from North America, 28 (18.1% from Central to Southwest Asia, 14 (9.0% from East Asia, 13 (8.4% from South and Southeast Asia, with the remaining 22 species (14.2% coming from other areas.

  7. ASSESSING OF HERBIVOROUS AND BENEFICIAL INSECTS ON SWITCHGRASS IN UKRAINE.

    Science.gov (United States)

    Stefanovska, T; Kucherovska, S; Pisdlisnyuk, V

    2014-01-01

    A perennial switchgrass, (Panicum virgatum L.), (C4) that is native to North America has good potential for biomass production because of its wide geographic distribution and adaptability to diverse environmental conditions. Insects can significantly impact the yield and quality of biofuel crops. If switchgrass are to be grown on marginally arable land or in monoculture, it are likely to be plagued with herbivore pests and plant diseases at a rate that exceeds what would be expected if the plants were not stressed in this manner. This biofuel crop has been under evaluation for commercial growing in Ukraine for eight years. However, insect diversity and the potential impact of pests on biomass production of this feedstock have not been accessed yet. The objective of our study, started in 2011, is a survey of switch grass insects by trophic groups and determine species that have pest status at two sites in the Central part of Ukraine (Kiev and Poltava regions). In Poltava site we investigated the effect of nine varieties of switchgrass (lowland and upland) to insects' diversity. We assessed changes over time in the densities of major insects' trophic groups, identifying potential pests and natural enemies. Obtained results indicates that different life stages of herbivorous insects from Hymenoptera, Homoptera, Diptera and Coleoptera orders were present on switchgrass during the growing season. Our study results suggests that choice of variety has an impact on trophic groups' structure and number of insects from different orders on swicthgrass. Herbivores and beneficial insects were the only groups that showed significant differences across sampling dates. The highest population of herbivores insects we recorded on 'Alamo' variety for studied years, although herbivore diversity tended to increase on 'Shelter', 'Alamo' and 'Cave-in-Rock' during 2012 and 2013. 'Dacotah', 'Nebraska', 'Sunburst', 'Forestburg' and 'Carthage' showed the highest level of beneficial insects

  8. Economic evaluation of the effects of planting date and application rate of imidacloprid for management of cereal aphids and barley yellow dwarf in winter wheat.

    Science.gov (United States)

    Royer, T A; Giles, K L; Nyamanzi, T; Hunger, R M; Krenzer, E G; Elliot, N C; Kindler, S D; Payton, M

    2005-02-01

    The effects of planting date and application rate of imidacloprid for control of Schizaphis graminum Rondani, Rhopalosiphum padi L. (Homoptera: Aphididae), and barley yellow dwarf virus (BYDV) in hard red winter wheat were studied. The first experiment was conducted from 1997 to 1999 at two locations and consisted of three planting dates and four rates of imidacloprid-treated seed. The second experiment was conducted from 2001 to 2002 in Stillwater, OK, and consisted of two varieties of hard red winter wheat seed and four rates of imidacloprid. Aphid densities, occurrence of BYDV, yield components, and final grain yield were measured, and yield differences were used to estimate the economic return obtained from using imidacloprid. In the first study, aphid populations responded to insecticide rate in the early and middle plantings, but the response was reduced in the late planting. Yields increased as insecticide rate increased but did not always result in a positive economic return. In the second study, imidacloprid seed treatments reduced aphid numbers and BYD occurrence, protected yield, and resulted in a positive economic return. The presence of aphids and BYDV lowered yield by reducing fertile head density, total kernel weight, and test weight. Whereas the application of imidacloprid seed treatments often provided positive yield protection, it did not did not consistently provide a positive economic return. A positive economic return was consistently obtained if the cereal aphid was carrying and transmitting BYDV and was more likely to occur if wheat was treated with a low rate if imidacloprid and planted in a "dual purpose" planting date window.

  9. How to decrease the negative effects of medium intensity disturbances on arthropod communities

    Directory of Open Access Journals (Sweden)

    G. Györffy

    2001-02-01

    Full Text Available One of the major goals in nature conservation practice is to optimise the timing or the method of treatments or both. We studied the response of the Auchenorrhyncha (Insecta: Homoptera assemblage to annual mowing in three different locations along an elevation gradient of a mesic grassland. Several weeks after mowing, the total number of imagoes and larvae decreased considerably, and the relative abundance differences between populations at different elevations also decreased, reflecting the density dependent effect of this treatment. The rate of changes in species composition was greatest in the microhabitats with more comfortable microclimates, in the opposite direction of the alteration of abundance, perhaps interfering with the migration. By the next spring the fauna of the wettest habitat proved to be the most sensitive to mowing and the most different from the others. The overall similarity of the insect communities increased, i.e. the community-level biodiversity decreased due to homogenising effect of mowing. In a heteromorphous habitat, the variability of spatio-temporal dynamics of the populations makes it impossible to find either single optimal time or optimal rotation plan for treatment based on the habitat types. For this reason, we suggest mowing in stripes parallel to the elevation gradient, which would mean synchronous treatment of each microhabitat instead of randomly chosen patches, where the execution is problematic. It is easier to keep the ratio of treated to untreated areas at 50%. Stripes should be narrow enough to provide the possibility of migration to favourable habitat patches, and should not hinder mechanical mowing. Suggested width of stripes is 10–15 m for Auchenorrhyncha.

  10. Macrofauna edáfica asociada con sistemas agroforestales en la Amazonía Colombiana

    Directory of Open Access Journals (Sweden)

    Juan Carlos Suárez Salazar

    2015-07-01

    Full Text Available La densidad, riqueza y diversidad de la macrofauna edáfica son afectadas, entre otros factores, por la configuración de los agroecosistemas y la estacionalidad de la precipitación. Con el fin de evaluar estos efectos en mayo y noviembre de 2011, correspondientes a épocas de máxima y mínima precipitación, respectivamente, se realizaron estudios sobre la composición de la macrofauna edáfica asociada con los arreglos agroforestales ubicados en el Centro de Investigaciones Macagual Cesar Augusto Estrada González, Amazonia, Caquetá, Colombia. El experimento se dispuso en un diseño completo al azar bifactorial con cuatro tratamientos (arreglos agroforestales: AB = abarco - Cariniana pyriformis Miers; CH = caucho Hevea brasiliensis (Willd. ex A. Juss. Müll. Arg. ; CP = caucho-parica Schizolobium amazonicum Huber; UV = uvito Genipa Americana L. y dos épocas (máxima y mínima precipitación, y cuatro repeticiones en parcelas divididas. Para explorar las relaciones entre los órdenes de macrofauna, se realizó un análisis de componentes principales y se evalúo el efecto de los arreglos agroforestales con una prueba de Monte Carlo. Los resultados mostraron que la densidad de la macrofauna fue mayor en el periodo de máxima precipitación (1129 individuos en comparación con el de mínima (598 individuos. Los arreglos agroforestales influyen sobre la presencia o ausencia de algunos grupos taxonómicos (P < 0.05 como Homoptera (Insecta y Raphidioptera (Insecta; además los UV y AB pueden favorecer a la macrofauna del estrés por sequía

  11. Genetic structure of the aphid, Chaetosiphon fragaefolii, and its role as a vector of the Strawberry Yellow Edge Virus to a native strawberry, Fragaria chiloensis in Chile.

