Effects of botanical insecticides on the instantaneous population growth rate of Aphis gossypii Glover (Hemiptera: Aphididae in cotton=Efeitos de inseticidas botânicos na taxa instantânea de crescimento populacional de Aphis gossypii Glover (Hemiptera: Aphididae em algodão

Directory of Open Access Journals (Sweden)

Edmilson Jacinto Marques

2012-04-01

Full Text Available Botanical insecticides have been studied aiming the alternative pest control. The present study investigated the effects of these insecticides on the instantaneous population growth rate (ri of Aphis gossypii. Botanical insecticides were tested in the following concentrations: Compostonat®, Rotenat-CE® and Neempro (0, 0.50, 0.75, 1.00, 1.25, 1.50 and 1.75%; Natuneem® and Neemseto® (0, 0.25, 0.50, 0.75 and 1.00% and essential oils of Foeniculum vulgare Mill., Cymbopogom winterianus (L., Chenopodium ambrosioides L. and Piper aduncum L (0, 0.0125, 0.025, 0.0375 and 0.05%. Cotton leaf discs, CNPA 8H cultivar with 5 cm in diameter were immersed for 30 seconds in products broth and dried for 30 minutes. Eight replicates per concentration were used and each disc was infested with five apterous adult females of A. gossypii uniform in size and confined for 10 days. Compostonat®, Rotenat® and Neempro provided negative ri decreasing A. gossypii population. Natuneem® and Neemseto® and the essential oil of F. vulgare showed positive ri increasing the population. The coefficients of determination (R2 of regression lines ranged from 0.46 to 0.85. The essential oils of C. winterianus, C. ambrosioides and P. aduncum were not statistically significant precluding the establishment of regression lines.Inseticidas botânicos têm sido estudados, visando o controle alternativo de pragas. O presente trabalho objetivou estudar os efeitos desses inseticidas sobre a taxa instantânea de crescimento populacional (ri de Aphis gossypii. Os inseticidas botânicos foram testados nas seguintes concentrações: Compostonat®, Rotenat-CE® e Neempro (0; 0,50; 0,75; 1,00; 1,25; 1,50 e 1,75%; Nautneem® e Neemseto® (0; 0,25; 0,50; 0,75 e 1,00%; e os óleos essenciais de Foeniculum vulgare Mill., Cymbopogom winterianus (L., Chenopodium ambrosioides L. e Piper aduncum L. (0; 0,0125; 0,025; 0,0375 e 0,05%. Discos de folhas de algodoeiro, cultivar CNPA 8H, com 5 cm de di

The control and protection of cotton plants using natural insecticides against the colonization by Aphis gossypii Glover (Hemiptera: Aphididae - doi: 10.4025/actasciagron.v35i2.15764

Directory of Open Access Journals (Sweden)

Ezio Santos Pinto

2012-12-01

Full Text Available The cotton aphid, Aphis gossypii Glover (Hemiptera: Aphididae, is a key pest of cotton, irrespective of the use of conventional or organic management. In organic systems, however, the use of synthetic insecticides is not allowed, increasing the difficulty of controlling this pest. This work evaluated aphid control and the ability of products to prevent aphid infestation using natural insecticides compared to a standard synthetic insecticide. The control trial was conducted with four products [Beauveria bassiana (Boveril®, neem oil (Neemseto®, and cotton seed oil compared to thiamethoxam (Actara®], and untreated plants served as the control group. The trial testing the efficacy of these products in preventing aphid infestation was conducted using the same products, excluding Boveril®. The evaluations were conducted 72 and 120h post-treatment for the efficacy and the protection against colonization trials, respectively. The aphid control by cotton seed oil, Neemseto®, and thiamethoxam was similar, with 100% control being achieved on the thiamethoxam-treated plants. Regarding the plant protection against aphid colonization, the insecticide thiamethoxam exhibited a better performance compared to the other tested products with steady results over the evaluation period. The natural products exhibited variable results with low protection against plant colonization throughout the evaluation period.

[Host plants of Aphis gossypii (Aphididae), vector of virus of Cucumis melo melon (Cucurbitaceae) in Costa Rica].

Science.gov (United States)

Sánchez, M V; Agüero, R; Rivera, C

2001-03-01

Plant species associated with commercial melon crops and surrounding areas were examined to identity the natural host plants of Aphis gossypii Glover. The study was conducted in two farms located in different melon production areas and plant life zones of Costa Rica. Plant species diversity, percent coverage and distribution over time were recorded during one year. Differences between locations were observed. A total of 86 plant species (49 families) and 72 plant species (40 families) were identified associated to the crop in farms A and B, respectively. In both farms a total of 24 species plants (16 families) were colonized by A. gossypii and 16 (10 families) are new reports of host plant species for this aphid. The new reports are: Justicia comata, Tetramerium nervosum, Alternanthera pubiflora, Cassia massoni, C. reticulata, Cleome viscosa, C. spinosa, Croton argenteus, Caperonia palustris, Chamaesyce gyssopilopia, Phyllantus amarus, Sida decumbens, Ludwigia erecta, Passiflora foetida, Guazuma ulmifolia and Corchorus orinocensis.

Population dynamics of Aphis gossypii Glover and in sole and intercropping systems of cotton and cowpea.

Science.gov (United States)

Fernandes, Francisco S; Godoy, Wesley A C; Ramalho, Francisco S; Garcia, Adriano G; Santos, Bárbara D B; Malaquias, José B

2018-01-01

Population dynamics of aphids have been studied in sole and intercropping systems. These studies have required the use of more precise analytical tools in order to better understand patterns in quantitative data. Mathematical models are among the most important tools to explain the dynamics of insect populations. This study investigated the population dynamics of aphids Aphis gossypii and Aphis craccivora over time, using mathematical models composed of a set of differential equations as a helpful analytical tool to understand the population dynamics of aphids in arrangements of cotton and cowpea. The treatments were sole cotton, sole cowpea, and three arrangements of cotton intercropped with cowpea (t1, t2 and t3). The plants were infested with two aphid species and were evaluated at 7, 14, 28, 35, 42, and 49 days after the infestations. Mathematical models were used to fit the population dynamics of two aphid species. There were good fits for aphid dynamics by mathematical model over time. The highest population peak of both species A. gossypii and A. craccivora was found in the sole crops, and the lowest population peak was found in crop system t2. These results are important for integrated management programs of aphids in cotton and cowpea.

Interspecific Associations between Cycloneda sanguinea and Two Aphid Species (Aphis gossypii and Hyadaphis foeniculi) in Sole-Crop and Fennel-Cotton Intercropping Systems.

Science.gov (United States)

Fernandes, Francisco S; Ramalho, Francisco S; Malaquias, José B; Godoy, Wesley A C; Santos, Bárbara Davis B

2015-01-01

Aphids cause significant damage to crop plants. Studies regarding predator-prey relationships in fennel (Foeniculum vulgare Mill.) and cotton (Gossypium hirsutum L.) crops are important for understanding essential ecological interactions in the context of intercropping and for establishing pest management programs for aphids. This study evaluated the association among Hyadaphis foeniculi (Passerini) (Hemiptera: Aphididae), Aphis gossypii Glover (Hemiptera: Aphididae) and Cycloneda sanguinea (L.) (Coleoptera: Coccinellidae) in cotton with coloured fibres, fennel and cotton intercropped with fennel. Association analysis was used to investigate whether the presence or absence of prey and predator species can indicate possible interactions between aphids and ladybugs. Significant associations among both apterous and alate H. foeniculi and C. sanguinea were observed in both the fennel and fennel-cotton intercropping systems. The similarity analysis showed that the presence of aphids and ladybugs in the same system is significantly dependent on the type of crop. A substantial amount of evidence indicates that the presence of the ladybug C. sanguinea, is associated with apterous or alate A. gossypii and H. foeniculi in fennel-cotton intercropping system. We recommend that future research vising integrated aphid management taking into account these associations for take decisions.

Separate and Combined Effects of Mentha piperata and Mentha pulegium Essential Oils and a Pathogenic Fungus Lecanicillium muscarium Against Aphis gossypii (Hemiptera: Aphididae).

Science.gov (United States)

Ebadollahi, Asgar; Davari, Mahdi; Razmjou, Jabrael; Naseri, Bahram

2017-06-01

In the present study, the toxicity of essential oils of Mentha piperata L. and Mentha pulegium L. and pathogenicity of Lecanicillium muscarium (Zare & Gams) were studied in the melon aphid, Aphis gossypii Glover. Analyses of the essential oils by GC-MS indicated limonene (27.28%), menthol (24.71%), menthone (14.01%), and carvol (8.46%) in the M. piperata essential oil and pulegone (73.44%), piperitenone (5.49%), decane (4.99%), and limonene (3.07%) in the essential oil of M. pulegium as the main components. Both essential oils and the pathogenic fungus had useful toxicity against A. gossypii. Probit analysis indicated LC50 values (lethal concentrations to kill 50% of population; 95% confidence limits in parentheses) of M. piperata and M. pulegium essential oils as 15.25 (12.25-19.56) and 23.13 (19.27-28.42) µl/liter air, respectively. Susceptibility to the pathogenic fungus increased with exposure time. Aphid mortality also increased when the essential oils were combined with L. muscarium, although the phenomena was additive rather than synergistic. Mycelial growth inhibition of L. muscarium exposed to the essential oils was also very low. Based on our results, M. piperata and M. pulegium essential oils and the pathogenic fungus L. muscarium have some potential for management of A. gossypii. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

BIOLOGY OF CHRYSOPA PHYLLOCHROMA WESMAEL （NEUROPTERA： CHRYSOPIDAE）. Ⅱ： INTRASPECIFIC INTERFERENCE AND SEARCHING CAPACITY

Institute of Scientific and Technical Information of China (English)

Jian-weiSu; Xiang-huiLiu; Neng-wenXiao; FengGe

2004-01-01

The present study examined intraspecific interference and searching behavior of Chrysopa phyllochroma Wesmael (Neuroptera: Chrysopidae) for Aphis gossypii Glover (Homoptera: Aphididae) nymphs under laboratory and greenhouse conditions. The results were shown as follow: 1) In four different arenas (i.e. Petri dish, glass vessel, glass vessel with barriers in it, and cage with potted cotton plant), the predaceous efficiency of C. phyllochroma larvae varied with the predator density, the hunt constant (Q) and the intraspecific interference (m)increased with the prey density but decreased with the space heterogeneity; 2) In cage with potted cotton plant, the first- and second-instar green lacewing larvae consumed 13.6 and 29.4 cotton aphids/day respectively. The number of cotton aphids consumed by C. phyllochroma on lower leaves was significantly less than that on upper leaves; and 3) In cage with potted cotton plant, the percentage of the first- and second-instar green lacewing larvae located on upper leaves was significant less than that on lower leaves.

Hábito de crescimento de Colletotrichum gossypii e C. gossypii var. Cephalosporioides em sementes de algodoeiro Growth habit of Colletotrichum gossypii and C. Gossypii var. Cephalosporioides on cotton seeds

Directory of Open Access Journals (Sweden)

Maria Aparecida de Souza Tanaka

1996-01-01

Full Text Available Observações sobre o hábito de crescimento de Colletotrichum gossypii e C. gossypii var. cephalosporioides em sementes de algodoeiro, inoculadas artificialmente e incubadas a 20-22°C durante cinco a sete dias, evidenciaram as seguintes características: (a em raízes: acérvulos isolados ou em grupos, massa conidial cor branco-suja, alaranjada ou salmão (mais freqüente, setas marrom-escuras, muitas vezes encobertas pela matriz gelatinosa; conídios produzidos também no micélio aéreo ou nas extremidades das setas, onde ficam aderidos, formando pequenos aglomerados; (b na superfície das sementes: conídios produzidos nos ápices de setas que emergem diretamente do tegumento, ficando aderidos uns aos outros, formando cachos, semelhantes a cadeias, que são vistos brilhantes sob a luz, em estereomicroscópio. As setas férteis são formadas também no micélio aéreo que recobre as sementes, geralmente após cinco dias de incubação. Os acérvulos com massa conidial raramente são visíveis, exceto em sementes danificadas ou mortas. Como característica de C. gossypii, observou-se que as sementes exibem, de modo geral, uma coloração rosada, em decorrência da abundante esporulação; a ausência ou escassez de micélio aéreo e as setas curtas resultam em um crescimento rente ao tegumento e aspecto compacto. Comparativamente, nas sementes com C. gossypii var. cephalosporioides, as setas são mais longas e menos densas; o micélio aéreo com setas férteis ocorre com mais freqüência, conferindo às sementes tonalidades acinzentadas e aspecto solto. A constatação de setas férteis em lesões foliares de ramulose evidencia que, no campo, essas estruturas podem funcionar como autênticos conidióforos, desempenhando um importante papel epidemiológico, ao possibilitar a disseminação dos esporos pelos ventos, a longas distâncias.The growth habit of Colletotrichum gossypii and C. gossypii var. cephalosporioides on artificially

Insectes ravageurs et propriétés biocides de Jatropha curcas L. (Euphorbiaceae : synthèse bibliographique

Directory of Open Access Journals (Sweden)

Abdoul Habou, Z.

2013-01-01

Full Text Available Insect pests and biocidal properties of Jatropha curcas L. (Euphorbiaceae. A review. Jatropha curcas is a Euphorbiaceae shrub widely distributed in many tropical countries. Its seeds are rich in oil that can be used as biofuel in modified diesel engines. Several insect species, mainly belonging to Hemiptera, Coleoptera and Orthoptera, have been referenced as insect pests of J. curcas. These insects attack the plant and cause damage to fruits, inflorescences and leaves. The most frequently observed pests belong to the genus Pachycoris (Heteroptera: Scutelleridae, which are widely distributed in Mexico, Australia, United States of America, Brazil and Nicaragua. Pachycoris spp. cause significant damage to the fruits, leading to the malformation of seeds and a reduction in their oil content. Although Jatropha shrubs are subjected to insect infestations, the oil has been shown to demonstrate biocidal activity, including insecticidal effects against several insect pests, including Busseola fusca (Fuller (Lepidoptera: Noctuidae, Sesamia calamistis Hampson (Lepidoptera: Noctuidae, Aphis gossypii Glover (Homoptera: Aphididae and Callosobruchus chinensis L. (Coleoptera: Bruchidae. In the present paper, we summarize the work carried out on inventories of J. curcas insect pests as well as on the biocidal activity of its oil.

Molecular determinants of sporulation in Ashbya gossypii.

Science.gov (United States)

Wasserstrom, Lisa; Lengeler, Klaus B; Walther, Andrea; Wendland, Jürgen

2013-09-01

Regulation of development and entry into sporulation is critical for fungi to ensure survival of unfavorable environmental conditions. Here we present an analysis of gene sets regulating sporulation in the homothallic ascomycete Ashbya gossypii. Deletion of components of the conserved pheromone/starvation MAP kinase cascades, e.g., STE11 and STE7, results in increased sporulation. In kar3 mutants sporulation is severely reduced, while deletion of KAR4 as well as of homologs of central Saccharomyces cerevisiae regulators of sporulation, IME1, IME2, IME4, and NDT80, abolishes sporulation in A. gossypii. Comparison of RNAseq transcript profiles of sporulation-deficient mutants identified a set of 67 down-regulated genes, most of which were up-regulated in the oversporulating ste12 mutant. One of these differentially expressed genes is an endoglucanase encoded by ENG2. We found that Eng2p promotes hyphal fragmentation as part of the developmental program of sporulation, which generates single-celled sporangia. Sporulation-deficient strains are arrested in their development but form sporangia. Supply of new nutrients enabled sporangia to return to hyphal growth, indicating that these cells are not locked in meiosis. Double-strand break (DSB) formation by Spo11 is apparently not required for sporulation; however, the absence of DMC1, which repairs DSBs in S. cerevisiae, results in very poor sporulation in A. gossypii. We present a comprehensive analysis of the gene repertoire governing sporulation in A. gossypii and suggest an altered regulation of IME1 expression compared to S. cerevisiae.

Blockage of the pyrimidine biosynthetic pathway affects riboflavin production in Ashbya gossypii.

Science.gov (United States)

Silva, Rui; Aguiar, Tatiana Q; Domingues, Lucília

2015-01-10

The Ashbya gossypii riboflavin biosynthetic pathway and its connection with the purine pathway have been well studied. However, the outcome of genetic alterations in the pyrimidine pathway on riboflavin production by A. gossypii had not yet been assessed. Here, we report that the blockage of the de novo pyrimidine biosynthetic pathway in the recently generated A. gossypii Agura3 uridine/uracil auxotrophic strain led to improved riboflavin production on standard agar-solidified complex medium. When extra uridine/uracil was supplied, the production of riboflavin by this auxotroph was repressed. High concentrations of uracil hampered this (and the parent) strain growth, whereas excess uridine favored the A. gossypii Agura3 growth. Considering that the riboflavin and the pyrimidine pathways share the same precursors and that riboflavin overproduction may be triggered by nutritional stress, we suggest that overproduction of riboflavin by the A. gossypii Agura3 may occur as an outcome of a nutritional stress response and/or of an increased availability in precursors for riboflavin biosynthesis, due to their reduced consumption by the pyrimidine pathway. Copyright © 2014 Elsevier B.V. All rights reserved.

Nano-formulation enhances insecticidal activity of natural pyrethrins against Aphis gossypii (Hemiptera: Aphididae) and retains their harmless effect to non-target predators.

Science.gov (United States)

Papanikolaou, Nikos E; Kalaitzaki, Argyro; Karamaouna, Filitsa; Michaelakis, Antonios; Papadimitriou, Vassiliki; Dourtoglou, Vassilis; Papachristos, Dimitrios P

2018-04-01

The insecticidal activity of a new nano-formulated natural pyrethrin was examined on the cotton aphid, Aphis gossypii Glover (Hemiptera: Aphididae), and the predators Coccinella septempunctata L. (Coleoptera: Coccinellidae) and Macrolophus pygmaeus Rambur (Hemiptera: Miridae), in respect with the nano-scale potential to create more effective and environmentally responsible pesticides. Pyrethrin was nano-formulated in two water-in-oil micro-emulsions based on safe biocompatible materials, i.e., lemon oil terpenes as dispersant, polysorbates as stabilizers, and mixtures of water with glycerol as the dispersed aqueous phase. Laboratory bioassays showed a superior insecticidal effect of the pyrethrin micro-emulsions compared to two commercial suspension concentrates of natural pyrethrins against the aphid. The nano-formulated pyrethrins were harmless, in terms of caused mortality and survival time, to L3 larvae and four-instar nymphs of the predators C. septempunctata and M. pygmaeus, respectively. We expect that these results can contribute to the application of nano-technology in optimization of pesticide formulation, with further opportunities in the development of effective plant protection products compatible with integrated pest management practices.

The joint action of destruxins and botanical insecticides (rotenone, azadirachtin and paeonolum) against the cotton aphid, Aphis gossypii Glover.

Science.gov (United States)

Yi, Fei; Zou, Chunhua; Hu, Qiongbo; Hu, Meiying

2012-06-18

The joint action of destruxins and three botanical insecticides, rotenone (Rot), azadirachtin (Aza) and paeonolum (Pae) against the cotton aphid, Aphis gossypii, was bioassayed. In laboratory experiment, several synergistic groups of destruxins with botanical insecticides were found by means of Sun's Co-toxicity Coefficients (CTC) and Finney's Synergistic Coefficient (SC). The best synergistic effect was discovered in the ratio group Des/Rot 1/9 with the CTC or SC and LC₅₀ values of 479.93 or 4.8 and 0.06 μg/mL, respectively. The second and third synergistic effects were recorded in the ratio groups Des/Rot 7/3 and 9/1. Although the ratio groups Des/Aza 6/4, Des/Pae 4/6, 3/7 and 2/8 indicated synergism by Sun's CTC, they were determined as additive actions by Finney's SC. Additive actions were also found in most of the ratio groups, but antagonism were recorded only in three ratio groups: Des/Pae 9/1, 7/3 and 6/4. In greenhouse tests, the highest mortality was 98.9% with the treatment Des/Rot 1/9 at 0.60 μg/mL, meanwhile, the treatments Des/Pae 4/6 and Des/Aza 6/4 had approximately 88% mortality.

Engineering Ashbya gossypii strains for de novo lipid production using industrial by-products.

Science.gov (United States)

Lozano-Martínez, Patricia; Buey, Rubén M; Ledesma-Amaro, Rodrigo; Jiménez, Alberto; Revuelta, José Luis

2017-03-01

Ashbya gossypii is a filamentous fungus that naturally overproduces riboflavin, and it is currently exploited for the industrial production of this vitamin. The utilization of A. gossypii for biotechnological applications presents important advantages such as the utilization of low-cost culture media, inexpensive downstream processing and a wide range of molecular tools for genetic manipulation, thus making A. gossypii a valuable biotechnological chassis for metabolic engineering. A. gossypii has been shown to accumulate high levels of lipids in oil-based culture media; however, the lipid biosynthesis capacity is rather limited when grown in sugar-based culture media. In this study, by altering the fatty acyl-CoA pool and manipulating the regulation of the main ∆9 desaturase gene, we have obtained A. gossypii strains with significantly increased (up to fourfold) de novo lipid biosynthesis using glucose as the only carbon source in the fermentation broth. Moreover, these strains were efficient biocatalysts for the conversion of carbohydrates from sugarcane molasses to biolipids, able to accumulate lipids up to 25% of its cell dry weight. Our results represent a proof of principle showing the promising potential of A. gossypii as a competitive microorganism for industrial biolipid production using cost-effective feed stocks. © 2016 The Authors. Microbial Biotechnology published by John Wiley & Sons Ltd and Society for Applied Microbiology.

Metabolic engineering of riboflavin production in Ashbya gossypii through pathway optimization.

Science.gov (United States)

Ledesma-Amaro, Rodrigo; Serrano-Amatriain, Cristina; Jiménez, Alberto; Revuelta, José Luis

2015-10-14

The industrial production of riboflavin mostly relies on the microbial fermentation of flavinogenic microorganisms and Ashbya gossypii is the main industrial producer of the vitamin. Accordingly, bioengineering strategies aimed at increasing riboflavin production in A. gossypii are highly valuable for industry. We analyze the contribution of all the RIB genes to the production of riboflavin in A. gossypii. Two important metabolic rate-limiting steps that limit the overproduction of riboflavin have been found: first, low mRNA levels of the RIB genes hindered the overproduction of riboflavin; second, the competition of the AMP branch for purinogenic precursors also represents a limitation for riboflavin overproduction. Thus, overexpression of the RIB genes resulted in a significant increase in riboflavin yield. Moreover, both the inactivation and the underexpression of the ADE12 gene, which controls the first step of the AMP branch, also proved to have a positive effect on riboflavin production. Accordingly, a strain that combines both the overexpression of the RIB genes and the underexpression of the ADE12 gene was engineered. This strain produced 523 mg/L of riboflavin (5.4-fold higher than the wild-type), which is the highest titer of riboflavin obtained by metabolic engineering in A. gossypii so far. Riboflavin production in A. gossypii is limited by a low transcription activity of the RIB genes. Flux limitation towards AMP provides committed substrate GTP for riboflavin overproduction without detrimental effects on biomass formation. A multiple-engineered Ashbya strain that produces up to 523 mg/L of riboflavin was generated.

African Journal of Biotechnology - Vol 12, No 16 (2013)

African Journals Online (AJOL)

... extracted from marine brown algae collected from Mandapam Island, India · EMAIL FREE ... Influence of plant growth regulators on somatic embryogenesis induction from ... Biological parameters of the non-target pest Aphis gossypii Glover ... for bacterial growth control · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT

INDUCING RESISTANCE IN COTTON AGAINST COLLETOTRICHUM GOSSYPII VAR. CEPHALOSPORIOIDES WITH ESSENTIAL OILS

Directory of Open Access Journals (Sweden)

B. T. Santos

2016-11-01

Full Text Available This study aimed to evaluate the potential of essential oils of rosemary (Rosmarinus officinalis, baccharis (Baccharis trimera, lemon grass (Cymbopogon citratus, basil (Ocimum basilicum and eucalyptus (Corymbia citriodora in inducing resistance in cotton plants against C. gossypii var. cephalosporioides. The inductive effect of the essential oils was evaluated in plants growing in pots in the environment, which were treated with 1% essential oil at 47 days of age. 24 hours after elicitor treatment the plants were inoculated with a suspension of 1.5 x 105 conidia mL-1 of C. gossypii var. cephalosporioides. Five evaluations were performed disease and calculated the area under the disease progress curve. All essential oils showed potential for inducing resistance against cotton C. gossypii var. cephalosporioides.

COMPARATIVE DEMOGRAPHICS OF A GENERALIST PREDATORY LADYBIRD ON FIVE APHID PREY： A LABORATORY STUDY

Institute of Scientific and Technical Information of China (English)

Omkar; AhmadPervez

2004-01-01

Prey driven demographic parameters of an aphidophagous ladybird, Propylea dissecta (Mulsant) were studied in attempt to answer how ladybird overcomes the problem of seasonally fluctuating food base. The ladybird reared for five generations in laboratory derived differential nutrition from five food sources (i.e. aphid species, Rhopalosiphum maidis (Fitch), Aphis craccivora Koch, Aphis gossypii Glover, Uroleucon compositae (Theobald) and Lipaphis erysimi (Kalt.)). The order of relative prey suitability was A. gossypii, A. craccivora, R. maidis, U. compositae and L.erysimi. Neonates suffered maximum mortality followed by eggs. Estimates of net reproductive rate,intrinsic rate of increase and finite rate of increase were highest (407.18, 0.2274 day-1, 1.2553 day-1) on A. gossypii and lowest (176.02, 0.1533 day-1, 1.1657 day-1) on L. erysimi. Generation time was shortest (26.43 days) on A. gossypii and longest (33.73 days) on L. erysimi. The present study thus,provides an explanation to the high incidence of P. dissecta on A. gossypii, as it experienced high intrinsic rate of increase and optimal values for related demographic parameters.

The Joint Action of Destruxins and Botanical Insecticides (Rotenone, Azadirachtin and Paeonolum Against the Cotton Aphid, Aphis gossypii Glover

Directory of Open Access Journals (Sweden)

Meiying Hu

2012-06-01

Full Text Available The joint action of destruxins and three botanical insecticides, rotenone (Rot, azadirachtin (Aza and paeonolum (Pae against the cotton aphid, Aphis gossypii, was bioassayed. In laboratory experiment, several synergistic groups of destruxins with botanical insecticides were found by means of Sun’s Co-toxicity Coefficients (CTC and Finney’s Synergistic Coefficient (SC. The best synergistic effect was discovered in the ratio group Des/Rot 1/9 with the CTC or SC and LC₅₀ values of 479.93 or 4.8 and 0.06 μg/mL, respectively. The second and third synergistic effects were recorded in the ratio groups Des/Rot 7/3 and 9/1. Although the ratio groups Des/Aza 6/4, Des/Pae 4/6, 3/7 and 2/8 indicated synergism by Sun’s CTC, they were determined as additive actions by Finney’s SC. Additive actions were also found in most of the ratio groups, but antagonism were recorded only in three ratio groups: Des/Pae 9/1, 7/3 and 6/4. In greenhouse tests, the highest mortality was 98.9% with the treatment Des/Rot 1/9 at 0.60 μg/mL, meanwhile, the treatments Des/Pae 4/6 and Des/Aza 6/4 had approximately 88% mortality.

Primeiro Registro de Afídeos (Hemiptera: Aphidoidea em Carambola (Averrhoa carambola L. no Brasil

Directory of Open Access Journals (Sweden)

Suzan Cunha

2016-12-01

Abstract. The starfruit (Averrhoa carambola L. has origin Asiatic and was introduced in Brazil in 1817, since then has increased its cultivation area in the country. The plant is attacked by few insects like flies and bugs. This work reports the presence of Aphis gossypii Glover on A. carambola for the first time in Brazil.

Flatidae (Homoptera: Fulgoroidea) of Indonesia, exclusive of Irian Jaya

NARCIS (Netherlands)

Medler, J.T.

1999-01-01

Taxa of the fulgoroid family Flatidae (Homoptera) occurring in Indonesia exclusive of Irian Jaya are treated. One hundred twenty seven species are recorded under 50 genera. Keys, descriptions, illustrations and collection data are presented. New genera described: Insulume, type species - Insulume

Floods of 1971 and 1972 on Glover Creek and Little River in southeastern Oklahoma

Science.gov (United States)

Thomas, Wilbert O.; Corley, Robert K.

1973-01-01

Heavy rains of December 9-10, 1971, and Oct. 30-31, 1972, caused outstanding floods on Glover Creek and Little River in McCurtain County in southeastern Oklahoma. This report presents hydrologic data that document the extent of flooding, flood profiles, and frequency of flooding on reaches of both streams. The data presented provide a technical basis for formulating effective flood-plain zoning that will minimize existing and future flood problems. The report also can be useful for locating waste-disposal and water-treatment facilities, and for the development of recreational areas. The area studied includes the reach of Little River on the Garvin and Idabel 7 1/2-minute quadrangles (sheet 1) and the reach of Glover Creek on the southwest quarter of the Golden 15-minute quadrangle (sheet 2). The flood boundaries delineated on the maps are the limits of flooding during the December 1971 and October 1972 floods. Any attempt to delineate the flood boundaries on streams in the study area other than Glover Creek and Little River was considered to be beyond the scope of this report. The general procedure used in defining the flood boundaries was to construct the flood profiles from high-water marks obtained by field surveys and by records at three stream-gaging stations (two on Little River and one on Glover Creek.). The extent of flooding was delineated on the topographic maps by using the flood profiles to define the flood elevations at various points along the channel and locating the elevations on the map by interpolating between contours (lines of equal ground elevation). In addition, flood boundaries were defined in places by field survey, aerial photographs, and information from local residents. The accuracy of the flood boundaries is consistent with the scale and contour interval of the maps (1 inch = 2,000 feet; contour interval 10 and 20 feet), which means the flood boundaries are drawn as accurately as possible on maps having 10- and 20-foot contour intervals.

Genetic variation and phylogeographic structure of the cotton aphid, Aphis gossypii, based on mitochondrial DNA and microsatellite markers.

Science.gov (United States)

Wang, Xing-Ya; Yang, Xian-Ming; Lu, Bin; Zhou, Li-Hong; Wu, Kong-Ming

2017-05-15

Aphis gossypii, one of the most important agricultural pests in the world, can cause serious economic losses in the main crop-producing areas. To clarify issues such as the genetic differentiation, genetic structure, and demographic history of A. gossypii populations, we used 10 nuclear microsatellite loci (SSR) and two mitochondrial gene sequences (COI and Cytb) to investigate genetic diversity and population structure of A. gossypii populations that were collected from 33 sampling sites in China from different climatic zones. SSR and mtDNA data suggested low to moderate levels of genetic diversity. A star-shaped network of mtDNA haplotypes indicated that the maternal ancestor of China cotton aphids likely originated in Xinjiang. The POPTREE, STRUCTURE and principal coordinate analysis (PCoA) revealed two genetic clusters: an eastern and a western region group. Isolation by distance (IBD) results showed a positive correlation between geographic distance and genetic distance in the vast eastern region but not in the western region. Neutrality testing and mismatch distribution analysis provided strong evidence for a recent rapid expansion in most populations. Genetic bottleneck was not detected in A. gossypii populations of China. The present work can help us to develop strategies for managing this pest.