    Science.gov (United States)

    Lavandero, Blas; Rojas, Pamela; Ramirez, Claudio C; Salazar, Marcela; Caligari, Peter D S

    2012-01-01

    The monoecious anholocyclical aphid, Chaetosiphon fragaefolii (Cockerell) (Homoptera: Aphididae), was collected on a native strawberry, Fragaria chiloensis (L.) Duchesne (Rosales: Rosaceae) from different sites in Chile. The presence of this aphid was recorded during two consecutive years. F. chiloensis plants were collected from seven natural and cultivated growing areas in central and southern Chile. Aphids were genotyped by cross-species amplification of four microsatellite loci from other aphid species. In addition, the aphid borne virus Strawberry mild yellow edge virus was confirmed in F. chiloensis plants by double-antibody sandwich ELISA and RT-PCR. Genetic variability and structure of the aphid populations was assessed from the geo-referenced individuals through AMOVA and a Bayesian assignment test. The presence of C. fragaefolii, during the two-year study was detected in only four of the seven sites (Curepto, Contulmo, Chilián and Cucao). Genetic variation among these populations reached 19% of the total variance. When assigning the individuals to groups, these were separated in three genetic clusters geographically disjunct. Of the seven sampled sites, six were positive for the virus by RT-PCR, and five by double-antibody sandwich ELISA . The incidence of the virus ranged from 0-100%. Presence of the virus corresponded with the presence of the aphid in all but two sites (Chilian and Vilches). The greatest incidence of Strawberry mild yellow edge virus was related to the abundance of aphids. On the other hand, sequences of the coat protein gene of the different virus samples did not show correspondence with either the genetic groups of the aphids or the sampling sites. The genetic structure of aphids could suggest that dispersal is mainly through human activities, and the spread to natural areas has not yet occurred on a great scale.

  12. Insect emergence in relation to floods in wet meadows and swamps in the River Dalälven floodplain.

    Science.gov (United States)

    Vinnersten, T Z Persson; Östman, Ö; Schäfer, M L; Lundström, J O

    2014-08-01

    Annual variation in flood frequency and hydroperiod during the vegetation season has ecological impacts on the floodplain biota. Although many insect groups may have a lower emergence during a flood event, it is poorly known how annual emergence of insects in temporary wetlands is related to the variation in hydrology. Between May and September, we studied the weekly emergence of 18 insect taxa over six consecutive years, 2002-2007, in six temporary flooded wetlands (four wet meadows and two forest swamps) in the River Dalälven floodplains, Central Sweden. We used emergence traps to collect emerging insects from terrestrial and aquatic parts of wet meadows and swamp forests. In all wetlands, the insect fauna was numerically dominated by the orders Diptera, Hymenoptera, Coleoptera and Homoptera. On a weekly basis, 9 out of the 18 insect taxa had lower emergence in weeks with flood than in weeks with no flood, whereas no taxon had a higher emergence in weeks with flood. Over the seasons, we related insect emergence to seasonal flood frequency and length of hydroperiod. The emergence of most studied taxa decreased with increasing hydroperiod, which suggests that emergence after floods do not compensate for the reduced emergence during floods. Only Culicidae and the aquatic Chironomidae sub-families Tanypodinae and Chironominae showed an increase in emergence with increasing hydroperiod, whereas Staphylinidae peaked at intermediate hydroperiod. We conclude that a hydroperiod covering up to 40% of the vegetation season has a significant negative effect on the emergence of most taxa and that only a few taxa occurring in the temporary wetlands are actually favoured by a flood regime with recurrent and unpredictable floods.

  13. Temporal Dynamics of Arthropods on Six Tree Species in Dry Woodlands on the Caribbean Island of Puerto Rico

    Science.gov (United States)

    Beltrán, William; Wunderle, Joseph M.

    2014-01-01

    Abstract The seasonal dynamics of foliage arthropod populations are poorly studied in tropical dry forests despite the importance of these studies for understanding arthropod population responses to environmental change. We monitored the abundance, temporal distributions, and body size of arthropods in five naturalized alien and one native tree species to characterize arthropod seasonality in dry novel Prosopis–Leucaena woodlands in Puerto Rico. A branch clipping method was used monthly to sample foliage arthropod abundance over 39 mo. Seasonal patterns of rainfall and abundance within various arthropod taxa were highly variable from year to year. Abundance for most taxa did not show significant seasonality over the 3 yr, although most taxa had abundance peaks each year. However, Homoptera displayed high seasonality with significant temporal aggregations in each year. Formicidae, Orthoptera, and Coleoptera showed high variation in abundance between wet and dry periods, whereas Hemiptera were consistently more abundant in the wet period. Seasonal differences in mean abundance were found only in a few taxa on Tamarindus indica L. , Bucida buceras L. , Pithecellobium dulce , and (Roxburgh) Benth. Mean arthropod abundance varied among tree species, with highest numbers on Prosopis juliflora , (Swartz) De Candolle, Pi. dulce , Leucaena leucocephala , and (Lamarck) de Wit. Abundance of Araneae, Orthoptera, Coleoptera, Lepidoptera larvae, and all arthropods showed weak relationships with one or more climatic variables (rainfall, maximum temperature, or relative humidity). Body size of arthropods was usually largest during the dry periods. Overall, total foliage arthropod abundance showed no consistent seasonality among years, which may become a more common trend in dry forests and woodlands in the Caribbean if seasonality of rainfall becomes less predictable. PMID:25502036

  14. Temporal dynamics of arthropods on six tree species in dry woodlands on the Caribbean Island of Puerto Rico.

    Science.gov (United States)

    Beltrán, William; Wunderle, Joseph M

    2014-01-01

    The seasonal dynamics of foliage arthropod populations are poorly studied in tropical dry forests despite the importance of these studies for understanding arthropod population responses to environmental change. We monitored the abundance, temporal distributions, and body size of arthropods in five naturalized alien and one native tree species to characterize arthropod seasonality in dry novel Prosopis-Leucaena woodlands in Puerto Rico. A branch clipping method was used monthly to sample foliage arthropod abundance over 39 mo. Seasonal patterns of rainfall and abundance within various arthropod taxa were highly variable from year to year. Abundance for most taxa did not show significant seasonality over the 3 yr, although most taxa had abundance peaks each year. However, Homoptera displayed high seasonality with significant temporal aggregations in each year. Formicidae, Orthoptera, and Coleoptera showed high variation in abundance between wet and dry periods, whereas Hemiptera were consistently more abundant in the wet period. Seasonal differences in mean abundance were found only in a few taxa on Tamarindus indica L., Bucida buceras L., Pithecellobium dulce, and (Roxburgh) Benth. Mean arthropod abundance varied among tree species, with highest numbers on Prosopis juliflora, (Swartz) De Candolle, Pi. dulce, Leucaena leucocephala, and (Lamarck) de Wit. Abundance of Araneae, Orthoptera, Coleoptera, Lepidoptera larvae, and all arthropods showed weak relationships with one or more climatic variables (rainfall, maximum temperature, or relative humidity). Body size of arthropods was usually largest during the dry periods. Overall, total foliage arthropod abundance showed no consistent seasonality among years, which may become a more common trend in dry forests and woodlands in the Caribbean if seasonality of rainfall becomes less predictable. © The Author 2014. Published by Oxford University Press on behalf of the Entomological Society of America.

  15. Índice de diversidade para entomofauna da bracatinga (Mimosa scabrella Benth..

    Directory of Open Access Journals (Sweden)

    Ervandil Corrêa Costa

    2009-09-01

    Full Text Available Normal 0 21 false false false MicrosoftInternetExplorer4 No período de abril de 1983 a setembro de 1984, efetuou-se o levantamento da entomofauna da bracatinga, em Almirante Tamandaré, PR. Os levantamentos foram efetuados quinzenalmente em copas de talhões com 8, 42 e 60 meses de idade, através da rede de copa e, de seus respectivos sub-bosques com rede de varredura. Para o cálculo do índice de diversidade utilizou-se a fórmula  alfa = (S-1/log N. Para a tabulação dos dados, optou-se pelas ordens Homoptera, Hemíptera e Coleóptera que apresentaram maior consistência quali-quantitativa. De acordo com os resultados obtidos ficou evidenciado que com o aumento da idade da planta e de seu respectivo sub-bosque ocorre um aumento concomitante e gradativo da diversidade das espécies. Com relação aos dois ecossistemas estudados o sub-bosque apresentou um valor  maior  para  o  índice de diversidade e no que se refere a diversidade das espécies entre famílias, separadamente, Chrysomelidae destacou-se com o mais alto  índice para o ecossistema formado pelas copas e, entre os diferentes sub-bosques destacou-se a família Curculionidae.