Variabilidade genética entre isolados de Colletotrichum gossypii do algodoeiro Genetic variability among the isolates of Colletotrichum gossypii of cotton

Directory of Open Access Journals (Sweden)

Yeshwant R. Mehta

2010-03-01

Full Text Available O algodoeiro é atacado por Colletotrichum gossypii (CG e C. gossypii var. cephalosporioides (CGC. Ambos os patógenos são transmitidos pela semente e sua distinção morfológica é extremamente difícil e inconsistente. Tentativas foram feitas no presente trabalho para verificar a variabilidade genética entre CG e CGC através de RAPD-PCR, ERIC- e REP-PCR e PCR-RFLP da região ITS rDNA. Foram utilizados 53 isolados coletados de sementes e folhas de plantas de diferentes cultivares nos estados do Paraná, São Paulo, Mato Grosso, Minas Gerais, e Paraiba, entre 1999 e 2003. Baseado em testes de patogenicidade, vinte e um isolados foram classificados como CG e 32 como CGC. Os resultados obtidos por RAPD-PCR, utilizando-se oito primers, revelaram dois grupos distintos sendo que o primeiro foi formado por 94% dos isolados de sementes e o segundo por 95% dos isolados de folhas. Na análise de ERIC- e REP-PCR, resultados semelhantes a RAPD foram obtidos, sendo que o primeiro grupo foi formado por 93% dos isolados provenientes das sementes e o segundo por 78% dos isolados provenientes das folhas. Quando o produto de amplificação da região ITS rDNA foi digerido com oito enzimas de restrição, um perfil de bandas semelhante para todos os isolados foi obtido. Resultados de RAPD, ERIC- e REP-PCR demonstraram que existem diferenças genéticas entre os isolados provenientes das sementes e aqueles provenientes de parte aérea, e esses dois grupos foram claramente distintos. Estudos futuros devem ser realizados utilizando outras técnicas moleculares para a obtenção de marcadores capazes de distinguir entre isolados de CG e CGC.Cotton is attacked by Colletotrichum gossypii (CG and C. gossypii var. cephalosporioides (CGC. Both the pathogens are transmitted by seed and their morphological distinction is extremely difficult and inconsistent. In the present study, attempts were made to verify the genetic variability among 53 isolates of CG and CGC using

Electron tomography of the microtubule cytoskeleton in multinucleated hyphae of Ashbya gossypii.

Science.gov (United States)

Gibeaux, Romain; Lang, Claudia; Politi, Antonio Z; Jaspersen, Sue L; Philippsen, Peter; Antony, Claude

2012-12-01

We report the mechanistic basis guiding the migration pattern of multiple nuclei in hyphae of Ashbya gossypii. Using electron tomography, we reconstructed the cytoplasmic microtubule (cMT) cytoskeleton in three tip regions with a total of 13 nuclei and also the spindle microtubules of four mitotic nuclei. Each spindle pole body (SPB) nucleates three cMTs and most cMTs above a certain length grow according to their plus-end structure. Long cMTs closely align for several microns along the cortex, presumably marking regions where dynein generates pulling forces on nuclei. Close proximity between cMTs emanating from adjacent nuclei was not observed. The majority of nuclei carry duplicated side-by-side SPBs, which together emanate an average of six cMTs, in most cases in opposite orientation with respect to the hyphal growth axis. Such cMT arrays explain why many nuclei undergo short-range back and forth movements. Only occasionally do all six cMTs orient in one direction, a precondition for long-range nuclear bypassing. Following mitosis, daughter nuclei carry a single SPB with three cMTs. The increased probability that all three cMTs orient in one direction explains the high rate of nuclear bypassing observed in these nuclei. The A. gossypii mitotic spindle was found to be structurally similar to that of Saccharomyces cerevisiae in terms of nuclear microtubule (nMT) number, length distribution and three-dimensional organization even though the two organisms differ significantly in chromosome number. Our results suggest that two nMTs attach to each kinetochore in A. gossypii and not only one nMT like in S. cerevisiae.

National Plant Diagnostic Network, Taxonomic training videos: Aphids under the microscope - Aphis gossypii

Science.gov (United States)

Training is a critical part of aphid (Hemiptera: Aphididae) identification. This video provides provides training to identify the cotton aphid, Aphis gossypii, using a compound microscope and an electronic identification key called “LUCID.” The video demonstrates key morphological structures that ca...

The APSES protein Sok2 is a positive regulator of sporulation in Ashbya gossypii.

Science.gov (United States)

Wasserstrom, Lisa; Dünkler, Alexander; Walther, Andrea; Wendland, Jürgen

2017-12-01

Ashbya gossypii is a homothallic, flavinogenic, filamentous ascomycete that starts overproduction of riboflavin and fragments its mycelium quantitatively into spore producing sporangia at the end of a growth phase. Mating is not required for sporulation and the standard homothallic laboratory strain is a MATa strain. Here we show that ectopic expression of Saccharomyces cerevisiae MATα2 in A. gossypii completely suppresses sporulation, inhibits riboflavin overproduction and downregulates among others AgSOK2. AgSok2 belongs to a fungal-specific group of (APSES) transcription factors. Deletion of AgSOK2 strongly reduces riboflavin production and blocks sporulation. The initiator of meiosis, AgIME1, is a transcription factor essential for sporulation. We characterized the AgIME1 promoter region required for complementation of the Agime1 mutant. Reporter assays with AgIME1 promoter fragments fused to lacZ showed that AgSok2 does not control AgIME1 transcription. However, global transcriptome analysis identified two other essential regulators of sporulation, AgIME2 and AgNDT80, as potential targets of AgSok2. Our data suggest that sporulation and riboflavin production in A. gossypii are under mating type locus and nutritional control. Sok2, a target of the cAMP/protein kinase A pathway, serves as a central positive regulator to promote sporulation. This contrasts Saccharomyces cerevisiae where Sok2 is a repressor of IME1 transcription. © 2017 John Wiley & Sons Ltd.

Lethal and sublethal effects of neem on Aphis gossypii and Cycloneda sanguinea in watermelon

Directory of Open Access Journals (Sweden)

Cíntia Ribeiro Souza

2015-05-01

Full Text Available The objective of this study was to evaluate the impact of oil extract of neem, Azadirachta indica, on the watermelon aphid Aphis gossypii and its natural enemy Cycloneda sanguinea. Toxicity bioassays were conducted with the commercial product DalNeem (1,475 g L-1 azadirachtin at 0.0037 µg a.i. mL-1, 0.0074 µg a.i. mL-1 and 0.0148 µg a.i. mL-1, Malathion at 1 µg a.i. mL-1 and distilled water as a control treatment. The products were sprayed to watermelon leaf discs, and the insects were exposed to the product residues. The instantaneous population growth rate of A. gossypii and the survival of C. sanguinea larvae exposed to the different treatments were calculated. A decrease in the instantaneous population growth rate of A. gossypii with increasing concentrations of neem was observed, and the aphids did not reproduce on the leaf discs treated with malathion during the first 24 hours of exposure due to its rapid lethal effect on adult insects. The larvae of the predator C. sanguinea exposed to malathion survived only for 24 hours. The survival of the predator exposed to different concentrations of neem was also significantly reduced compared to the predators exposed only to water. However, laboratory experiments may overestimate the effect of neem on predators because the individuals cannot employ escape behavior caused by neem repellency.

Evaluation of antifungal metabolites activity from bacillus licheniformis OE-04 against Colletotrichum gossypii.

Science.gov (United States)

Nawaz, Hafiz Husnain; Nelly Rajaofera, M J; He, Qiguang; Anam, Usmani; Lin, Chunhua; Miao, Weiguo

2018-04-01

Anthracnose disease in the cotton plant caused by fungal pathogen Colletotrichum gossypii. It is supposed to be most critical diseases in the cotton crop as it causes infection and leads to complete damaging of the cotton crop by infecting the leaves, stems, and bolls in the field. The disease control is challenging due to the absence of an effective fungicide without damaging the farmer health and environment. So the series of experiments were designed to assess the antagonistic activity of biosurfactant released by strain Bacillus licheniformis OE-04 against the anthracnose causing agent in cotton and this strain was screened out from forty eight strain of rhizobacteria. We also estimated the heat stability and pH range and toxicity of biosurfactant produced by strain 0E-04. The results showed that biosurfactant has maximum antifungal activity against C. gossypii. In vitro study concluded that the biosurfactant can reduce fungal activity by inhibiting the spore germination of C. gossypii. Moreover, the biosurfactant also has wide pH and temperature range. We observed Antifungal activity of biosurfactant at 5 to 10 pH range and temperature range was also wide from room temperature to 100 °C. We also observed the toxicity of biosurfactant produced by Bacillus licheniformis against zebra fish (Danio rerio). We were noticed that biosurfactant have least harmful effect with maximum concentration. The study confirmed that biosurfactant of Bacillus licheniformis have high pH and heat stability range with least harmful effects so it can be a good replacement of chemical pesticides for cotton anthracnose control. Copyright © 2018 Elsevier Inc. All rights reserved.

Seed Treatment Combined with a Spot Application of Clothianidin Granules Prolongs the Efficacy of Controlling Piercing-Sucking Insect Pests in Cotton Fields.

Science.gov (United States)

Zhang, Zhengqun; Zhao, Yunhe; Wang, Yao; Li, Beixing; Lin, Jin; Zhang, Xuefeng; Mu, Wei

2017-09-13

Seed treatments can directly protect cotton from early season piercing-sucking insect Aphis gossypii Glover but hardly provide long-term protection against Apolygus lucorum (Meyer-Dür). Therefore, the efficacy of clothianidin seed treatments combined with spot applications of clothianidin granules at the bud stage of cotton was evaluated to control piercing-sucking pests during the entire cotton growing season. Clothianidin seed treatments (at the rate of 4 g ai/kg seed) combined with a clothianidin granular treatment (even at low rate of 0.9 kg ai/ha) at the bud stage can effectively suppress A. gossypii and A. lucorum infestations throughout the seedling and blooming stages after planting and can improve cotton yield. The spot application of clothianidin granules also reduced the population densities of Bemisia tabaci (Gennadius). The dynamic changes of clothianidin residues demonstrated that the control efficacy of clothianidin against A. gossypii and A. lucorum might be related to the residues of this neonicotinoid in cotton leaves. This pest management practice provided long-term protection against cotton piercing-sucking pests for the entire growing season of cotton plants and could supplement the short-term control efficiency of clothianidin used as a seed treatment.

Effect of alternative prey on development and consumption of Orius insidiosus (Say) (Hemiptera, Anthocoridae) and oviposition behavior on chrysantemum cultivars

International Nuclear Information System (INIS)

Soglia, Maria da Conceicao M.; Bueno, Vanda Helena Paes; Carvalho, Livia Mendes

2007-01-01

This work aimed to evaluate the development time and the consumption of Orius insidiosus (Say, 1832) feeding on Aphis gossypii Glover, 1877 as well as its oviposition behavior on two chrysanthemum cut cultivars. The trials were conducted in climatic chamber at 25 ± 1 deg C, RH 70 ± 10% and 12h photo phase. Nymphs of the predator, less than 24h old, were kept individually in petri dishes (5cm) with 20 nymphs of A. gossypii (first, second and third instar) on leaf disc (4 cm) of each cultivar ('White Reagan' and 'Yellow Snowdon') in a layer of agar-water (1%). Petiole of each chrysanthemum cultivar as oviposition substrate was evaluated and the females were feeding on eggs of Anagasta kuehniella (Zeller, 1879). The predator complete its development feeding on A. gossypii kept in both cultivars. The duration of nymphal phase of O. insidiosus were 21.1 and 18.3 days on 'White Reagan' and 'Yellow Snowdon', respectively. The consumption of the females of O. insidiosus was higher (P<0.01) on A. gossypii in 'White Reagan' (2.63 nymphs) compared to the consumption in 'Yellow Snowdon' (0.7 nymphs). Females of O. insidiosus oviposited in petiole of both cultivars with 22.5 and 23.3 eggs/female on 'White Reagan' and 'Yellow Snowdon', respectively. Release of O. insidiosus on chrysanthemum crops could be important to decrease the A. gossypii population, as the predator completes its development having this aphid as prey, and the chrysanthemum cultivars offer conditions to colonization and establishment of O. insidiosus. (author)

Organization of organelles within hyphae of Ashbya gossypii revealed by electron tomography.

Science.gov (United States)

Gibeaux, Romain; Hoepfner, Dominic; Schlatter, Ivan; Antony, Claude; Philippsen, Peter

2013-11-01

Ashbya gossypii grows as multinucleated and constantly elongating hyphae. Nuclei are in continuous forward and backward motion, also move during mitosis, and frequently bypass each other. Whereas these nuclear movements are well documented, comparatively little is known about the density and morphology of organelles which very likely influence these movements. To understand the three-dimensional subcellular organization of hyphae at high resolution, we performed large-scale electron tomography of the tip regions in A. gossypii. Here, we present a comprehensive space-filling model in which most membrane-limited organelles including nuclei, mitochondria, endosomes, multivesicular bodies, vacuoles, autophagosomes, peroxisomes, and vesicles are modeled. Nuclei revealed different morphologies and protrusions filled by the nucleolus. Mitochondria are very abundant and form a tubular network with a polarized spherical fraction. The organelles of the degradative pathways show a clustered organization. By analyzing vesicle-like bodies, we identified three size classes of electron-dense vesicles (∼200, ∼150, and ∼100 nm) homogeneously distributed in the cytoplasm which most likely represent peroxisomes. Finally, coated and uncoated vesicles with approximately 40-nm diameters show a polarized distribution toward the hyphal tip with the coated vesicles preferentially localizing at the hyphal periphery.

Primeiro Registro de Afídeos (Hemiptera: Aphidoidea) em Carambola (Averrhoa carambola L.) no Brasil

OpenAIRE

Cunha, Suzan Beatriz Zambon da; Sousa e Silva, Carlos Roberto

2016-01-01

A carambola (Averrhoa carambola L.) árvore de origem Asiática foi introduzida no Brasil em 1817, desde então vem aumentando sua área de cultivo no país. A planta é atacada por poucos insetos como as moscas e percevejos. Este trabalho relata a presença de Aphis gossypii Glover em A. carambola pela primeira vez no Brasil. First Record of Aphids (Hemiptera: Aphididae) on Starfruit (Averrhoa carambola L.) in Brazil Abstract. The starfruit (Averrhoa carambola L.) has origin Asiatic an...

Dynamics of multiple nuclei in Ashbya gossypii hyphae depend on the control of cytoplasmic microtubules length by Bik1, Kip2, Kip3, and not on a capture/shrinkage mechanism.

Science.gov (United States)

Grava, Sandrine; Philippsen, Peter

2010-11-01

Ashbya gossypii has a budding yeast-like genome but grows exclusively as multinucleated hyphae. In contrast to budding yeast where positioning of nuclei at the bud neck is a major function of cytoplasmic microtubules (cMTs), A. gossypii nuclei are constantly in motion and positioning is not an issue. To investigate the role of cMTs in nuclear oscillation and bypassing, we constructed mutants potentially affecting cMT lengths. Hyphae lacking the plus (+)end marker Bik1 or the kinesin Kip2 cannot polymerize long cMTs and lose wild-type nuclear movements. Interestingly, hyphae lacking the kinesin Kip3 display longer cMTs concomitant with increased nuclear oscillation and bypassing. Polymerization and depolymerization rates of cMTs are 3 times higher in A. gossypii than in budding yeast and cMT catastrophes are rare. Growing cMTs slide along the hyphal cortex and exert pulling forces on nuclei. Surprisingly, a capture/shrinkage mechanism seems to be absent in A. gossypii. cMTs reaching a hyphal tip do not shrink, and cMT +ends accumulate in hyphal tips. Thus, differences in cMT dynamics and length control between budding yeast and A. gossypii are key elements in the adaptation of the cMT cytoskeleton to much longer cells and much higher degrees of nuclear mobilities.