  16. Low-metallicity Star Formation (IAU S255)

    Science.gov (United States)

    Hunt, Leslie K.; Madden, Suzanne C.; Schneider, Raffaella

    2009-01-01

    Preface; SOC and LOC; Participants; Life at the conference; Conference photo; Session I. Population III and Metal-Free Star Formation: 1. Open questions in the study of population III star formation S. C. O. Glover, P. C. Clark, T. H. Greif, J. L. Johnson, V. Bromm, R. S. Klessen and A. Stacy; 2. Protostar formation in the early universe Naoki Yoshida; 3. Population III.1 stars: formation, feedback and evolution of the IMF Jonathan C. Tan; 4. The formation of the first galaxies and the transition to low-mass star formation T. H. Greif, D. R. G. Schleicher, J. L. Johnson, A.-K. Jappsen, R. S. Klessen, P. C. Clark, S. C. O. Glover, A. Stacy and V. Bromm; 5. Low-metallicity star formation: the characteristic mass and upper mass limit Kazuyuki Omukai; 6. Dark stars: dark matter in the first stars leads to a new phase of stellar evolution Katherine Freese, Douglas Spolyar, Anthony Aguirre, Peter Bodenheimer, Paolo Gondolo, J. A. Sellwood and Naoki Yoshida; 7. Effects of dark matter annihilation on the first stars F. Iocco, A. Bressan, E. Ripamonti, R. Schneider, A. Ferrara and P. Marigo; 8. Searching for Pop III stars and galaxies at high redshift Daniel Schaerer; 9. The search for population III stars Sperello di Serego Alighieri, Jaron Kurk, Benedetta Ciardi, Andrea Cimatti, Emanuele Daddi and Andrea Ferrara; 10. Observational search for population III stars in high-redshift galaxies Tohru Nagao; Session II. Metal Enrichment, Chemical Evolution, and Feedback: 11. Cosmic metal enrichment Andrea Ferrara; 12. Insights into the origin of the galaxy mass-metallicity relation Henry Lee, Eric F. Bell and Rachel S. Somerville; 13. LSD and AMAZE: the mass-metallicity relation at z > 3 F. Mannucci and R. Maiolino; 14. Three modes of metal-enriched star formation at high redshift Britton D. Smith, Matthew J. Turk, Steinn Sigurdsson, Brian W. O'Shea and Michael L. Norman; 15. Primordial supernovae and the assembly of the first galaxies Daniel Whalen, Bob Van Veelen, Brian W. O

  17. Low-Metallicity Star Formation: From the First Stars to Dwarf Galaxies

    Science.gov (United States)

    Hunt, Leslie K.; Madden, Suzanne C.; Schneider, Raffaella

    2008-12-01

    Preface; SOC and LOC; Participants; Life at the conference; Conference photo; Session I. Population III and Metal-Free Star Formation: 1. Open questions in the study of population III star formation S. C. O. Glover, P. C. Clark, T. H. Greif, J. L. Johnson, V. Bromm, R. S. Klessen and A. Stacy; 2. Protostar formation in the early universe Naoki Yoshida; 3. Population III.1 stars: formation, feedback and evolution of the IMF Jonathan C. Tan; 4. The formation of the first galaxies and the transition to low-mass star formation T. H. Greif, D. R. G. Schleicher, J. L. Johnson, A.-K. Jappsen, R. S. Klessen, P. C. Clark, S. C. O. Glover, A. Stacy and V. Bromm; 5. Low-metallicity star formation: the characteristic mass and upper mass limit Kazuyuki Omukai; 6. Dark stars: dark matter in the first stars leads to a new phase of stellar evolution Katherine Freese, Douglas Spolyar, Anthony Aguirre, Peter Bodenheimer, Paolo Gondolo, J. A. Sellwood and Naoki Yoshida; 7. Effects of dark matter annihilation on the first stars F. Iocco, A. Bressan, E. Ripamonti, R. Schneider, A. Ferrara and P. Marigo; 8. Searching for Pop III stars and galaxies at high redshift Daniel Schaerer; 9. The search for population III stars Sperello di Serego Alighieri, Jaron Kurk, Benedetta Ciardi, Andrea Cimatti, Emanuele Daddi and Andrea Ferrara; 10. Observational search for population III stars in high-redshift galaxies Tohru Nagao; Session II. Metal Enrichment, Chemical Evolution, and Feedback: 11. Cosmic metal enrichment Andrea Ferrara; 12. Insights into the origin of the galaxy mass-metallicity relation Henry Lee, Eric F. Bell and Rachel S. Somerville; 13. LSD and AMAZE: the mass-metallicity relation at z > 3 F. Mannucci and R. Maiolino; 14. Three modes of metal-enriched star formation at high redshift Britton D. Smith, Matthew J. Turk, Steinn Sigurdsson, Brian W. O'Shea and Michael L. Norman; 15. Primordial supernovae and the assembly of the first galaxies Daniel Whalen, Bob Van Veelen, Brian W. O

  18. Can the motor system resolve a premovement bias in grip aperture? Online analysis of grasping the Müller-Lyer illusion.

    Science.gov (United States)

    Heath, Matthew; Rival, Christina; Binsted, Gordon

    2004-10-01

    The goal of the present investigation was to determine the time-course by which the motor system might resolve the context-dependent effects of a visual illusion [i.e., the Müller-Lyer (ML) figure]. Specifically, we asked participants to scale their grip aperture (GA) to the perceived size of an object embedded within a ML figure in advance of closed-loop (CL) and open-loop (OL) grasping movements. As a result, premovement GA was biased in a direction consistent with the perceptual effects of the illusion. We reasoned that such a manipulation might provide a novel opportunity to determine whether the motor system is able to resolve a biased GA immediately following the onset of a response [i.e., in accord with the perception/action model (PAM); Milner and Goodale 1995, The visual brain in action, Oxford University Press], or gradually as the action unfolds [i.e., in accord with the planning/control model (PCM); Glover and Dixon 2002, Percept Psychophys 64:266-278]. It was found that biasing GA in advance of movement resulted in a reliable effect of the ML figure throughout CL and OL trials (i.e., up to 80% of grasping time). Although the present findings appear contrary to the theoretical tenets of the PAM and the PCM, it is proposed that biasing GA in advance of movement leads to offline visual processing and a feedforward mode of grasping control, thus accounting for the illusion-induced effect throughout the grasping response.

  19. Reef Sharks Exhibit Site-Fidelity and Higher Relative Abundance in Marine Reserves on the Mesoamerican Barrier Reef

    Science.gov (United States)

    Bond, Mark E.; Babcock, Elizabeth A.; Pikitch, Ellen K.; Abercrombie, Debra L.; Lamb, Norlan F.; Chapman, Demian D.

    2012-01-01

    Carcharhinid sharks can make up a large fraction of the top predators inhabiting tropical marine ecosystems and have declined in many regions due to intense fishing pressure. There is some support for the hypothesis that carcharhinid species that complete their life-cycle within coral reef ecosystems, hereafter referred to as “reef sharks”, are more abundant inside no-take marine reserves due to a reduction in fishing pressure (i.e., they benefit from marine reserves). Key predictions of this hypothesis are that (a) individual reef sharks exhibit high site-fidelity to these protected areas and (b) their relative abundance will generally be higher in these areas compared to fished reefs. To test this hypothesis for the first time in Caribbean coral reef ecosystems we combined acoustic monitoring and baited remote underwater video (BRUV) surveys to measure reef shark site-fidelity and relative abundance, respectively. We focused on the Caribbean reef shark (Carcharhinus perezi), the most common reef shark in the Western Atlantic, at Glover's Reef Marine Reserve (GRMR), Belize. Acoustically tagged sharks (N = 34) were detected throughout the year at this location and exhibited strong site-fidelity. Shark presence or absence on 200 BRUVs deployed at GRMR and three other sites (another reserve site and two fished reefs) showed that the factor “marine reserve” had a significant positive effect on reef shark presence. We rejected environmental factors or site-environment interactions as predominant drivers of this pattern. These results are consistent with the hypothesis that marine reserves can benefit reef shark populations and we suggest new hypotheses to determine the underlying mechanism(s) involved: reduced fishing mortality or enhanced prey availability. PMID:22412965

  20. Electric field effect in superconductor-ferroelectric structures

    Science.gov (United States)

    Lemanov, V. V.