Effect of alternative prey on development and consumption of Orius insidiosus (Say) (Hemiptera, Anthocoridae) and oviposition behavior on chrysantemum cultivars; Efeito da presa alternativa no desenvolvimento e consumo de Orius insidiosus (Say) (Hemiptera, Anthocoridae) e comportamento de oviposicao em cultivares de crisantemo

Energy Technology Data Exchange (ETDEWEB)

Soglia, Maria da Conceicao M. [Universidade Federal da Bahia (UFBA), Cruz das Almas, BA (Brazil). Centro de Ciencias Agrarias e Ambientais], e-mail: mcsoglia@yahoo.com.br; Bueno, Vanda Helena Paes; Carvalho, Livia Mendes [Universidade Federal de Lavras (UFLA), MG (Brazil). Dept. de Entomologia], e-mail: vhpbueno@ufla.br

2007-10-15

This work aimed to evaluate the development time and the consumption of Orius insidiosus (Say, 1832) feeding on Aphis gossypii Glover, 1877 as well as its oviposition behavior on two chrysanthemum cut cultivars. The trials were conducted in climatic chamber at 25 {+-} 1 deg C, RH 70 {+-} 10% and 12h photo phase. Nymphs of the predator, less than 24h old, were kept individually in petri dishes (5cm) with 20 nymphs of A. gossypii (first, second and third instar) on leaf disc (4 cm) of each cultivar ('White Reagan' and 'Yellow Snowdon') in a layer of agar-water (1%). Petiole of each chrysanthemum cultivar as oviposition substrate was evaluated and the females were feeding on eggs of Anagasta kuehniella (Zeller, 1879). The predator complete its development feeding on A. gossypii kept in both cultivars. The duration of nymphal phase of O. insidiosus were 21.1 and 18.3 days on 'White Reagan' and 'Yellow Snowdon', respectively. The consumption of the females of O. insidiosus was higher (P<0.01) on A. gossypii in 'White Reagan' (2.63 nymphs) compared to the consumption in 'Yellow Snowdon' (0.7 nymphs). Females of O. insidiosus oviposited in petiole of both cultivars with 22.5 and 23.3 eggs/female on 'White Reagan' and 'Yellow Snowdon', respectively. Release of O. insidiosus on chrysanthemum crops could be important to decrease the A. gossypii population, as the predator completes its development having this aphid as prey, and the chrysanthemum cultivars offer conditions to colonization and establishment of O. insidiosus. (author)

A comparative study on the effects of electron beam irradiation on imidacloprid-resistant and -susceptible Aphis gossypii (Hemiptera: Aphididae)

Science.gov (United States)

Yun, Seung-Hwan; Koo, Hyun-Na; Lee, Seon-Woo; Kim, Hyun Kyung; Kim, Yuri; Han, Bumsoo; Kim, Gil-Hah

2015-07-01

The melon and cotton aphid, Aphis gossypii, is a polyphagous insect pest. This study compared the development, reproduction, DNA damage, recovery, and gene expression in imidacloprid-resistant (IMI-R) and -susceptible (S) strains of A. gossypii by electron beam irradiation. When 1st instar nymphs were irradiated with 100 Gy, the fecundity (nymphs of F1 generation) of the resultant adults were completely inhibited. When adults were irradiated with 200 Gy, the number of total 1st instar nymphs produced per adult was 3.0±1.7 and 1.9±1.4 in the S and IMI-R strains, respectively, but adult development was completely suppressed. However, electron beam irradiation did not affect adult longevity in either the S or IMI-R strain. There was no statistically significant difference between the effect of irradiation on the S and IMI-R strains. Therefore, electron beam irradiation at 200 Gy could be used as a phytosanitary irradiation treatment for both S and IMI-R strains of A. gossypii. The DNA damage caused by electron beam irradiation was evaluated by an alkaline comet assay. Exposure to an electron beam (50 Gy) induced DNA damage that was repaired to a similar level as the untreated control group (0 Gy) over time. However, at more than 100 Gy, the DNA damage was not completely repaired. The expression of P450, HSP70, cuticle protein, and elongation factor genes were higher in the IMI-R strain than in the S strain.

The behavior of Aphis gossypii and Aphis craccivora (Hemiptera: Aphididae) and of their predator Cycloneda sanguinea (Coleoptera: Coccinellidae) in cotton-cowpea intercropping systems.

Science.gov (United States)

Fernandes, Francisco S; Godoy, Wesley A C; Ramalho, Francisco S; Malaquias, José B; Santos, Bárbara D B

2018-01-01

The intercropping is an important cultural practice commonly used in pest management. It is based on the principle that increased plant diversity in the agro-ecosystem can lead to reductions of pest populations in the crop. The current study aimed to assess the impact the colored fiber cotton-cowpea intercropped systems on Aphis gossypii and Aphis craccivora and on their predator Cycloneda sanguinea and the losses and the dispersion behavior of these aphids and their predator in these cropping systems. The experiment had a randomized block experimental design with two bioassays and four treatments. The number of apterous and alate aphids (A. gossypii) per cotton plant was 1.46 and 1.73 or 1.97 and 2.19 times highest in the solid cotton system than that found in the cotton-cowpea intercropped systems (S1) and (S2), respectively. On the other hand, the cotton-cowpea intercropped systems (S1 and S2) reduced, respectively, in 43% and 31% the number of apterousA. gossypiiper cotton plant compared to the control. Implementing cotton-cowpea intercropped system in the S1 scheme reduced A. gossypii infestation, favored the multiplication of C. sanguinea, and allowed obtaining heavier open bolls.

Quality of different aphids as hosts of the parasitoid Lysiphlebus testaceipes (Cresson) (Hymenoptera: Braconidae, Aphidiinae); Qualidade de diferentes especies de pulgoes como hospedeiros do parasitoide Lysiphlebus testaceipes (Cresson) (Hymenoptera: Braconidae, Aphidiinae)

Energy Technology Data Exchange (ETDEWEB)

Silva, Robson J.; Bueno, Vanda H.P. [Universidade Federal de Lavras, MG (Brazil). Dept. de Entomologia]. E-mail: vhpbueno@ufla.br; Sampaio, Marcus V.[Universidade Federal de Uberlandia (UFU), MG (Brazil). Inst. de Ciencias Agrarias]. E-mail: mvsampaio@iciag.ufu.br

2008-03-15

Lysiphlebus testaceipes (Cresson) has a broad aphid host range; however the quality of these preys may interfere in its biological feature. This study aimed to evaluate the quality of three Macrosiphini, Brevicoryne brassicae (L.), Lipaphis erysimi (Kaltenbach) and Myzus persicae (Sulzer), and three Aphidini Schizaphis graminum (Rondani) Rhopalosiphum maidis (Fitch) and Aphis gossypii Glover as hosts to L. testaceipes and to determine the relation possible of host preference, of size and quality of the host. The tests were carried out in climatic chamber at 25 {+-} 1 deg C, RH 70 {+-} 10% and 12h photophase. The parasitoid did not oviposite in B. brassicae and L. erysimi, while the other species were nutritionally suitable to the parasitoid. L. testaceipes showed preference for aphids from tribe Aphidini and these hosts presented better quality to the parasitoid when compared to Macrosiphini. Interactions among size, preference and quality between the Aphidini were found. L. testaceipes showed preference (parasitism rate 76.7%) for R. maidis, the bigger host (hind tibia with 0.281 mm). This host provided bigger size (hind tibia with 0.49 mm) and higher emergence rate (95.6%) to the parasitoid when compared to A. gossypii (parasitism rate of 55.7%). Also the smaller host A. gossypii (0.266 mm) provided smaller size hind tibia (0.45 mm) and higher mortality of the parasitoid (emergence rate 72.1%). However, the development time was shorter and the longevity was higher in A. gossypii (6.3 and 5.4 days, respectively) when compared to the host R. maidis (6.7 and 3.8 days, respectively), and not been related to host size. (author)

A mutant with riboflavin productivity obtained from non-riboflavin-producing ashbya gossypii by γ-induction

International Nuclear Information System (INIS)

Yang Suhong; Ge Zhongliang

1993-01-01

60 Co γ-ray was used to irradiate Ashbya gossypii, which does not produce riboflavin originally, and mutants were obtained with colonial colour changing from white into yellow. Mutant ratio was high at the absorption dose of 90 Gy. Results of reverse phase-HPLC, high performance-TLC and fluoroscopic analysis proved that riboflavin is produced by the mutant fermentation. The mutant remained after generations of culture, indicating that the induced new properties are stably inheritable

Desenvolvimento larval de Chrysoperla externa alimentada com Aphis gossypii provenientes de três cultivares de algodoeiro

Directory of Open Access Journals (Sweden)

Eunice Cláudia Schlick-Souza

2011-10-01

Full Text Available O objetivo deste trabalho foi avaliar os aspectos biológicos de Chrysoperla externa alimentadas com Aphis gossypii provenientes de três cultivares de algodoeiro (FMT 701, Acala 90 e Delta Opal. O experimento foi conduzido no Laboratório de Fitossanidade da Universidade Estadual de Mato Grosso do Sul (UEMS, Unidade de Cassilândia (MS. Os adultos de C. externa foram mantidos em gaiolas de PVC, em sala climatizada. As larvas do predador foram individualizadas em placas de Petri e alimentadas diariamente com pulgões advindos das diferentes cultivares. Larvas que se alimentaram de indíviduos da cultivar FMT 701 apresentaram a viabilidade menor do que as que alimentaram dos afídeos criados nas cultivares Delta Opal e Acala 90. Observou-se redução do consumo diário nas larvas de terceiro ínstar que se alimentaram dos pulgões advindos da cultivar Acala 90. Consequentemente, larvas supridas com pulgões criados nas cultivares Delta Opal e Acala 90, tiveram menor peso, 3,60 e 3,90 mg respectivamente, diferindo significativamente da FMT 701. De modo geral, é possível a utilização de C. externa no controle de A. gossypii nas cultivares estudadas.

Presence of Native Prey Does Not Divert Predation on Exotic Pests by Harmonia axyridis in Its Indigenous Range

Science.gov (United States)

Zhang, Gui Fen; Lövei, Gábor L; Wu, Xia; Wan, Fang Hao

2016-01-01

In China, two invasive pests, Bemisia tabaci MEAM1 (Gennadius) and Frankliniella occidentalis (Pergande), often co-occur with the native pest, Aphis gossypii (Glover), on plants of Malvaceae and Cucurbitaceae. All three are preyed on by the native ladybird, Harmonia axyridis (Pallas); however, the native predator might be expected to prefer native prey to the exotic ones due to a shared evolutionary past. In order to clarify whether the presence of native prey affected the consumption of these two invasive species by the native predator, field-cage experiments were conducted. A duplex qPCR was used to simultaneously detect both non-native pests within the gut of the predator. H. axyridis readily accepted both invasive prey species, but preferred B. tabaci. With all three prey species available, H. axyridis consumption of B. tabaci was 39.3±2.2% greater than consumption of F. occidentalis. The presence of A. gossypii reduced (by 59.9% on B. tabaci, and by 60.6% on F. occidentalis), but did not stop predation on the two exotic prey when all three were present. The consumption of B. tabaci was similar whether it was alone or together with A. gossypii. However, the presence of aphids reduced predation on the invasive thrips. Thus, some invasive prey may be incorporated into the prey range of a native generalist predator even in the presence of preferred native prey. PMID:27391468

A comparative study on the effects of electron beam irradiation on imidacloprid-resistant and -susceptible Aphis gossypii (Hemiptera: Aphididae)

International Nuclear Information System (INIS)

Yun, Seung-Hwan; Koo, Hyun-Na; Lee, Seon-Woo; Kim, Hyun Kyung; Kim, Yuri; Han, Bumsoo; Kim, Gil-Hah

2015-01-01

The melon and cotton aphid, Aphis gossypii, is a polyphagous insect pest. This study compared the development, reproduction, DNA damage, recovery, and gene expression in imidacloprid-resistant (IMI-R) and -susceptible (S) strains of A. gossypii by electron beam irradiation. When 1st instar nymphs were irradiated with 100 Gy, the fecundity (nymphs of F 1 generation) of the resultant adults were completely inhibited. When adults were irradiated with 200 Gy, the number of total 1st instar nymphs produced per adult was 3.0±1.7 and 1.9±1.4 in the S and IMI-R strains, respectively, but adult development was completely suppressed. However, electron beam irradiation did not affect adult longevity in either the S or IMI-R strain. There was no statistically significant difference between the effect of irradiation on the S and IMI-R strains. Therefore, electron beam irradiation at 200 Gy could be used as a phytosanitary irradiation treatment for both S and IMI-R strains of A. gossypii. The DNA damage caused by electron beam irradiation was evaluated by an alkaline comet assay. Exposure to an electron beam (50 Gy) induced DNA damage that was repaired to a similar level as the untreated control group (0 Gy) over time. However, at more than 100 Gy, the DNA damage was not completely repaired. The expression of P450, HSP70, cuticle protein, and elongation factor genes were higher in the IMI-R strain than in the S strain. - Highlights: • Electron beam irradiation induces abnormal development in both the IMI-R and -S strain. • Electron beam irradiation induces DNA damage in both the S and IMI-R strain. • The expression of several specific genes were higher in the IMI-R strain. • 200 Gy could be used as a phytosanitary treatment for both strains of this species

Toxic and Repellent effecto of Harmal (Peganum harmala L. Acetonic Extract on Several Aphids and Tribolium castaneum (Herbst Efecto Tóxico y Repelente del Extracto Acetónico de Harmal (Peganum harmala L. sobre varias especies de Áfidos y Tribolium castaneum (Herbst

Directory of Open Access Journals (Sweden)

Elham Salari

2012-03-01

Full Text Available To reduce the dependence on the sometimes unwise use of synthetic pesticides in fruit and vegetable plantations, the toxicity and repellence of Peganum harmala L. (Zygophyllaceae acetonic seed extract was assayed against several insect pests. For contact toxicity, 3- to 4-d-old individuals of Aphis fabae Scopoli, A. gossypii Glover, A. nerii Boyer de Fonscolombe, and Myzus persicae (Sulzer were included, as well as 1- to 7-d-old adult Tribolium castaneum (Herbst. Repellent effect experiments were conducted on adult, 1- to 2- and 3- to 4-d old M.persicae individuals. At 60 mg mL4, the topical bioassay mortality percentage was significantly higher in A. gossypii than in A. fabae and A. nerii after 12-72 h. Mortality of the treatments on M.persicae was 87.1% and 90.0% after 24 and 48 h, respectively, and significantly higher than A. fabae and A. nerii during this period. At 60 mg mL-1, the mortality of T. castaneum was much lower than that of the aphid species. The highest repellent index (over 72% was observed on 1- to 2-d-old M. persicae individuals.Para reducir la dependencia de los pesticidas sintéticos en plantaciones frutales y hortalizas, se realizó un ensayo para medir la toxicidad y repelencia de un extracto acetónico obtenido a partir de semillas de Peganum harmala L. (Zygophyllaceae contra diferentes especies de plagas. Para evaluar la toxicidad del extracto al contacto con los insectos, se incluyeron individuos de 3-4 d de edad de Aphis fabae Scopoli, Aphis gossypii Glover, Aphis nerii Boyer de Fonscolombe, y Myzus persicae (Sulzer, así como adultos 1-7 d de edad de Tribolium castaneum (Herbst. Experimentos para medir el efecto repelente se llevaron a cabo con individuos de 1-2 y 3-4 d de edad de M. persicae. En los resultados de los bioensayos tópicos el porcentaje de mortalidad fue significativamente mayor en la especie A. gossypii que en A. fabae y A. nerii, después de 12-72 h con una concentración de 60 mg mL-1. La mortalidad

The entomopathogenic fungal endophytes Purpureocillium lilacinum (formerly Paecilomyces lilacinus) and Beauveria bassiana negatively affect cotton aphid reproduction under both greenhouse and field conditions.