    1995-01-01

    Electric field effect (the E-effect) in superconductors has been studied since 1960 when Glover and Sherill published their results on a shift of the critical temperature T(sub c) about 0.1 mK in Sn and In thin films under the action Off the field E=300 kV/cm. Stadler was the first to study the effect or spontaneous polarization of ferroelectric substrate on the electric properties of superconductors. He observed that the reversal of polarization of TGS substrate under action of external electric field in Sn-TGS structures induced the T(sub c) shift in Sn about 1.3 mK. Since in this case the effect is determined not by the electric field but by the spontaneous polarization, we may call this effect the P-effect. High-T(sub c) superconductors opened the new possibilities to study the E- and P-effects due to low charge carrier density, as compared to conventional superconductors, and to anomalously small coherence length. Experiments in this field began in many laboratories but a breakthrough was made where a shift in T(sub c) by 50 mK was observed in YBCO thin films. Much higher effects were observed in subsequent studies. The first experiments on the P-effect in high-T(sub c) superconductors were reported elsewhere. In this report we shall give a short description of study on the P-effect in high-T(sub c) superconductors.

  1. Untangling natural seascape variation from marine reserve effects using a landscape approach.

    Directory of Open Access Journals (Sweden)

    Brittany E Huntington

    Full Text Available Distinguishing management effects from the inherent variability in a system is a key consideration in assessing reserve efficacy. Here, we demonstrate how seascape heterogeneity, defined as the spatial configuration and composition of coral reef habitats, can mask our ability to discern reserve effects. We then test the application of a landscape approach, utilizing advances in benthic habitat mapping and GIS techniques, to quantify this heterogeneity and alleviate the confounding influence during reserve assessment. Seascape metrics were quantified at multiple spatial scales using a combination of spatial image analysis and in situ surveys at 87 patch reef sites in Glover's Reef Lagoon, Belize, within and outside a marine reserve enforced since 1998. Patch reef sites were then clustered into classes sharing similar seascape attributes using metrics that correlated significantly to observed variations in both fish and coral communities. When the efficacy of the marine reserve was assessed without including landscape attributes, no reserve effects were detected in the diversity and abundance of fish and coral communities, despite 10 years of management protection. However, grouping sites based on landscape attributes revealed significant reserve effects between site classes. Fish had higher total biomass (1.5x and commercially important biomass (1.75x inside the reserve and coral cover was 1.8 times greater inside the reserve, though direction and degree of response varied by seascape class. Our findings show that the application of a landscape classification approach vastly improves our ability to evaluate the efficacy of marine reserves by controlling for confounding effects of seascape heterogeneity and suggests that landscape heterogeneity should be considered in future reserve design.

  2. Development of a Short Form of the Five-Factor Narcissism Inventory: the FFNI-SF.

    Science.gov (United States)

    Sherman, Emily D; Miller, Joshua D; Few, Lauren R; Campbell, W Keith; Widiger, Thomas A; Crego, Cristina; Lynam, Donald R

    2015-09-01

    The Five-Factor Narcissism Inventory (FFNI; Glover, Miller, Lynam, Crego, & Widiger, 2012) is a 148-item self-report inventory of 15 traits designed to assess the basic elements of narcissism from the perspective of a 5-factor model. The FFNI assesses both vulnerable (i.e., cynicism/distrust, need for admiration, reactive anger, and shame) and grandiose (i.e., acclaim seeking, arrogance, authoritativeness, entitlement, exhibitionism, exploitativeness, grandiose fantasies, indifference, lack of empathy, manipulativeness, and thrill seeking) variants of narcissism. The present study reports the development of a short-form version of the FFNI in 4 diverse samples (i.e., 2 undergraduate samples, a sample recruited from MTurk, and a clinical community sample) using item response theory. The validity of the resultant 60-item short form was compared against the validity of the full scale in the 4 samples at both the subscale level and the level of the grandiose and vulnerable composites. Results indicated that the 15 subscales remain relatively reliable, possess a factor structure identical to the structure of the long-form scales, and manifest correlational profiles highly similar to those of the long-form scales in relation to a variety of criterion measures, including basic personality dimensions, other measures of grandiose and vulnerable narcissism, and indicators of externalizing and internalizing psychopathology. Grandiose and vulnerable composites also behave almost identically across the short- and long-form versions. It is concluded that the FFNI-Short Form (FFNI-SF) offers a well-articulated assessment of the basic traits comprising grandiose and vulnerable narcissism, particularly when assessment time is limited. (c) 2015 APA, all rights reserved.

  3. Retrospective Correction of Physiological Noise: Impact on Sensitivity, Specificity, and Reproducibility of Resting-State Functional Connectivity in a Reading Network Model.

    Science.gov (United States)

    Krishnamurthy, Venkatagiri; Krishnamurthy, Lisa C; Schwam, Dina M; Ealey, Ashley; Shin, Jaemin; Greenberg, Daphne; Morris, Robin D

    2018-03-01

    It is well accepted that physiological noise (PN) obscures the detection of neural fluctuations in resting-state functional connectivity (rsFC) magnetic resonance imaging. However, a clear consensus for an optimal PN correction (PNC) methodology and how it can impact the rsFC signal characteristics is still lacking. In this study, we probe the impact of three PNC methods: RETROICOR: (Glover et al., 2000 ), ANATICOR: (Jo et al., 2010 ), and RVTMBPM: (Bianciardi et al., 2009 ). Using a reading network model, we systematically explore the effects of PNC optimization on sensitivity, specificity, and reproducibility of rsFC signals. In terms of specificity, ANATICOR was found to be effective in removing local white matter (WM) fluctuations and also resulted in aggressive removal of expected cortical-to-subcortical functional connections. The ability of RETROICOR to remove PN was equivalent to removal of simulated random PN such that it artificially inflated the connection strength, thereby decreasing sensitivity. RVTMBPM maintained specificity and sensitivity by balanced removal of vasodilatory PN and local WM nuisance edges. Another aspect of this work was exploring the effects of PNC on identifying reading group differences. Most PNC methods accounted for between-subject PN variability resulting in reduced intersession reproducibility. This effect facilitated the detection of the most consistent group differences. RVTMBPM was most effective in detecting significant group differences due to its inherent sensitivity to removing spatially structured and temporally repeating PN arising from dense vasculature. Finally, results suggest that combining all three PNC resulted in "overcorrection" by removing signal along with noise.

  4. The parsec-scale relationship between ICO and AV in local molecular clouds

    Science.gov (United States)

    Lee, Cheoljong; Leroy, Adam K.; Bolatto, Alberto D.; Glover, Simon C. O.; Indebetouw, Remy; Sandstrom, Karin; Schruba, Andreas

    2018-03-01

    We measure the parsec-scale relationship between integrated CO intensity (ICO) and visual extinction (AV) in 24 local molecular clouds using maps of CO emission and dust optical depth from Planck. This relationship informs our understanding of CO emission across environments, but clean Milky Way measurements remain scarce. We find uniform ICO for a given AV, with the results bracketed by previous studies of the Pipe and Perseus clouds. Our measured ICO-AV relation broadly agrees with the standard Galactic CO-to-H2 conversion factor, the relation found for the Magellanic clouds at coarser resolution, and numerical simulations by Glover & Clark (2016). This supports the idea that CO emission primarily depends on shielding, which protects molecules from dissociating radiation. Evidence for CO saturation at high AV and a threshold for CO emission at low AV varies remains uncertain due to insufficient resolution and ambiguities in background subtraction. Resolution of order 0.1 pc may be required to measure these features. We use this ICO-AV relation to predict how the CO-to-H2 conversion factor (XCO) would change if the Solar Neighbourhood clouds had different dust-to-gas ratio (metallicity). The calculations highlight the need for improved observations of the CO emission threshold and H I shielding layer depth. They are also sensitive to the shape of the column density distribution. Because local clouds collectively show a self-similar distribution, we predict a shallow metallicity dependence for XCO down to a few tenths of solar metallicity. However, our calculations also imply dramatic variations in cloud-to-cloud XCO at subsolar metallicity.

  5. THE EFFECT OF AGRO-ECOLOGICAL ZONES ON THE INCIDENCE AND DISTRIBUTION OF APHID VECTORS OF PEPPER VEINAL MOTTLE VIRUS, ON CULTIVATED PEPPER (CAPSICUM ANNUUM L. IN NIGERIA

    Directory of Open Access Journals (Sweden)

    A.A. FAJINMI

    2011-11-01

    Full Text Available The distribution of aphid vectors of Pepper veinal mottle virus (PVMV was studied on cultivated pepper between 2003 and 2005 in the major pepper producing areas of the six agro-ecological zones in Nigeria. The aphids were isolated, identified and their transmission ability determined. Population of aphid vectors increased progressively in all the agro-ecological zones from March at the onset of raining season reaching a peak in August and then declining from September at the on set of the dry season. The Humid forest and Derived Savanna agro-ecological zones recorded highest mean population of aphids / leaf and types of aphid’s species compared with other agro-ecological zones. Six species of aphid, Myzus persicae (Sulzer, Aphis gossipii (Glover, Aphis craccivora (Koch, Aphis spiraecola (Patch, Aphis fabae (Blanchard, and Rhopalosiphum maidis (Fitch, were identified on the pepper fields surveyed in all the agro-ecological zones. There was no significant difference in the occurrence of M. persicae, A. gossipii, A. craccivora, and R. maidis while A. spiraecola and A. fabae that varied in occurrence in all the zones. Ability to transmit PVMV to a healthy pepper plants varied in all the identified aphid species but R. maidis was not able to transmit PVMV from infected to a healthy pepper plant. A more sustainable approach to controlling pepper viruses is by targeting the aphid vectors and preventing the vectors from reaching the crops because the aphid vectors which are virus specific are the major means of transmitting virus to healthy plant.

  6. A comparison of the criterion validity of popular measures of narcissism and narcissistic personality disorder via the use of expert ratings.

    Science.gov (United States)

    Miller, Joshua D; McCain, Jessica; Lynam, Donald R; Few, Lauren R; Gentile, Brittany; MacKillop, James; Campbell, W Keith

    2014-09-01

    The growing interest in the study of narcissism has resulted in the development of a number of assessment instruments that manifest only modest to moderate convergence. The present studies adjudicate among these measures with regard to criterion validity. In the 1st study, we compared multiple narcissism measures to expert consensus ratings of the personality traits associated with narcissistic personality disorder (NPD; Study 1; N = 98 community participants receiving psychological/psychiatric treatment) according to the Diagnostic and Statistical Manual of Mental Disorders (4th ed., text rev.; DSM-IV-TR; American Psychiatric Association, 2000) using 5-factor model traits as well as the traits associated with the pathological trait model according to the Diagnostic and Statistical Manual of Mental Disorders (5th ed.; American Psychiatric Association, 2013). In Study 2 (N = 274 undergraduates), we tested the criterion validity of an even larger set of narcissism instruments by examining their relations with measures of general and pathological personality, as well as psychopathology, and compared the resultant correlations to the correlations expected by experts for measures of grandiose and vulnerable narcissism. Across studies, the grandiose dimensions from the Five-Factor Narcissism Inventory (FFNI; Glover, Miller, Lynam, Crego, & Widiger, 2012) and the Narcissistic Personality Inventory (Raskin & Terry, 1988) provided the strongest match to expert ratings of DSM-IV-TR NPD and grandiose narcissism, whereas the vulnerable dimensions of the FFNI and the Pathological Narcissism Inventory (Pincus et al., 2009), as well as the Hypersensitive Narcissism Scale (Hendin & Cheek, 1997), provided the best match to expert ratings of vulnerable narcissism. These results should help guide researchers toward the selection of narcissism instruments that are most well suited to capturing different aspects of narcissism. PsycINFO Database Record (c) 2014 APA, all rights reserved.

  7. Abyssal fauna of the UK-1 polymetallic nodule exploration area, Clarion-Clipperton Zone, central Pacific Ocean: Cnidaria.

    Science.gov (United States)

    Dahlgren, Thomas G; Wiklund, Helena; Rabone, Muriel; Amon, Diva J; Ikebe, Chiho; Watling, Les; Smith, Craig R; Glover, Adrian G

    2016-01-01

    We present data from a DNA taxonomy register of the abyssal Cnidaria collected as part of the Abyssal Baseline (ABYSSLINE) environmental survey cruise 'AB01' to the UK Seabed Resources Ltd (UKSRL) polymetallic-nodule exploration area 'UK-1' in the eastern Clarion-Clipperton Zone (CCZ), central Pacific Ocean abyssal plain. This is the second paper in a series to provide regional taxonomic data for a region that is undergoing intense deep-sea mineral exploration for high-grade polymetallic nodules. Data were collected from the UK-1 exploration area following the methods described in Glover et al. (2015b). Morphological and genetic data are presented for 10 species and 18 records identified by a combination of morphological and genetic data, including molecular phylogenetic analyses. These included 2 primnoid octocorals, 2 isidid octocorals, 1 anemone, 4 hydroids (including 2 pelagic siphonophores accidentally caught) and a scyphozoan jellyfish (in the benthic stage of the life cycle). Two taxa matched previously published genetic sequences (pelagic siphonophores), two taxa matched published morphological descriptions (abyssal primnoids described from the same locality in 2015) and the remaining 6 taxa are potentially new species, for which we make the raw data, imagery and vouchers available for future taxonomic study. We have used a precautionary approach in taxon assignments to avoid over-estimating species ranges. The Clarion-Clipperton Zone is a region undergoing intense exploration for potential deep-sea mineral extraction. We present these data to facilitate future taxonomic and environmental impact study by making both data and voucher materials available through curated and accessible biological collections. For some of the specimens we also provide image data collected at the seabed by ROV, wich may facilitate more accurate taxon designation in coming ROV or AUV surveys.

  8. IRECCSEM: Evaluating Clare Basin potential for onshore carbon sequestration using magnetotelluric data (Preliminary results). New approaches applied for processing, modeling and interpretation

    Science.gov (United States)

    Campanya i Llovet, J.; Ogaya, X.; Jones, A. G.; Rath, V.

    2014-12-01

    The IRECCSEM project (www.ireccsem.ie) is a Science Foundation Ireland Investigator Project that is funded to evaluate Ireland's potential for onshore carbon sequestration in saline aquifers by integrating new electromagnetic data with existing geophysical and geological data. The main goals of the project are to determine porosity-permeability values of the potential reservoir formation as well as to evaluate the integrity of the seal formation. During the Summer of 2014 a magnetotelluric (MT) survey was carried out at the Clare basin (Ireland). A total of 140 sites were acquired including audiomagnetotelluric (AMT), broadband magnetotelluric (BBMT) and long period magnetotelluric (LMT) data. The nominal space between sites is 0.6 km for AMT sites, 1.2 km for BBMT sites and 8 km for LMT sites. To evaluate the potential for carbon sequestration of the Clare basin three advances on geophysical methodology related to electromagnetic techniques were applied. First of all, processing of the MT data was improved following the recently published ELICIT methodology. Secondly, during the inversion process, the electrical resistivity distribution of the subsurface was constrained combining three different tensor relationships: Impedances (Z), induction arrows (TIP) and multi-site horizontal magnetic transfer-functions (HMT). Results from synthetic models were used to evaluate the sensitivity and properties of each tensor relationship. Finally, a computer code was developed, which employs a stabilized least squares approach to estimate the cementation exponent in the generalized Archie law formulated by Glover (2010). This allows relating MT-derived electrical resistivity models to porosity distributions. The final aim of this procedure is to generalize the porosity - permeability values measured in the boreholes to regional scales. This methodology will contribute to the evaluation of possible sequestration targets in the study area.