Science.gov (United States)

Castillo Lopez, Diana; Zhu-Salzman, Keyan; Ek-Ramos, Maria Julissa; Sword, Gregory A

2014-01-01

The effects of two entomopathogenic fungal endophytes, Beauveria bassiana and Purpureocillium lilacinum (formerly Paecilomyces lilacinus), were assessed on the reproduction of cotton aphid, Aphis gossypii Glover (Homoptera:Aphididae), through in planta feeding trials. In replicate greenhouse and field trials, cotton plants (Gossypium hirsutum) were inoculated as seed treatments with two concentrations of B. bassiana or P. lilacinum conidia. Positive colonization of cotton by the endophytes was confirmed through potato dextrose agar (PDA) media plating and PCR analysis. Inoculation and colonization of cotton by either B. bassiana or P. lilacinum negatively affected aphid reproduction over periods of seven and 14 days in a series of greenhouse trials. Field trials were conducted in the summers of 2012 and 2013 in which cotton plants inoculated as seed treatments with B. bassiana and P. lilacinum were exposed to cotton aphids for 14 days. There was a significant overall effect of endophyte treatment on the number of cotton aphids per plant. Plants inoculated with B. bassiana had significantly lower numbers of aphids across both years. The number of aphids on plants inoculated with P. lilacinum exhibited a similar, but non-significant, reduction in numbers relative to control plants. We also tested the pathogenicity of both P. lilacinum and B. bassiana strains used in the experiments against cotton aphids in a survival experiment where 60% and 57% of treated aphids, respectively, died from infection over seven days versus 10% mortality among control insects. Our results demonstrate (i) the successful establishment of P. lilacinum and B. bassiana as endophytes in cotton via seed inoculation, (ii) subsequent negative effects of the presence of both target endophytes on cotton aphid reproduction using whole plant assays, and (iii) that the P. lilacinum strain used is both endophytic and pathogenic to cotton aphids. Our results illustrate the potential of using these

The entomopathogenic fungal endophytes Purpureocillium lilacinum (formerly Paecilomyces lilacinus and Beauveria bassiana negatively affect cotton aphid reproduction under both greenhouse and field conditions.

Directory of Open Access Journals (Sweden)

Diana Castillo Lopez

Full Text Available The effects of two entomopathogenic fungal endophytes, Beauveria bassiana and Purpureocillium lilacinum (formerly Paecilomyces lilacinus, were assessed on the reproduction of cotton aphid, Aphis gossypii Glover (Homoptera:Aphididae, through in planta feeding trials. In replicate greenhouse and field trials, cotton plants (Gossypium hirsutum were inoculated as seed treatments with two concentrations of B. bassiana or P. lilacinum conidia. Positive colonization of cotton by the endophytes was confirmed through potato dextrose agar (PDA media plating and PCR analysis. Inoculation and colonization of cotton by either B. bassiana or P. lilacinum negatively affected aphid reproduction over periods of seven and 14 days in a series of greenhouse trials. Field trials were conducted in the summers of 2012 and 2013 in which cotton plants inoculated as seed treatments with B. bassiana and P. lilacinum were exposed to cotton aphids for 14 days. There was a significant overall effect of endophyte treatment on the number of cotton aphids per plant. Plants inoculated with B. bassiana had significantly lower numbers of aphids across both years. The number of aphids on plants inoculated with P. lilacinum exhibited a similar, but non-significant, reduction in numbers relative to control plants. We also tested the pathogenicity of both P. lilacinum and B. bassiana strains used in the experiments against cotton aphids in a survival experiment where 60% and 57% of treated aphids, respectively, died from infection over seven days versus 10% mortality among control insects. Our results demonstrate (i the successful establishment of P. lilacinum and B. bassiana as endophytes in cotton via seed inoculation, (ii subsequent negative effects of the presence of both target endophytes on cotton aphid reproduction using whole plant assays, and (iii that the P. lilacinum strain used is both endophytic and pathogenic to cotton aphids. Our results illustrate the potential of

Treehoppers (Homoptera, Membracidae in southeastern Brazil: use of host plants

Directory of Open Access Journals (Sweden)

Benedito C. Lopes

1995-09-01

Full Text Available A survey on the use of host plants by treehoppers in plants in cerrado (savanna vegetation at Moji-Guaçu (São Paulo, Southeastern Brazil was made. Fifty-two species of treehoppers were recorded in association with 40 host plant species from October 1980 to February 1982. The families Araliaceae, Asteraceae, Leguminosae, Malpighiaceae, Myrtaceae and Nyctaginaceae were the most commonly used for oviposition. Byrsonima intermedia A. Juss. (Malpighiaceae had the highest number of associated treehopper species (10 species. The abundance of treehopper individuals was related to the hot and rainy season (from October to February, while during the cold and dry season (from March to September there was a decrease in the number of these Homoptera. After the occurrence of a frost, few adults and nymphs were observed on the host plants for one to two months.

Oxidative stress protection and glutathione metabolism in response to hydrogen peroxide and menadione in riboflavinogenic fungus Ashbya gossypii.

Science.gov (United States)

Kavitha, S; Chandra, T S

2014-11-01

Ashbya gossypii is a plant pathogen and a natural overproducer of riboflavin and is used for industrial riboflavin production. A few literature reports depict a link between riboflavin overproduction and stress in this fungus. However, the stress protection mechanisms and glutathione metabolism are not much explored in A. gossypii. In the present study, an increase in the activity of catalase and superoxide dismutase was observed in response to hydrogen peroxide and menadione. The lipid peroxide and membrane lipid peroxide levels were increased by H2O2 and menadione, indicating oxidative damage. The glutathione metabolism was altered with a significant increase in oxidized glutathione (GSSG), glutathione peroxidase (GPX), glutathione S transferase (GST), and glutathione reductase (GR) and a decrease in reduced glutathione (GSH) levels in the presence of H2O2 and menadione. Expression of the genes involved in stress mechanism was analyzed in response to the stressors by semiquantitative RT-PCR. The messenger RNA (mRNA) levels of CTT1, SOD1, GSH1, YAP1, and RIB3 were increased by H2O2 and menadione, indicating the effect of stress at the transcriptional level. A preliminary bioinformatics study for the presence of stress response elements (STRE)/Yap response elements (YRE) depicted that the glutathione metabolic genes, stress genes, and the RIB genes hosted either STRE/YRE, which may enable induction of these genes during stress.

Folic Acid Production by Engineered Ashbya gossypii.

Science.gov (United States)

Serrano-Amatriain, Cristina; Ledesma-Amaro, Rodrigo; López-Nicolás, Rubén; Ros, Gaspar; Jiménez, Alberto; Revuelta, José Luis

2016-11-01

Folic acid (vitamin B 9 ) is the common name of a number of chemically related compounds (folates), which play a central role as cofactors in one-carbon transfer reactions. Folates are involved in the biosynthesis and metabolism of nucleotides and amino acids, as well as supplying methyl groups to a broad range of substrates, such as hormones, DNA, proteins, and lipids, as part of the methyl cycle. Humans and animals cannot synthesize folic acid and, therefore, need them in the diet. Folic acid deficiency is an important and underestimated problem of micronutrient malnutrition affecting billions of people worldwide. Therefore, the addition of folic acid as food additive has become mandatory in many countries thus contributing to a growing demand of the vitamin. At present, folic acid is exclusively produced by chemical synthesis despite its associated environmental burdens. In this work, we have metabolically engineered the industrial fungus Ashbya gossypii in order to explore its potential as a natural producer of folic acid. Overexpression of FOL genes greatly enhanced the synthesis of folates and identified GTP cyclohydrolase I as the limiting step. Metabolic flux redirection from competing pathways also stimulated folic acid production. Finally, combinatorial engineering synergistically increased the production of different bioactive forms of the folic vitamin. Overall, strains were constructed which produce 146-fold (6595µg/L) more vitamin than the wild-type and by far represents the highest yield reported. Copyright © 2016 International Metabolic Engineering Society. Published by Elsevier Inc. All rights reserved.

Synthesis and biological activity of pyridazine amides, hydrazones and hydrazides.

Science.gov (United States)

Buysse, Ann M; Yap, Maurice Ch; Hunter, Ricky; Babcock, Jonathan; Huang, Xinpei

2017-04-01

Optimization studies on compounds initially designed to be herbicides led to the discovery of a series of [6-(3-pyridyl)pyridazin-3-yl]amides exhibiting aphicidal properties. Systematic modifications of the amide moiety as well as the pyridine and pyridazine rings were carried out to determine if these changes could improve insecticidal potency. Structure-activity relationship (SAR) studies showed that changes to the pyridine and pyridazine rings generally resulted in a significant loss of insecticidal potency against green peach aphids [Myzus persicae (Sulzer)] and cotton aphids [(Aphis gossypii (Glover)]. However, replacement of the amide moiety with hydrazines, hydrazones, or hydrazides appeared to be tolerated, with small aliphatic substituents being especially potent. A series of aphicidal [6-(3-pyridyl)pyridazin-3-yl]amides were discovered as a result of random screening of compounds that were intially investigated as herbicides. Follow-up studies of the structure-activity relationship of these [6-(3-pyridyl)pyridazin-3-yl]amides showed that biosteric replacement of the amide moiety was widely tolerated suggesting that further opportunities for exploitation may exist for this new area of insecticidal chemistry. Insecticidal efficacy from the original hit, compound 1, to the efficacy of compound 14 produced greater than 10-fold potency improvement against Aphis gossypii and greater than 14-fold potency improvement against Myzus persicae. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

Intercropping System for Protection the Potato Plant from Insect Infestation

Directory of Open Access Journals (Sweden)

Aziza Sharaby

2015-06-01

Full Text Available The use of intercropping system provides an option for insect control for organic farmers that are limited in their chemical use. Additionally, intercropping systems can be attractive to conventional growers as a cost-effective insect control solution. A study was carried out for two seasons 2011-2012 and 2012-2013 to evaluate the effect of intercropping of potato (Solanum tuberosum L. with onion (Allium cepa L. on whitefly (Bemicia tabasi Gennadius and aphids’ Myzus persicae Sulz. and Aphis gossypii Glover infestation in potato fields. Results indicated that intercropping significantly reduced potato plant infestation with whitefly by 42.7, 51.3% while it was 62.69% reduction with aphids during the two successive winter seasons than when potato plants were cultivated alone. Therefore, intercropping could be recommended as a protection method of reducing pest population in the fields.

Sequence and structural characterization of Trx-Grx type of monothiol glutaredoxins from Ashbya gossypii.

Science.gov (United States)

Yadav, Saurabh; Kumari, Pragati; Kushwaha, Hemant Ritturaj

2013-01-01

Glutaredoxins are enzymatic antioxidants which are small, ubiquitous, glutathione dependent and essentially classified under thioredoxin-fold superfamily. Glutaredoxins are classified into two types: dithiol and monothiol. Monothiol glutaredoxins which carry the signature "CGFS" as a redox active motif is known for its role in oxidative stress, inside the cell. In the present analysis, the 138 amino acid long monothiol glutaredoxin, AgGRX1 from Ashbya gossypii was identified and has been used for the analysis. The multiple sequence alignment of the AgGRX1 protein sequence revealed the characteristic motif of typical monothiol glutaredoxin as observed in various other organisms. The proposed structure of the AgGRX1 protein was used to analyze signature folds related to the thioredoxin superfamily. Further, the study highlighted the structural features pertaining to the complex mechanism of glutathione docking and interacting residues.

Evolution of multinucleated Ashbya gossypii hyphae from a budding yeast-like ancestor.

Science.gov (United States)

Schmitz, Hans-Peter; Philippsen, Peter

2011-06-01

In the filamentous ascomycete Ashbya gossypii polarity establishment at sites of germ tube and lateral branch emergence depends on homologues of Saccharomyces cerevisiae factors controlling bud site selection and bud emergence. Maintenance of polar growth involves homologues of well-known polarity factors of budding yeast. To achieve the much higher rates of sustained polar surface expansion of hyphae compared to mainly non-polarly growing yeast buds five important alterations had to evolve. Permanent presence of the polarity machinery at a confined area in the rapidly expanding hyphal tip, increased cytoplasmic space with a much enlarged ER surface for generating secretory vesicles, efficient directed transport of secretory vesicles to and accumulation at the tip, increased capacity of the exocytosis system to process these vesicles, and an efficient endocytosis system for membrane and polarity factor recycling adjacent to the zone of exocytosis. Morphological, cell biological, and molecular aspects of this evolution are discussed based on experiments performed within the past 10 y. Copyright © 2011 The British Mycological Society. Published by Elsevier Ltd. All rights reserved.

Clustering of Nuclei in Multinucleated Hyphae Is Prevented by Dynein-Driven Bidirectional Nuclear Movements and Microtubule Growth Control in Ashbya gossypii ▿ †

Science.gov (United States)

Grava, Sandrine; Keller, Miyako; Voegeli, Sylvia; Seger, Shanon; Lang, Claudia; Philippsen, Peter

2011-01-01

During filamentous fungus development, multinucleated hyphae employ a system for long-range nuclear migration to maintain an equal nuclear density. A decade ago the microtubule motor dynein was shown to play a central role in this process. Previous studies with Ashbya gossypii revealed extensive bidirectional movements and bypassings of nuclei, an autonomous cytoplasmic microtubule (cMT) cytoskeleton emanating from each nucleus, and pulling of nuclei by sliding of cMTs along the cortex. Here, we show that dynein is the sole motor for bidirectional movements and bypassing because these movements are concomitantly decreased in mutants carrying truncations of the dynein heavy-chain DYN1 promoter. The dynactin component Jnm1, the accessory proteins Dyn2 and Ndl1, and the potential dynein cortical anchor Num1 are also involved in the dynamic distribution of nuclei. In their absence, nuclei aggregate to different degrees, whereby the mutants with dense nuclear clusters grow extremely long cMTs. As in budding yeast, we found that dynein is delivered to cMT plus ends, and its activity or processivity is probably controlled by dynactin and Num1. Together with its role in powering nuclear movements, we propose that dynein also plays (directly or indirectly) a role in the control of cMT length. Those combined dynein actions prevent nuclear clustering in A. gossypii and thus reveal a novel cellular role for dynein. PMID:21642510

Controle da pérola-da-terra, Eurhizococcus brasiliensis (Hempel) (Homoptera:Margarodidae), através da insetigação

OpenAIRE

Hickel, Eduardo R.; Peruzzo, Edegar L.; Schuck, Enio

2001-01-01

A pérola-da-terra, Eurhizococcus brasiliensis (Hempel) (Homoptera: Margarodidae), é a principal praga da videira no Sul do Brasil. As estratégias normais de controle desta praga não afetam a população do inseto porque os indivíduos estão no subsolo e desenvolvem um corpo globoso resistente a intempéries. Assim sendo, um ensaio foi conduzido em laboratório para verificar a possibilidade de aplicar a insetigação no controle da pérola-da-terra. Tubos de 50 mm de altura de cano PVC (150 mm fi) fo...