  9. Plasma's sweeping arc

    International Nuclear Information System (INIS)

    Pichon, Max

    2010-01-01

    . Prasad says there are no air discharges from the process, which is under negative pressure, and the syngas is clean burning. “We know that emissions from the produced syngas when used in a gas turbine are lower than emissions from natural gas and within US EPA standards,” he said. Zenergy's next step is a feasibility study prior to provide all the costing. However, it estimates the cost of producing 1MVV of electricity would be about US$2.5 million ($2.8 million). Part of the unknown is the composition of input wastes, and that's what gives WMAA knowledge manager Mark Glover cause for concern. “The proposition by some plasma companies that I have spoken to is that they want to up the ante and take MSW and start producing energy and other reusable materials,” Glover told WME. While he loves the technology, he reckons it's not right for the waste sector. He uses the old 'garbage in, garbage out' idea. “If you put low-grade material into plasma, you will get low-grade material out at the other end, and this and other AWT technologies tend to be very sensitive to variations. MSW is a very complex material and it is very hard to control,” he said. It's not dioxins he's worried about- the ultra-high temperatures would destroy all the organic molecules that create them - but the robustness of the process.There's another worry, this one strategic. Glover says it would fail WMAA's energy from waste guidelines, which say that the material to be converted to energy would not be accepted as the best alternative to converting the MSW. It says any recover able organic fraction of the waste should be separated and turned to compost, a higher order use than energy conversion. What's more, it remains largely untested at scale, meaning considerable technological and budgetary uncertainties remain. But that won't stop Prasad from pushing the technology into Australia and it that hasn't silenced the buzz offshore. PWR

  10. Evaluación de barreras vegetales en el manejo integrado de la mancha anular del papayo (PRSV-P en Michoacán, México Evaluation of plant barriers in an integrated management of papayo ringspot in Michoacan, Mexico

    Directory of Open Access Journals (Sweden)

    Patricia Rivas-Valencia

    2008-12-01

    Full Text Available El efecto de barreras vegetales como componente de un programa de manejo integrado (MI, se validó y adaptó en 1999 en Michoacán, México, para controlar la Mancha Anular del Papayo, enfermedad causada por el Papaya ringspot potyvirus type-P (PRSV-P. Se estableció un experimento en parcelas divididas con dos factores experimentales: barreras vegetales (Hibiscus sabdariffa, y componentes de MI: MI sin aspersión de citrolina (1.5% (MI-A, MI sin eliminación de plantas con síntomas iniciales de virosis antes de floración (MI-D y MI. Las barreras vegetales sembradas 20 días antes del trasplante del papayo y el desplante retrasaron en 19 días el inicio del progreso de epidemias en el MI lo que resultó en una mayor producción (14.2% que el resto de tratamientos, aunque fue superado por MI-A en vigor (4% en diámetro de tallo. La citrolina fue fitotóxica, disminuyó el vigor de plantas (5.3% y no limitó significativamente el desarrollo de la enfermedad ya que la intensidad de las epidemias (X0 = 47días, Yf = 84% y ABCPE = 3220% días fue similar al testigo. El uso de barreras vegetales por si sola aparentemente no es suficiente para la reducción de la incidencia y dispersión de la enfermedad. Los áfidos más abundantes, con reconocida capacidad transmisora del PRSV-P, fueron Aphis gossypii, A. nerii, A. spiraecola y Macrosiphum euphorbiae, los cuales representaron aproximadamente el 13% del total de áfidos capturados.The effect of plant barriers as a component of an integrated management program (IM was validated and adapted in 1999, in Michoacan, Mexico, to control papaya ringspot, caused by papaya ringspot potyvirus type-P (PRSV-P. A split-plot design was established with two experimental factors: plant barriers and components of IM: IM without oil sprinkling (IM-O, IM without plant rouging (IM-R, and complete IM. Plant barriers (Hibiscus sabdariffa, sowed 20 days before papaya transplanting, and plant rouging delayed the epidemics

  11. Microclimate and ramulosis occurrence in a cotton crop under three plant population densities in Southern Brazil Microclima y ocurrencia de ramulosis en cultivo de algodón sembrado a tres densidades en el sudeste de Brasil

    Directory of Open Access Journals (Sweden)

    J. E. B. A. Monteiro

    2006-12-01

    Full Text Available This study aimed to evaluate crop microclimate and its influence on ramulosis disease in a cotton crop conducted in three population densities. The experiment was carried out in Piracicaba, state of São Paulo, Brazil, where the genotypes IAC 23 and Coodetec 401 were sowed with the following plant population densities: 55,000; 111,000; and 166,000 plants per hectare. To start the epidemic process, a conidia suspension of Colletotrichum gossypii var. cephalosporioides was inoculated in the crop at 30 and 45 days after sowing. The weather variables, air temperature, relative humidity and leaf wetness duration, were recorded with an automatic weather station located at the experimental area and with six micro-stations located within the crop canopy (three in each genotype. Results showed that plant density had low effect on air temperature, but differences were found on relative humidity and leaf wetness duration. These differences were observed until the canopy became a continuous surface. The microclimate promoted by plant densities showed to have little influence on disease progress, since macroclimate during the experiment was favorable to disease development. Genotype IAC 23 was more resistant to ramulosis than Coodetec 401. The area under disease progress curve presented a define relationship with yield (R² = 0.70 for all treatments and R²sup = 0.93 for averages, being a potential parameter for evaluating the impact of ramulosis disease on cotton production in southern Brazil.El objetivo de este trabajo fue evaluar el microclima en el cultivo de algodón a tres densidades poblacionales y su efecto sobre la intensidad de la ramulosis. El experimento fue conducido en Piracicaba, SP, Brasil. Los genotipos IAC 23 y Coodetec 401 fueron sembrados a las densidades de 55.000, 111.000 y 166.000 plantas por hectárea. El cultivo fue inoculado con una suspensión de conidios de Colletotrichum gossypii var. cephalosporoides a los 30 y a los 45 d

  12. Interação entre inseticidas e umidade do solo no controle do pulgão e da mosca-branca em algodoeiro Interaction between insecticides and soil moisture in the control of whitefly and aphid in cotton

    Directory of Open Access Journals (Sweden)

    Jorge Braz Torres

    2008-08-01

    Full Text Available O objetivo deste trabalho foi avaliar o controle exercido por tiametoxam e pimetrozine, em aplicação foliar ou ao solo, sobre Bemisia tabaci e Aphis gossypii, em algodoeiro, e determinar a interação entre formas de aplicação e a umidade do solo, em diferentes intervalos após a aplicação. Foram aplicados inseticidas via pulverização ou esguicho ao solo, em plantas de algodoeiro submetidas a três faixas de umidade do solo. Os inseticidas foram testados separadamente, em arranjos fatoriais, com formas de aplicação (tiametoxam, pragas (pimetrozine e teores de umidade no solo como fatores de variação, com as avaliações repetidas no tempo. Foram realizadas avaliações após 3 horas e aos 3, 6, 12, 24 e 32 dias após a aplicação. Os inseticidas, em pulverização, apresentaram controle superior a 80%, até 6 dias depois da aplicação, para mosca-branca e pulgão. O uso de tiametoxam com esguicho, na menor faixa de umidade, propiciou controle inferior a 60%, no dia da aplicação, superior a 90%, aos 3 e 6 dias, e superior a 80%, aos 12 dias após aplicação. O grau de estresse hídrico em que se encontra a planta é importante para a escolha do inseticida e da modalidade de aplicação mais adequados ao controle das pragas avaliadas.The objective of this work was to evaluate the control, in cotton plants, of Bemisia tabaci and Aphis gossypii by thiamethoxam and pymetrozine, with foliar or soil drench applications, and to determine the interaction between application method and soil humidity, in different intervals after insecticide application. Insecticide application consisted of foliar spray and soil drench, using cotton plants submitted to three levels of soil moisture. The insecticides were tested separately, in factorial arrangements, with application methods (thiamethoxam, pest species (pymetrozine and soil moisture levels, as treatments, with repeated measures on time. Evaluations were carried out after 3 hours, and at 3