Responses of Nasonovia ribisnigri (Homoptera: Aphididae) to susceptible and resistant lettuce.

Science.gov (United States)

Liu, Yong-Biao; McCreight, James D

2006-06-01

Nymphs and alates of aphid Nasonovia ribisnigri (Mosley) (Homoptera: Aphididae) were tested on 10 lettuce cultivars with N. ribisnigri resistance gene Nr and 18 cultivars without the resistance gene in various bioassays. Bioassays used whole plants, leaf discs, or leaf cages to determine susceptibility of commercial lettuce cultivars to N. ribisnigri infestation and to evaluate screening methods for breeding lettuce resistance to N. ribisnigri. Resistant and susceptible plants were separated in 3 d when using whole plant bioassays. Long-term (> or =7 d) no-choice tests using leaf cages or whole plants resulted in no survival of N. ribisnigri on resistant plants, indicating great promise of the Nr gene for management of N. ribisnigri. Effective screening was achieved in both no-choice tests where resistant or susceptible intact plants were tested separately in groups or individually and in choice tests where susceptible and resistant plants were intermixed. Leaf discs bioassays were not suitable for resistance screening. All lettuce cultivars without the resistance gene were suitable hosts for N. ribisnigri, indicating the great importance of this pest to lettuce production and the urgency in developing resistant lettuce cultivars to manage N. ribisnigri.

Ability of Aphis gossypii and Myzus persicae to Transmit Cucumber mosaic virus in Single and Mixed Infection with Two Potyviruses to Zucchini Squash Eficiência dos afídeos Aphis gossypii e Myzus persicae na transmissão do Cucumber mosaic virus em infecção simples e mista com dois Potyvirus para abobrinha de moita

Directory of Open Access Journals (Sweden)

Zayame Vegette Pinto

2008-06-01

Full Text Available The main objective of this work was to investigate the ability of Aphis gossypii and Myzus persicae to transmit Cucumber mosaic virus (CMV singly and mixed with two potyviruses (Papaya ringspot virus - type W, PRSV-W and Zucchini yellow mosaic virus, ZYMV, to zucchini squash plants (Cucurbita pepo. The results showed that the potyviruses in general were more efficiently transmitted by both species of aphids as compared to CMV. The transmission of PRSV-W, ZYMV and CMV separately was more efficient than in mixture.O objetivo desse trabalho foi estudar a eficiência de Aphis gossypii e Myzus persicae na transmissão do vírus do mosaico do pepino (Cucumber mosaic virus, CMV, isoladamente e em mistura com duas espécies de potyvirus (Vírus do mosaico do mamoeiro = Papaya ringspot virus - type W, PRSV-W e Vírus do mosaico amarelo da abobrinha = Zucchini yellow mosaic virus, ZYMV, para planta-testes de abobrinha de moita (Cucurbita pepo. Os dois potyvirus em geral foram transmitidos com mais eficiência pelas duas espécies de afídeos do que o CMV. A transmissão do PRSV-W, ZYMV e CMV, separadamente, foi mais eficiente do que em mistura.

Type of prey influences biology and consumption rate of Orius insidiosus (Say (Hemiptera, Anthocoridae

Directory of Open Access Journals (Sweden)

Simone M. Mendes

2002-01-01

Full Text Available Generalist predators are capable of consuming different types of prey, and as each prey may have distinct nutritional values, each may have a distinct impact on the biology of the predator. Therefore, the aim of this study was to determine how the consumption of different prey influences certain biological characteristics and the predatory capacity of Orius insidiosus (Say. The investigation was performed in climatic chamber at 25 ±1 ºC, RH 70 ± 10% and fotophase 12. Eggs of Anagasta kuehniella (Zeller, adults of Caliothrips phaseoli (Hood and nymphs of Aphis gossypii Glover were used as prey and were provided daily ad libitum for all the mobile stages of the predator. The results showed that biological parameters of O. insidiosus are affected differently depending on the type of prey ingested. The development time of the nymphal stage was 13.1, 11.23 and 10.25 days for O. insidiosus feeding on eggs of A. kuehniella, nymphs of A. gossypii and adults of C. phaseoli, respectively. Longevity was five times larger for adults fed on eggs of A. kuehniella (56.25 days compared to that of adults that preyed on nymphs of A. gossypii (11.44 days, and four times larger when the prey were adults of C. phaseoli (13.58 days. The consumption of eggs of A. kuehniella by predator females resulted in a shorter pre-oviposition period (3.2 days and a longer oviposition period (44.4 days when compared to the consumption of other types of prey. In addition, fecundity was increased with the consumption of eggs of A. kuehniella (195.25 eggs laid / female when compared to feeding on the other prey, C. phaseoli (70.00 eggs laid / female or A. gossypii (22.50 eggs laid / female. However, the consumption of aphids was larger (148.28 nymphs/ nymphal stage than that of thrips (74.10 thrips / nymphal stage or eggs of A. kuehniella (37.03 eggs /nymphal stage for all of the nymphal stages of the predator. The results indicate that the eggs of A. kuehniella are the type of

SEPARATION OF THE MINOR FLAVONOLS FROM FLOS GOSSYPII BY HIGH-SPEED COUNTERCURRENT CHROMATOGRAPHY

Science.gov (United States)

Yang, Yi; Zhao, Yongxin; Gu, Dongyu; Ayupbek, Amatjan; Huang, Yun; Dou, Jun; Ito, Yoichiro; Zhang, Tianyou; Aisa, Haji Akber

2010-01-01

An effective high-speed countercurrent chromatography (HSCCC) method was established for further separation and purification of four minor flavonols in addition to five major flavonols which were reported by our previous study from extracts of Flos Gossypii. HSCCC was performed with three two-phase solvent systems composed of n-hexane-ethyl acetate-methanol-water (7.5:15:6:7, v/v), (2.5:15:2:7, v/v) and (0:1:0:1, v/v). The separation was repeated 3 times, and 3.8 mg of 8-methoxyl-kaempferol-7-O-β-D-rhamnoside (HPLC purity 98.27%), 6.7 mg of astragalin (HPLC purity 94.18%), 3.3 mg of 4′-methoxyl-quercetin-7-O-β-D-glucoside (HPLC purity 94.30%) and 8.2 mg of hyperoside (HPLC purity 93.48%) were separated from 150 mg of the crude sample. The chemical structures of the flavonols were confirmed by MS, 1H NMR and 13C NMR. Meanwhile, the results indicated that the target compound with smaller K value (<0.5) can be separated by increasing column length of HSCCC. And four separation rules of flavonols according to the present study and references were summarized, which can be used as a useful guide for separation of flavonols by HSCCC. PMID:21494318

Comparative efficacy of some insecticides against cotton whitefly, bemisia tabaci (gennadius) (homoptera: aleyrodidae) under natural field conditions

International Nuclear Information System (INIS)

Nadeem, M.K.; Hasnain, M.; Ahmed, S.; Ashfaq, M.

2011-01-01

Comparative efficacy of five commonly used insecticides viz., acetamiprid, buprofezin, diafenthiuron, imidacloprid and endosulfan against nymph and adult population of cotton whitefly, Bemisia tabaci (Gennadius) (Homoptera: Aleyrodidae) under natural field conditions has been studied. Results showed that buprofezin was the most effective insecticide against nymph population of whitefly among the tested insecticides where nymphal population of B. tabaci was 0.2/leaf after 24h spray as compared to 1.9/leaf in control. Acetamiprid was the most effective against adult population of whitefly (0.3 to 1.3/leaf post 72 h spray, as compared to control with 6.9 to 8.2/leaf) followed by diafenthiuron and imidaclopirid. whereas, endosulfan was found to be the least effective on both populations as adult and nymph of whitefly. From the tested insecticides, acetamaprid gave effective control of both nymph and adult population of B. tabaci. (author)

COMPORTAMENTO DO FUNGO Colletotrichum gossypii South. var. cephalosporoides Costa EM SUBSTRATO COM DIFERENTES FONTES DE NITROGÊNIO THE BEHAVIOR OF THE FUNGUS Colletotrichum gossypii South Var. cephalosporoides Costa IN SUBSTRATE CONTAINING DIFFERENT SOURCES OF NITROGEN

Directory of Open Access Journals (Sweden)

Yvo de Carvalho

2007-09-01

Full Text Available

Nesse trabalho procurou-se observar o efeito de diversas substâncias nitrogenadas sobre o crescimento miceliano, esporulação e aspectos morfológicos das colônias do fungo Colletotrichum gossypii South. var. cephalosporoides Costa em substrato sólido. Usou-se um substrato sintético como meio-básico e a este se adicionou peptona, metionina, asparagina, nitrato de sódio ou salicilato de amônia, conforme o tratamento. A testemunha não recebeu qualquer fonte de nitrogênio. Concluiu-se que a peptona foi o melhor tratamento para esporulação e crescimento miceliano, seguindo-se a asparagina que foi eficiente na indução da esporulação. O salicilato de amônia exerceu efeito inibidor do crescimento vegetativo e da esporulação do fungo. Para produção de inóculo, a curto prazo, recomenda-se o uso da peptona como fonte de nitrogênio. Foram observadas diferenças na pigmentação, bordos e densidade das colônias. A esporulação, embora abundante em substratos contendo peptona e asparagina, ocorreu em forma de verdadeiras massas localizadas de conídios na primeira, e como conídios dispersos na segunda.

In this experiment, the effect of different nitrogenous substances on the mycelium growth, sporulation and morphological aspects of the colonies of the fungus Colletotrichum gossypii  South Var. cephalosporoides Costa planted in a solid substrate were observed. A synthetic substrate was used as a basic medium, and to this was added peptone metionine, asparagine, sodium nitrate or ammonium salicylate, according to the treatment. The control (group received no nitrogen whatsover. It was concluded that peptone was the best treatment for sporulation and mycelium growth, and that the next best was asparagine which was helpfull in inducing sporulation. Ammonium salicylate inhibited the vegetative growth

Taxonomic notes on some Polyglyptini: descriptions of new genus and new species (Homoptera, Membracidae, Smiliinae

Directory of Open Access Journals (Sweden)

Albino M. Sakakibara

1996-01-01

Full Text Available Taxonomic notes on some Polyglyptini; descriptions of new genus and new species (Homoptera, Membracidae, Smiliinae. The genera Hemiptycha Germar, Metheisa Fowler, Maturnaria Metcalf, Aphetea Fowler, Dioclophara Kirkaldy, and Phormophora Stål, are redescribed; Creonus, gen.n. (type species: Maturna lloydi Funkhouser, 1914, and Aphetea robustula, sp.n. (from Bolivia, are described. Some nomenclatural changes are introduced, as follow: - Hemiptycha Germar, 1833 = Polyrhyssa Stål, 1869, syn.n.: - Hemiptycha cultrata (Coquebert, 1801, comb.n., = Polyglyptodes flavocostatus Haviland, 1925, syn.n., = Polyrhyssa cultrata maculata Fonseca, 1942, syn.n. - Hemiptycha obtecta (Fabricius, 1803 = Hille herbicola Haviland, 1925, syn.n. - Maturnaria ephippigera (Fairmaire, 1846 = Publilia tumulata Buckton, 1903, syn.n., = Metheisa fowleri Funkhouser, 1927, syn.n. - Creonus lloydi (Funkhouser, 1914, comb.n. - Aphetea parvula (Fabricius, 1803, comb.n., = Aphetea affinis Haviland, 1925, syn.n. - Dioclophara Kirkaldy, 1904 = lncolea Goding, 1926, syn.n. - Dioclophara viridula (Fairmaire, 1846 = Maturna multilineata Fonseca, 1942, syn.n. - Dioclophara variegata (Goding, 1926, comb.n. = lncolea viridis Goding, 1926, syn.n. - Phormophora maura (Fabricius, 1803 = Darnis dorsata Fabricius, 1803, syn.n.

Increased riboflavin production from activated bleaching earth by a mutant strain of Ashbya gossypii.

Science.gov (United States)

Tajima, Satoshi; Itoh, Yoko; Sugimoto, Takashi; Kato, Tatsuya; Park, Enoch Y

2009-10-01

The production of riboflavin from vegetable oil was increased using a mutant strain of Ashbya gossypii. This mutant was generated by treating the wild-type strain with N-methyl-N'-nitro-N-nitrosoguanidine (MNNG). Riboflavin production was 10-fold higher in the mutant compared to the wild-type strain. The specific intracellular catalase activity after 3 d of culture was 6-fold higher in the mutant than in the wild-type strain. For the mutant, riboflavin production in the presence of 40 mM hydrogen peroxide was 16% less than that in the absence of hydrogen peroxide, whereas it was 56% less for the wild-type strain. The isocitrate lyase (ICL) activity of the mutant was 0.26 mU/mg of protein during the active riboflavin production phase, which was 2.6-fold higher than the wild-type strain. These data indicate that the mutant utilizes the carbon flux from the TCA cycle to the glyoxylate cycle more efficiently than the wild-type strain, resulting in enhanced riboflavin production. This novel mutant has the potential to be of use for industrial-scale riboflavin production from waste-activated bleaching earth (ABE), thereby transforming a useless material into a valuable bioproduct.

Distribution and population development of Nasonovia ribisnigri (Homoptera: Aphididae) in iceberg lettuce.

Science.gov (United States)

Liu, Yong-Biao

2004-06-01

A field study was conducted to determine the distribution and development of aphid Nasonovia ribisnigri (Mosley) (Homoptera: Aphididae) populations in iceberg lettuce, Lactuca sativa L. 'Salinas'. Lettuce plants were transplanted and caged individually in the field and inoculated with apterous N. ribisnigri at 0, 1, 2, 3, and 4 wk after transplanting in spring and fall 2002. Plants were harvested 15-50 d after inoculations; numbers of alates and apterous N. ribisnigri were counted or estimated on each leaf for each plant. Inoculations during all 5 wk of plant development resulted in successful colonization of lettuce heads. Results indicated that head formation did not reduce the risk of colonization by N. ribisnigri to iceberg lettuce; plants were susceptible to colonization by N. ribisnigri throughout their development. For later inoculations, N. ribisnigri populations were relatively smaller, and aphids were found mostly within the heads. For earlier inoculations, N. ribisnigri populations were larger, and within-plant distributions shifted toward frame leaves. The shift of population distributions toward frame leaves correlated significantly with increases in N. ribisnigri population density. For most inoculations, more aphids were present on wrapper leaves than on other leaves. The proportion of alates did not vary significantly with population density. Population development of N ribisnigri also correlated significantly with heat unit accumulation. Yellow sticky cards were used to monitor alates in each cage. Catches of N. ribisnigri alates on yellow sticky cards were significantly correlated with total numbers of alates as well as with total population sizes on individual lettuce plants.

Characterization of Phenacoccus solenopsis (Tinsley) (Homoptera: Pseudococcidae) Resistance to Emamectin Benzoate: Cross-Resistance Patterns and Fitness Cost Analysis.

Science.gov (United States)

Afzal, M B S; Shad, S A

2016-06-01

Cotton mealybug Phenacoccus solenopsis (Tinsley) (Homoptera: Pseudococcidae) is a sucking pest of worldwide importance causing huge losses by feeding upon cotton in various parts of the world. Because of the importance of this pest, this research was carried out to select emamectin resistance in P. solenopsis in the laboratory to study cross-resistance, stability, realized heritability, and fitness cost of emamectin resistance. After selection from third generation (G3) to G6, P. solenopsis developed very high emamectin resistance (159.24-fold) when compared to a susceptible unselected population (Unsel pop). Population selected to emamectin benzoate conferred moderate (45.81-fold), low (14.06-fold), and no cross-resistance with abamectin, cypermethrin, and profenofos, respectively compared to the Unsel pop. A significant decline in emamectin resistance was observed in the resistant population when not exposed to emamectin from G7 to G13. The estimated realized heritability (h (2)) for emamectin resistance was 0.84. A high fitness cost was associated with emamectin resistance in P. solenopsis. Results of this study may be helpful in devising insecticide resistance management strategies for P. solenopsis.

The neotype barcode of the cotton aphid (Hemiptera: Aphididae: Aphis gossypii Glover, 1877) and a proposal for type barcodes

Science.gov (United States)

A type barcode is a DNA barcode unequivocally tied to an authoritatively identified specimen, preferably the primary type specimen. Type barcodes are analogous, albeit subordinate, to type specimens, providing a stable reference to which other barcodes can be compared. We here designate and describe...

Synthesis and biological activity of a new class of insecticides: the N-(5-aryl-1,3,4-thiadiazol-2-yl)amides.

Science.gov (United States)

Eckelbarger, Joseph D; Parker, Marshall H; Yap, Maurice Ch; Buysse, Ann M; Babcock, Jonathan M; Hunter, Ricky; Adelfinskaya, Yelena; Samaritoni, Jack G; Garizi, Negar; Trullinger, Tony K

2017-04-01

Optimization studies on a high-throughput screening (HTS) hit led to the discovery of a series of N-(6-arylpyridazin-3-yl)amides with insecticidal activity. It was hypothesized that the isosteric replacement of the pyridazine ring with a 1,3,4-thiadiazole ring could lead to more potent biological activity and/or a broader sap-feeding pest spectrum. The resulting N-(5-aryl-1,3,4-thiadiazol-2-yl)amides were explored as a new class of insecticides. Several methods for 2-amino-1,3,4-thiadiazole synthesis were used for the preparation of key synthetic intermediates. Subsequent coupling to variously substituted carboxylic acid building blocks furnished the final targets, which were tested for insecticidal activity against susceptible strains of Aphis gossypii (Glover) (cotton aphid), Myzus persicae (Sulzer) (green peach aphid) and Bemisia tabaci (Gennadius) (sweetpotato whitefly). Structure-activity relationship (SAR) studies on both the amide tail and the aryl A-ring of novel N-(5-aryl-1,3,4-thiadiazol-2-yl)amides led to a new class of insecticidal molecules active against sap-feeding insect pests. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

A non-persistently transmitted-virus induces a pull-push strategy in its aphid vector to optimize transmission and spread.

Science.gov (United States)

Carmo-Sousa, Michele; Moreno, Aranzazu; Garzo, Elisa; Fereres, Alberto

2014-06-24

Plant viruses are known to modify the behaviour of their insect vectors, both directly and indirectly, generally adapting to each type of virus-vector relationship in a way that enhances transmission efficiency. Here, we report results of three different studies showing how a virus transmitted in a non-persistent (NP) manner (Cucumber mosaic virus; CMV, Cucumovirus) can induce changes in its host plant, cucumber (Cucumis sativus cv. Marumba) that modifies the behaviour of its aphid vector (Aphis gossypii Glover; Hemiptera: Aphididae) in a way that enhances virus transmission and spread non-viruliferous aphids changed their alighting, settling and probing behaviour activities over time when exposed to CMV-infected and mock-inoculated cucumber plants. Aphids exhibited no preference to migrate from CMV-infected to mock-inoculated plants at short time intervals (1, 10 and 30 min after release), but showed a clear shift in preference to migrate from CMV-infected to mock-inoculated plants 60 min after release. Our free-choice preference assays showed that A. gossypii alates preferred CMV-infected over mock-inoculated plants at an early stage (30 min), but this behaviour was reverted at a later stage and aphids preferred to settle and reproduce on mock-inoculated plants. The electrical penetration graph (EPG) technique revealed a sharp change in aphid probing behaviour over time when exposed to CMV-infected plants. At the beginning (first 15 min) aphid vectors dramatically increased the number of short superficial probes and intracellular punctures when exposed to CMV-infected plants. At a later stage (second hour of recording) aphids diminished their feeding on CMV-infected plants as indicated by much less time spent in phloem salivation and ingestion (E1 and E2). This particular probing behaviour including an early increase in the number of short superficial probes and intracellular punctures followed by a phloem feeding deterrence is known to enhance the transmission

Climatic factors and populational dynamics of Mahanarva posticata (Stal-1855) (Homoptera-Cercopidae) as a contribution to a possible regional implantation of the sterile male technique

International Nuclear Information System (INIS)

Oliveira, M.L. de

1981-01-01

A field study on the population dynamics of M. posticata (STAL, 1855) (Homoptera-Cercopidae) was carried out from 1971 to 1978 under the ecological conditions prevailing in the Litoral-Mata-Sul Zone of Pernambuco, Brazil. The results indicated that maximal infestation of the sugar cane crops by the insect generally occured in June and in July, and it was dependent on rainfall, temperature and relative humidity. The population density of adults was decreased markedly during the months of January, February and March. Technical and economical viability of the insect control by the male-sterilization-techniques through radiation was also demonstrated. The technique is to be used isolated or with other conventional procedures in the combat of froghopper infestations in the sugar cane growing in Pernambuco, Brazil. (Author) [pt

Relationships between benthic cover, current strength, herbivory, and a fisheries closure in Glovers Reef Atoll, Belize

Science.gov (United States)

McClanahan, T.; Karnauskas, M.

2011-03-01

Benthic cover, current strengths, and fish abundance and diversity were examined on 150 lagoonal patch reefs and mapped to determine their distribution, inter-relationships, and relationship to the fisheries closure in Glovers Reef Atoll. Current strength was highest at both the northern and southern ends of the atoll and largely controlled by local wind and weakly by tidal forcing. Benthic functional group distributions varied throughout the atoll and had distinct areas of dominance. In contrast, dominance of coral species was weaker, reflecting the lost cover and zonation of Acropora, Porites, and Montastraea that were reported in the 1970s. Hard and soft corals dominated the windward rim, while the central and leeward lagoon had lower current strengths and sea grass and fleshy green algae were relatively more abundant. Brown erect algae were relatively more common in the north and calcifying green and red algae the southern ends of the atoll. Only Montastraea- Agaricia agaricites distributions were similar to reports from the 1970s with high relative dominance in the southern and northeast atoll. The central-northern zone, which was described as an Acropora zone in the 1970s, was not recognizable, and Porites porites, P. astreoides, Millepora alcicornis, and Favia fragum were the most abundant species during this survey . Hard and soft coral cover abundance declined away from the reef rim and tidal channels and was associated with fast seawater turnover and high surgeonfish abundance. Consequently, the windward rim area has retained the most original and persistent hard-soft coral and surgeonfish community and is considered a priority for future management, if the goal is to protect coral from fishing impacts.

EFEITOS DA TEMPERATURA DE INCUBAÇÃO SOBRE O FUNGO colletotrichum gossypii South. var. cephalosporioides EFFECT OF TEMPERATURE INCUBATION ON THE FUNGUS Colletotrichum gossypi SOUTH. Var. cephalosporioides COSTA

Directory of Open Access Journals (Sweden)

Yvo de Carvalho

2007-09-01

Full Text Available

Estudou-se o efeito da temperatura de incubação sobre o crescimento vegetativo, esporulação e morfologia da colônia do fungo Colletotrichum gossypii South. var. cephalosporioides Costa, em substrato de batata + dextrose + agar, pH 5,6. O delineamento experimental usado foi o de blocos casualizados e as temperaturas variaram de 12 a 33°C, a intervalos de 3° C. Concluiu-se que a temperatura de incubação afeta notavelmente o crescimento vegetativo, a esporulação e a morfologia da colônia do fungo. Temperaturas acima da faixa ótima provocaram modificações mais acentuadas sobre o crescimento miceliano, esporulação e aspecto morfológico, do que temperaturas baixas. Conídios produzidos em temperaturas extremas, 12 a 33°C, mostraram-se mais curtos que os dos demais tratamentos. A incubação à temperatura de 27°C é a mais recomendável para produção de inóculos em quantidade.

In this work, the effect of temperature of incubation on the vegetative growth, sporulation and morphology of the colony of the fungus colletotrichum gossypii South. var. cephalosporioides Costa in substrate containing potato + dextrose + agar pH 5.6, was studied. The experimental design used was that of randomized blocks, with temperatures varying from 12 to 33 degrees centigrades, at intervals of 3°C. It was concluded that the temperature of incubation notably affects the vegetative growth, sporulation and morphology of the colony of this fungus. Temperatures above the optimum range caused greater changes in mycelial, sporulation an morphology of the colony than temperatures below this range. Conidia produced at l2 and 33°C were shown to be shorter than those in other treatments. The temperature of incubation recommended for inocule production was 27°C.

Molecular systematics of aphids (Homoptera: Aphididae): new insights from the long-wavelength opsin gene.

Science.gov (United States)

Ortiz-Rivas, Benjamín; Moya, Andrés; Martínez-Torres, David

2004-01-01

Viviparous aphids (Aphididae) constitute a monophyletic group within the Homoptera with more than 4000 extant species worldwide but higher diversity in temperate regions. Several aspects of their biology account for attention paid to this group of insects. Their plant-sap-sucking way of feeding with many species transmitting viruses to crop plants has important implications on crop management strategies. Cyclical parthenogenesis associated in many groups to host alternation and elaborate polyphenisms is of special interests for evolutionists. Finally, the ancient association of most aphid species with intracellular endosymbiotic bacteria (Buchnera sp.) has also received much attention from evolutionists interested in mechanisms involved in the symbiotic process. Knowing the phylogenetic relationships among major aphid taxa is of special interest to evolutionists interested in the above issues. However, until recently, molecular approaches to aphid phylogeny were absent and discussions on the evolution of aphid life-cycles and on evolutionary aspects of their symbiotic association with Buchnera were framed by morphology-based phylogenies. Recently, two reports using molecular approaches attempted to address the yet unresolved phylogeny of Aphididae with limited although somehow different conclusions. In the present report we study the utility of the long-wave opsin gene in resolving phylogenetic relationships among seven subfamilies within the Aphididae. Our results corroborate some previously proposed relationships and suggest a revision of some others. In particular, our data support grouping the analysed aphid species into three main clades, being the subfamily Lachninae one of them, which contradicts its generally accepted sistership relationship with the subfamily Aphidinae. Moreover, our data also suggest a basal position of Lachninae which has implications on current discussions about the ancestrality of conifer-feeding in modern aphids.

Population Growth of Rhopalosiphum padi L. (Homoptera: Aphididae on Different Cereal Crops from the Semiarid Pampas of Argentina under Laboratory Conditions Crecimiento Poblacional de Rhopalosiphum padi L. (Homoptera: Aphididae sobre Diferentes Cereales de la Pampas Semiárida de Argentina en Condiciones de Laboratorio

Directory of Open Access Journals (Sweden)

Lilian R Descamps

2011-09-01

Full Text Available The bird cherry-oat aphid Rhopalosiphum padi L. (Homoptera: Aphididae is one of the main pests in a number of crops in the semiarid Pampas of Argentina. In the present study, the effect of different host plants, including Triticum aestivum L., ×Triticosecale Wittm., Hordeum vulgare L., Hordeum distichum L., Avena sativa L., and Secale cereale L. on biological parameters of R. padi L. was studied in the laboratory at 24 ± 1 °C, 65 ± 10% RH and a 14:10 photoperiod. Longevity, intrinsic rate of natural increase (r m, net reproductive rate (R0, mean generation time (T, doubling time (DT, and finite rate of increase (λ of the bird cherry-oat aphid on the different cereal crops were estimated. Differences in fertility life table parameters of R. padi among host plants were analyzed using pseudo-values, which were produced by Jackknife re-sampling. Results indicated that beer barley might be the most suitable food for R. padi due to greater adult longevity (20.88 d, higher fecundity (41 nymphs female-1, higher intrinsic rate of natural increase (0.309 females female-1 d-1, lower doubling time (2.24, and lower nymphal mortality (22.2%. Therefore, it can be concluded from the present study that R. padi prefers beer barley for fast and healthy development over other cereal crops.El áfido Rhopalosiphum padi L. (Homoptera: Aphididae es una de las principales plagas de numerosos cultivos de la región semiárida pampeana de Argentina. En el presente trabajo se estudió el efecto de diferentes cereales incluidos Triticum aestivum L., ×Triticosecale Wittm., Hordeum vulgare L., Hordeum distichum L., Avena sativa L. and Secale cereale L. sobre los parámetros biológicos de R. padi en laboratorio. Se estimaron longevidad, tasa intrínseca de crecimiento natural (r m, tasa neta de reproducción (R0, tiempo generacional medio (T, tiempo de duplicación (TD, y tasa finita de incremento (λ del pulgón de la avena en diferentes cereales. Las diferencias de

Influence des facteurs écologiques (température et hygrométrie sur le développement de la cochenille farineuse du manioc (Phenacoccus manihoti Matile-Ferrero, Homoptera: Pseudococcidae

Directory of Open Access Journals (Sweden)

Obame Minko, D.

2009-01-01

Full Text Available The Influence of Ecological Factors (such as Temperature and Hygrometry on the Development of Cassava Mealybug (Phenacoccus manihoti Matile-Ferrero, Homoptera: Pseudococcidae. Phenacoccus manihoti Matile-Ferrero cassava mealybug was accidentally carried away from South America to Africa by early 70s. Since then, it has been inducing a lot of damage to cassava cultures, which cassava remains the main foodstuff in the southern Sahara inhabitant's nutrition. Being anxious to understand the depredator population evolution in the nature, we have studied the temperature and hygrometry as main ecological factors helpful to development. The temperature favours eggs hatching and reduces the duration of embryonic, larval and cycle development whereas hygrometry's action on mealybug development can be neglected. As both factors are opposite functions in the nature, mutual influence on the field can be possible.

Presence of the aphid, Chaetosiphon fragaefolii, on strawberry in Argentina.

Science.gov (United States)

Cédola, Claudia; Grecob, Nancy

2010-01-01

Seasonal abundance of the strawberry aphid complex under different agronomic practices in the outskirts of La Plata, Argentina was studied on strawberry, Fragaria x ananassa Duchesne (Rosales: Rosaceae). Aphid densities were low in strawberry fields in which insecticides and fungicides were used. In addition to Aphis gossypii, Aphis fabae, Mysus persicae and Macrosiphum euphorbiae, the aphid, Chaetosiphon fragaefolii (Cockerell) (Homoptera: Aphididae), was recorded for the first time in this horticultural area. Life history and some demographic parameters were calculated for C. fragaefolii. The mean duration of nymphal stages was 10.44 days, the oviposition period was 11.8 days, and the mean number of nymph/female/day was 2.4 +/- 0.3. Demographic parameters analyzed included the net reproductive rate R(o) = 14.55 +/- 0.096 nymph/female, generation time T=16.91 +/- 0.035 days, and the intrinsic rate of increase r(m) = 0.158 +/- (0.004). No parasites were found associated with C. fragaefolli. The pathogenic fungus, Entomophthora planchoniana Cornu (Zygomycetes: Entomophthorales) was the main mortality factor. Although aphids are not the main pests in strawberry fields, C. fragaefolii can be a serious problem because it can transmit several virus diseases of strawberry. Greater knowledge of life history traits and mortality factors of this species is needed in order to design appropriate control strategies.