  13. Controle alternativo da mancha de Ramularia do algodoeiro Alternative control of the Cotton ramularia spot

    Directory of Open Access Journals (Sweden)

    Leonardo Angelo de Aquino

    2008-06-01

    Full Text Available A mancha de Ramularia, causada pelo fungo Ramularia gossypii (Speg. Cif., é uma doença foliar de destaque na cotonicultura brasileira. Com a expansão da cotonicultura, existem poucos produtos avaliados para manejo da Ramularia, destacando-se os fungicidas dos grupos triazóis e estrobirulinas. Objetivou-se nesse trabalho avaliar o efeito da aplicação foliar do silicato de potássio, da calda Viçosa e de fungicidas protetores (mancozeb e clorotalonil para o controle químico da mancha de Ramularia. O silicato de potássio não foi eficiente para o controle da doença com severidade de 15,38%, enfolhamento relativo aos 166 dias após a emergência de 38,19%, produtividade de algodão em caroço de 136,11 @ ha-1 e área abaixo da curva de progresso da mancha de Ramularia de 644, 598 e 172 nos terços inferior, médio e superior, respectivamente, com valores semelhantes à testemunha sem fungicida. A calda viçosa proporcionou satisfatório controle da doença não diferindo em termos de produtividade dos tratamentos com piraclostrobin e ou tebuconazol, sendo o incremento de produtividade em relação à testemunha de 88%. Os fungicidas mancozeb e clorotalonil em mistura com calda Viçosa ou com tebuconazole foram eficientes no controle da mancha de Ramularia, destacando-se o fungicida mancozeb em mistura com tebuconazol.Areolate mildew, caused by the fungus Ramularia gossypii (Speg. Cif., is the most important foliar disease on cotton. There are a few products available to the growers to manage this disease among them the fungicides tryazol and strobilurine. This study aimed to evaluate the effect of foliar application of potassium silicate, 'calda Viçosa' e protector fungicides (Mancozeb and Clorothalonyl to control areolate mildew on cotton. The potassium silicate was not efficient to control the disease with severity of 15.38%, canopy quality at 166 days after plant emergence of 38.19%, yield of 2041.65 kg ha-1 and area under areolate

  14. Vermelhão do algodoeiro Cotton "vermelhão" or anthocyanosis

    Directory of Open Access Journals (Sweden)

    A. S. Costa

    1954-01-01

    Full Text Available Uma moléstia do algodoeiro associada à infestação pelo pulgão Aphis gossypii, é descrita. É proposto que o nome vermelhão fique restrito a essa moléstia e que quando esta designação for usada em associação com outras moléstias, seja qualificada em seu emprêgo. São apontadas algumas diferenças que permitem distinguir o vermelhão do afídio de outras condições em que a coloração das fôlhas do algodoeiro é mais ou menos semelhante. Foi verificado que, quando afídios coletados de plantas com vermelhão eram alimentados em algodoeiros novos por 48 horas apenas, os sintomas da moléstia se manifestavam dentro de 12 a 30 dias. Infestações com um afídio por planta foram suficientes para reproduzir a moléstia em alguns casos ; com cinco afídios por planta conseguiu-se reproduzir a moléstia com maior freqüência ; com 25 afídios, em praticamente todos os casos. Insetos da mesma espécie, coletados de plantas de pepino, não produziram o vermelhão quando colocados sobre algodoeiros. Reprodução de vermelhão foi obtida por enxertia, passando os sintomas a se manifestar nos cavalos ; houve também perpetuação dos sintomas por enxertia em terceira reprodução vegetativa. A evidência obtida nos ensaios de reprodução da moléstia é discutida, sendo apontado que tudo indica ser um vírus a causa primária da moléstia e não toxina do inseto ou deficiência de elementos. Outras hipóteses alternativas são mencionadas.A disease associated with the infestation of cotton plants by the cotton or melon aphid, Aphis gossypii Glov. is described under the name of "vermelhão" or anthocyanosis. Symptoms of the disease resemble those resulting from magnesium deficiency. Aphids collected from diseased plants reproduced the disease when fed on cotton seedlings for 48 hours. Symptoms usually appeared from 12 to 30 days after inoculation, as chlorotic areas or spots that later turned reddish or purplish under strong light conditions

  15. Evolution of the SH3 Domain Specificity Landscape in Yeasts.

    Directory of Open Access Journals (Sweden)

    Erik Verschueren

    Full Text Available To explore the conservation of Src homology 3 (SH3 domain-mediated networks in evolution, we compared the specificity landscape of these domains among four yeast species, Saccharomyces cerevisiae, Ashbya gossypii, Candida albicans, and Schizosaccharomyces pombe, encompassing 400 million years of evolution. We first aligned and catalogued the families of SH3-containing proteins in these four species to determine the relationships between homologous domains. Then, we tagged and purified all soluble SH3 domains (82 in total to perform a quantitative peptide assay (SPOT for each SH3 domain. All SPOT readouts were hierarchically clustered and we observed that the organization of the SH3 specificity landscape in three distinct profile classes remains conserved across these four yeast species. We also produced a specificity profile for each SH3 domain from manually aligned top SPOT hits and compared the within-family binding motif consensus. This analysis revealed a striking example of binding motif divergence in a C. albicans Rvs167 paralog, which cannot be explained by overall SH3 sequence or interface residue divergence, and we validated this specificity change with a yeast two-hybrid (Y2H assay. In addition, we show that position-weighted matrices (PWM compiled from SPOT assays can be used for binding motif screening in potential binding partners and present cases where motifs are either conserved or lost among homologous SH3 interacting proteins. Finally, by comparing pairwise SH3 sequence identity to binding profile correlation we show that for ~75% of all analyzed families the SH3 specificity profile was remarkably conserved over a large evolutionary distance. Thus, a high sequence identity within an SH3 domain family predicts conserved binding specificity, whereas divergence in sequence identity often coincided with a change in binding specificity within this family. As such, our results are important for future studies aimed at unraveling

  16. Genetic Control of Biosynthesis and Transport of Riboflavin and Flavin Nucleotides and Construction of Robust Biotechnological Producers†

    Science.gov (United States)

    Abbas, Charles A.; Sibirny, Andriy A.

    2011-01-01

    Summary: Riboflavin [7,8-dimethyl-10-(1′-d-ribityl)isoalloxazine, vitamin B2] is an obligatory component of human and animal diets, as it serves as the precursor of flavin coenzymes, flavin mononucleotide, and flavin adenine dinucleotide, which are involved in oxidative metabolism and other processes. Commercially produced riboflavin is used in agriculture, medicine, and the food industry. Riboflavin synthesis starts from GTP and ribulose-5-phosphate and proceeds through pyrimidine and pteridine intermediates. Flavin nucleotides are synthesized in two consecutive reactions from riboflavin. Some microorganisms and all animal cells are capable of riboflavin uptake, whereas many microorganisms have distinct systems for riboflavin excretion to the medium. Regulation of riboflavin synthesis in bacteria occurs by repression at the transcriptional level by flavin mononucleotide, which binds to nascent noncoding mRNA and blocks further transcription (named the riboswitch). In flavinogenic molds, riboflavin overproduction starts at the stationary phase and is accompanied by derepression of enzymes involved in riboflavin synthesis, sporulation, and mycelial lysis. In flavinogenic yeasts, transcriptional repression of riboflavin synthesis is exerted by iron ions and not by flavins. The putative transcription factor encoded by SEF1 is somehow involved in this regulation. Most commercial riboflavin is currently produced or was produced earlier by microbial synthesis using special selected strains of Bacillus subtilis, Ashbya gossypii, and Candida famata. Whereas earlier RF overproducers were isolated by classical selection, current producers of riboflavin and flavin nucleotides have been developed using modern approaches of metabolic engineering that involve overexpression of structural and regulatory genes of the RF biosynthetic pathway as well as genes involved in the overproduction of the purine precursor of riboflavin, GTP. PMID:21646432

  17. Genetic control of biosynthesis and transport of riboflavin and flavin nucleotides and construction of robust biotechnological producers.

    Science.gov (United States)

    Abbas, Charles A; Sibirny, Andriy A

    2011-06-01

    Riboflavin [7,8-dimethyl-10-(1'-d-ribityl)isoalloxazine, vitamin B₂] is an obligatory component of human and animal diets, as it serves as the precursor of flavin coenzymes, flavin mononucleotide, and flavin adenine dinucleotide, which are involved in oxidative metabolism and other processes. Commercially produced riboflavin is used in agriculture, medicine, and the food industry. Riboflavin synthesis starts from GTP and ribulose-5-phosphate and proceeds through pyrimidine and pteridine intermediates. Flavin nucleotides are synthesized in two consecutive reactions from riboflavin. Some microorganisms and all animal cells are capable of riboflavin uptake, whereas many microorganisms have distinct systems for riboflavin excretion to the medium. Regulation of riboflavin synthesis in bacteria occurs by repression at the transcriptional level by flavin mononucleotide, which binds to nascent noncoding mRNA and blocks further transcription (named the riboswitch). In flavinogenic molds, riboflavin overproduction starts at the stationary phase and is accompanied by derepression of enzymes involved in riboflavin synthesis, sporulation, and mycelial lysis. In flavinogenic yeasts, transcriptional repression of riboflavin synthesis is exerted by iron ions and not by flavins. The putative transcription factor encoded by SEF1 is somehow involved in this regulation. Most commercial riboflavin is currently produced or was produced earlier by microbial synthesis using special selected strains of Bacillus subtilis, Ashbya gossypii, and Candida famata. Whereas earlier RF overproducers were isolated by classical selection, current producers of riboflavin and flavin nucleotides have been developed using modern approaches of metabolic engineering that involve overexpression of structural and regulatory genes of the RF biosynthetic pathway as well as genes involved in the overproduction of the purine precursor of riboflavin, GTP.

  18. Formation of Stylet Sheaths in āere (in air from eight species of phytophagous hemipterans from six families (Suborders: Auchenorrhyncha and Sternorrhyncha.

    Directory of Open Access Journals (Sweden)

    J Kent Morgan

    Full Text Available Stylet sheath formation is a common feature among phytophagous hemipterans. These sheaths are considered essential to promote a successful feeding event. Stylet sheath compositions are largely unknown and their mode of solidification remains to be elucidated. This report demonstrates the formation and solidification of in āere (in air produced stylet sheaths by six hemipteran families: Diaphorina citri (Psyllidae, Asian citrus psyllid, Aphis nerii (Aphididae, oleander/milkweed aphid, Toxoptera citricida (Aphididae, brown citrus aphid, Aphis gossypii (Aphididae, cotton melon aphid, Bemisia tabaci biotype B (Aleyrodidae, whitefly, Homalodisca vitripennis (Cicadellidae, glassy-winged sharpshooter, Ferrisia virgata (Pseudococcidae, striped mealybug, and Protopulvinaria pyriformis (Coccidae, pyriform scale. Examination of in āere produced stylet sheaths by confocal and scanning electron microscopy shows a common morphology of an initial flange laid down on the surface of the membrane followed by continuous hollow core structures with sequentially stacked hardened bulbous droplets. Single and multi-branched sheaths were common, whereas mealybug and scale insects typically produced multi-branched sheaths. Micrographs of the in āere formed flanges indicate flange sealing upon stylet bundle extraction in D. citri and the aphids, while the B. tabaci whitefly and H. vitripennis glassy-winged sharpshooter flanges remain unsealed. Structural similarity of in āere sheaths are apparent in stylet sheaths formed in planta, in artificial diets, or in water. The use of 'Solvy', a dissolvable membrane, for intact stylet sheath isolation is reported. These observations illustrate for the first time this mode of stylet sheath synthesis adding to the understanding of stylet sheath formation in phytophagous hemipterans and providing tools for future use in structural and compositional analysis.

  19. Dispersal strategies of phytophagous insects at a local scale: adaptive potential of aphids in an agricultural environment

    Directory of Open Access Journals (Sweden)

    Boll Roger

    2006-10-01

    Full Text Available Abstract Background The spread of agriculture greatly modified the selective pressures exerted by plants on phytophagous insects, by providing these insects with a high-level resource, structured in time and space. The life history, behavioural and physiological traits of some insect species may have evolved in response to these changes, allowing them to crowd on crops and to become agricultural pests. Dispersal, which is one of these traits, is a key concept in evolutionary biology but has been over-simplified in most theoretical studies. We evaluated the impact of the local-scale dispersal strategy of phytophagous insects on their fitness, using an individual-based model to simulate population dynamics and dispersal between leaves and plants, by walking and flying, of the aphid Aphis gossypii, a major agricultural pest, in a melon field. We compared the optimal values for dispersal parameters in the model with the corresponding observed values in experimental trials. Results We show that the rates of walking and flying disperser production on leaves were the most important traits determining the fitness criteria, whereas dispersal distance and the clustering of flying dispersers on the target plant had no effect. We further show that the effect of dispersal parameters on aphid fitness depended strongly on plant characteristics. Conclusion Parameters defining the dispersal strategies of aphids at a local scale are key components of the fitness of these insects and may thus be essential in the adaptation to agricultural environments that are structured in space and time. Moreover, the fact that the effect of dispersal parameters on aphid fitness depends strongly on plant characteristics suggests that traits defining aphid dispersal strategies may be a cornerstone of host-plant specialization.

  20. La situación de las annonaceae en México: principales plagas, enfermedades y su control

    Directory of Open Access Journals (Sweden)

    Librado Vidal Hernández

    2014-01-01

    Full Text Available La importancia económica de las especies de la familia Annonaceae en México es diversa y no se restringe a las especies comestibles, pues además incluye especies con propiedades aromáticas para la extracción de aceites esenciales, medicinales, insecticidas y tóxicos a peces. En general esta familia no se ha formalizado agronómica ni económicamente, sin embargo, presenta grandes perspectivas dentro de programas de mejoramiento genético, en el uso como portainjertos o bien como cultivos alternativos. Las principales plagas asociadas al género Annona son: Bephratelloides cubensis Ashmead, Cerconota anonella Sepp., Corythuca gossypii Fab., Planococcus citri, Chrysobotris sp., Talponia batesi Heinrich., Acantocephala femorata Fab.. Las principales enfermedades de las anonáceas reportadas son: Colletotrichum gloeosporioides Penz, Rhizopusstolonifer Ehr., Phyllosticta sp., Pestalotia sp., Macrophoma sp., Fusarium sp y Phytopthora sp.. Siendo la primera la principal enfermedad de mayor importancia en el cultivo del guanábano dado que disminuye el rendimiento y calidad de los frutos. En chirimoyo y guanábano es muy poca la información bibliográfica existente sobre plagas y enfermedades, y en las demás especies de Annona es nula. No se han realizado evaluaciones de las pérdidas que ocasionan las plagas y enfermedades en las Anonáceas, ocasionando un desconocimiento pleno sobre los daños ocasionados por este factor biótico.