Ocorrência de Tuthillia cognata Hodkinson, Brown & Burckhardt, 1986(Hemiptera: Homoptera, Psyllidae em plantios experimentais de camu-camu Myrciaria dubia (H.B.K. Mc Vaugh em Manaus (Amazonas, Brasil Occurrence of Tuthillia cognata Hodkinson, Brown & Burckhardt, 1986 (Hemiptera: Homoptera, Psyllidae in experimental plantations of camu-camu Myrciaria dubia (H.B.K. Mc Vaugh in Manaus (Amazonas, Brazil

Directory of Open Access Journals (Sweden)

Márcio Luís Leitão Barbosa

2004-01-01

Full Text Available O cultivo de camu-camu Myrciaria dubia (H.B.K. Mc Vaugh tem apresentado inúmeros problemas fitossanitários, dentre os quais, Tuthillia cognata Hodkinson et al. (Hemiptera: Homoptera, Psyllidae, que constantemente é citada como praga secundária. Os objetivos deste estudo foram determinar o nível e a intensidade de infestação (% por T. cognata e estudar aspectos do ciclo biológico e do comportamento de T. cognata, em plantios experimentais de camu-camu. Foram selecionados, de forma aleatória, 17 e 14 exemplares nos plantios I e II, respectivamente. Para cada uma das variáveis estudadas, foram calculados a média aritmética, o desviopadrão, a variância e a amplitude de variação. Foi verificado um nível de infestação de 82% (plantio I e 57% (plantio II, uma intensidade de infestação de 94% (plantio I e 75% (plantio II e uma média de seis ninfas/folha em cada plantio, o que indica que T. cognata representa uma das pragas-chave dessa cultura. Foram observados adultos de Chrysoperla sp. (Neuroptera: Chrysopidae e ninfas de Reduviidae (Hemiptera: Heteroptera, que podem atuar como prováveis agentes de controle biológico de T. cognata.The cultivation of camu-camu Myrciaria dubia (H.B.K. Mc Vaugh has presented countless phytosanitary problems, among them, Tuthillia cognata Hodkinson et al. (Hemiptera: Homoptera, Psyllidae, which often is noticed as a secondary pest. This study aimed to determine the level and the intensity of infestation (% for T. cognata, as well as to study the biological cycle and behavioural aspects of T. cognata, in experimental plantation of camu-camu. 17 and 14 specimens from plantation I and II, respectively, were randomly selected. The arithmetic average, the standard deviation, the variance and the total amplitude were calculated for each studied variable. A level of infestation of 82% (plantation I and 57% (plantation II, an intensity of infestation of 94% (plantation I and 75% (plantation II and an

Potential damages, seasonal abundance and distribution of Empoasca terminalis Distant (Homoptera: Cicadellidae on soybean in South Sulawesi

Directory of Open Access Journals (Sweden)

Andi Nasruddin

2015-09-01

Full Text Available Plant damages caused by leafhopper, Empoasca terminalis Distant (Homoptera: Cicadellidae on soybean were first encountered in 2007 in Makassar, South Sulawesi. The insect has been constantly associated with soybean crops in the province ever since. The purposes of the present study were to (i evaluate potential yield loss attributable to the leafhopper in an experimental set up, (ii seasonal abundance of E. terminalis, and (iii distribution of E. terminalis in all major soybean-producing areas in the province. Potential yield loss due to the leafhopper was assessed in a field experiment using two large plots. One of the plots was kept leafhopper-free by weekly insecticide sprays; and the other plot was left unsprayed to allow leafhopper infestation to occur. Adult abundance was weekly monitored using a sweep net throughout the season. Nymph abundance was determined by direct count on the plant leaves. Leafhopper distribution was assessed through surveys conducted in all major soybean-producing areas in South Sulawesi, from 2009–2013. The results of the study showed that E. terminalis caused an average yield loss of 26% on susceptible crops without insecticide use. First leafhopper infestation in all planting seasons occurred two weeks after the plant emergence. Rainfall negatively correlated with the leafhopper abundance. The leafhopper existed in all major soybean production areas in the province. Therefore, our results confirmed the status of E. terminalis as an important soybean pest in the region. In addition, crops planted early in the dry season could escape from heavy leafhopper infestation.

Prey Preference of Predatory mite Amblyseius swirskii (Athias-Henriot (Acari: Phytoseiidae on untreated and Beauveria bassiana-treated of Trialeurodes vaporariorum (Homoptera: Aleyrodidae

Directory of Open Access Journals (Sweden)

Marjan Seiedy

2018-01-01

Full Text Available Introduction The predator Amblyseius swirskii and entomopathogenic fungus Beauveria bassiana are important biocontrol agents of Trialeurodes vaporariorum. Determination of the host preference of predators in the fields when receiving signals related to either untreated and Beauveria bassiana-treated pest is important. Materials and Methods In this research, the prey preference of adult female (2 days old of A. swirskii was determined on untreated and Beauveria bassiana-treated of Trialeurodes vaporariorum (Homoptera: Aleyrodidae in various treatments base on Manly Index. These different treatments consisted of two time intervals; 24 and 48 h post-inoculation of greenhouse whiteflies with 1×105 conidia /ml of B. bassiana with 13 replicates. 24-h starved predators were added to the leaf discs singly then the number of consumed untreated and B. bassiana-treated T. vaporariorum in each Petri dish was assessed after 24 h. Results and Discussion The results revealed that mean number of consumed B. bassiana-treated T. vaporariorum in two time intervals; 24 and 48 h. after inoculation were 4/15±0/19 and 2.23±0/12, respectively. This investigation showed a significant preference of A. swirskii towards untreated T. vaporariorum in 24 (P< 0.0034 and 48 h. (P

Phylogenetic position of the yeast-like symbiotes of Tagosodes orizicolus (Homoptera: Delphacidae based on 18S ribosomal DNA partial sequences

Directory of Open Access Journals (Sweden)

Ana M Xet-Mull

2004-09-01

Full Text Available Tagosodes orizicolus Muir (Homoptera: Delphacidae, the endemic delphacid species of tropical America carries yeast-like symbiotes (YLS in the abdominal fat bodies and the ovarial tissues, like other rice planthoppers of Asia. These YLS are obligate symbiotes, which are transmitted transovarially, and maintain a mutualistic relationship with the insect host. This characteristic has made in vitro culture and classification of YLS rather difficult using conventional methods. Nevertheless, microorganisms of similar characteristics have been successfully classified by using molecular taxonomy. In the present work, the YLS of Tagosodes orizicolus(YLSTo were purified on Percoll® gradients, and specific segments of 18S rDNA were amplified by PCR, cloned and sequenced. Sequences were aligned by means of the CLUSTAL V (DNASTAR program; phylogenetic trees were constructed with the Phylogeny Inference Package (PHYLIP, showing that YLSTo belong to the fungi class Pyrenomycetes, phylum Ascomycota. Similarities between 98% and 100% were observed among YLS of the rice delphacids Tagosodes orizicolus, Nilaparvata lugens, Laodelphax striatellus and Sogatella furcifera, and between 89.8% and 90.8% when comparing the above to YLS of the aphid Hamiltonaphis styraci. These comparisons revealed that delphacid YLS are a highly conserved monophyletic group within the Pyrenomycetes and are closely related to Hypomyces chrysospermus. Rev. Biol. Trop. 52(3: 777-785. Epub 2004 Dic 15.Tagosodes orizicolus Muir (Homoptera: Delphacidae es una especie endémica de América tropical que al igual que otros saltahojas de Asia, tiene simbiontes levaduriformes (YLS, por sus siglas en Inglés en los cuerpos grasos del abdomen y en los tejidos de los ovarios. Los YLS son simbiontes obligados que se transmiten transovarialmente y que mantienen relaciones mutualística con el insecto hospedero. Esta característica ha hecho muy difícil su cultivo in vitro y por ende su clasificaci

Alterações anatômicas em algodoeiro infectado pelo vírus da doença azul Anatomical alterations in blue disease infected cotton plant

Directory of Open Access Journals (Sweden)

Juliana K. Takimoto

2009-01-01

Full Text Available A doença azul do algodoeiro está associada a um vírus ainda pouco conhecido em suas características morfológicas e moleculares, tanto quanto a sua patologia e epidemiologia. O tipo de transmissão circulativa pelo afídeo vetor Aphis gossypii Glover, associado a recentes relatos de estudos moleculares, sustentam ser o agente etiológico uma espécie membro da família Luteoviridae. No presente trabalho, estudos anatômicos comparativos em plantas sadias e infectadas foram realizados com a finalidade de conhecer aspectos estruturais da interação vírus-espécie hospedeira, com potencial aplicação na área de diagnose e melhoramento genético. Os estudos anatômicos foram realizados em folhas de plantas infectadas, com área foliar reduzida, nervuras cloróticas e margem foliar voltada para baixo. O encurtamento dos entrenós, que resultam em um agrupamento de folhas, flores e frutos, e conseqüente redução da altura da planta, do número e tamanho dos frutos, são expressões fenotípicas da planta de algodão infectada, a qual serviu para o presente estudo. Nas plantas infectadas com o agente da doença azul havia maior acúmulo de calose e de cristais de oxalato de cálcio, cloroplastos íntegros distribuídos na região periférica das células do mesofilo e aparente alteração química no interior das células do parênquima paliçádico. Inclusões nos vasos do floema e, ocasionalmente no xilema, também foram observadas. O acúmulo de calose e a presença de inclusões no floema podem indicar uma relação ou preferência do vírus por esse tecido.Cotton blue disease is caused by a virus whose morphological and molecular characteristics is not well known and so demanding information its phytosanitary and epidemiological characteristics. Evidences of an aphid borne (Aphis gossypii Glover circulative (persistent type of transmission, associated with a recent molecular report, sustain for a virus species belonging to the

ORF Alignment: NC_005788 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available uery: 286 ESYQTKRQRLMKQLKENYAGHTAFCVTALDEICWFLNIRGSDVEYNPVFYAYFVIHQDSS 345 ... ESYQTKRQRLMKQLKENYAGHT...AFCVTALDEICWFLNIRGSDVEYNPVFYAYFVIHQDSS Sbjct: 1 ... ESYQTKRQRLMKQLKENYAGHTAFCVTALDE...gossypii ATCC 10895] ref|NP_986634.1| AGL032Cp ... [Eremothecium gossypii] ... Length = 385 ... Q

ORF Alignment: NC_005788 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available gossypii ATCC 10895] ref|NP_986570.1| AGL097Cp ... [Eremothecium gossypii] ... Length = 198 ... Query: 449 NPRKFESWL...HTATLANIATVFKDSDSKEWRAHGDPTEIAIQVFATRMDHPHHALTTXXXX 508 ... NPRKFESWLHTATLANIATVF...KDSDSKEWRAHGDPTEIAIQVFATRMDHPHHALTT ... Sbjct: 1 ... NPRKFESWLHTATLANIATVFKDSDSKEWR

ORF Alignment: NC_005788 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available gossypii ATCC 10895] ref|NP_986381.1| AGL286Cp ... [Eremothecium gossypii] ... Length = 122 ... Query: 201 ALNGFENTDPHTST...AFALGPEGPTQRNLDTHGXXXXXXXXXXXXXXXXXXXXLGLYSDMG 260 ... ALNGFENTDPHTSTAFALGPE...GPTQRNLDTHG ... LGLYSDMG Sbjct: 1 ... ALNGFENTDPHTSTAFALGPEGPTQRNLDT

Mass rearing and augmentative biological control evaluation of Rhynocoris fuscipes (Hemiptera: Reduviidae) against multiple pests of cotton.

Science.gov (United States)

Tomson, Majesh; Sahayaraj, Kitherian; Kumar, Vivek; Avery, Pasco B; McKenzie, Cindy L; Osborne, Lance S

2017-08-01

Rhynocoris fuscipes (Fab.) (Hemiptera: Reduviidae) is a generalist predator of cotton pests and is commonly found inhabiting cotton-growing regions in southern India. With the goal of integrating this predator in standard management practices used against cotton pests on a commercial scale, (1) we developed a protocol for adult group rearing of this predator inside micro-environmental cages (MECs), and (2) we evaluated the biocontrol potential of mass-produced predators against cotton pests under potted and field conditions. Higher fecundity and adult longevity of R. fuscipes was recorded in the MECs than under natural growing conditions. The reduviid predator preferred stones and fallen leaves as hiding places in the MECs. The predator showed a higher biocontrol potential during the night hours against two pests, Phenacoccus solenopsis Tinsley and Dysdercus cingulatus (Fab.), than during the day under potted conditions. Under field conditions, R. fuscipes significantly reduced the population of Aphis gossypii Glover, P. solenopsis, D. cingulatus and Helicoverpa armigera (Hübner) by 28, 70, 29 and 50%, respectively. No negative impact of R. fuscipes was reported on other natural enemies present in the cotton agroecosystem. Significantly higher crop yield and cost benefit ratio were observed in R. fuscipes-released plots than in the control plots. The results suggest that R. fuscipes can be mass produced efficiently under controlled conditions in MECs, and used in an integrated management program for multiple cotton pests. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

Incidence of pests and viral disease on pepino (Solanum muricatum Ait.) in Kanagawa Prefecture, Japan.

Science.gov (United States)

Kim, Ok-Kyung; Ishikawa, Tadashi; Yamada, Yoshihiro; Sato, Takuma; Shinohara, Hirosuke; Takahata, Ken

2017-01-01

The solanaceous fruit crop pepino ( Solanum muricatum Ait.), originating in the Andes, is grown commercially in South American countries and New Zealand. In these areas, pests and diseases of pepino have been identified well; however, to date, these have seldom been investigated in detail in Japan. Herein, we attempt to reconstruct an agricultural production system for commercial pepino crops in Japan, and evaluate the incidence of pests and viral diseases on pepino. The findings of this study will facilitate in developing a better crop system for the commercial cultivation of healthy pepino fruits. A total of 11 species, comprising nine insects and two mites, were recognized as pests of pepino plants in our experimental fields in Kanagawa Prefecture, central Honshu, Japan. Of these pest species, the two-spotted spider mite Tetranychus urticae Koch, 1836 and the cotton aphid Aphis gossypii Glover, 1877, were remarkably abundant than the other pest species. Eventually, 13 species, including two previously recorded, are currently recognized as the pests of pepino in Japan. With regard to viruses, we tested two species Alfalfa mosaic virus (AMV) and Cucumber mosaic virus (CMV), as well as three genera Carlavirus , Potexvirus , and Potyvirus . No virus was detected in symptomatic pepino leaves collected in our experimental fields. This is a first report on the identification of pests on pepino plants in Kanagawa Prefecture, Japan and elucidates the relationship between currently occurring pests of pepino plants and potential viral pathogens that they can transmit.

Spatial Distribution and Sampling Plans With Fixed Level of Precision for Citrus Aphids (Hom., Aphididae) on Two Orange Species.

Science.gov (United States)

Kafeshani, Farzaneh Alizadeh; Rajabpour, Ali; Aghajanzadeh, Sirous; Gholamian, Esmaeil; Farkhari, Mohammad

2018-04-02

Aphis spiraecola Patch, Aphis gossypii Glover, and Toxoptera aurantii Boyer de Fonscolombe are three important aphid pests of citrus orchards. In this study, spatial distributions of the aphids on two orange species, Satsuma mandarin and Thomson navel, were evaluated using Taylor's power law and Iwao's patchiness. In addition, a fixed-precision sequential sampling plant was developed for each species on the host plant by Green's model at precision levels of 0.25 and 0.1. The results revealed that spatial distribution parameters and therefore the sampling plan were significantly different according to aphid and host plant species. Taylor's power law provides a better fit for the data than Iwao's patchiness regression. Except T. aurantii on Thomson navel orange, spatial distribution patterns of the aphids were aggregative on both citrus. T. aurantii had regular dispersion pattern on Thomson navel orange. Optimum sample size of the aphids varied from 30-2061 and 1-1622 shoots on Satsuma mandarin and Thomson navel orange based on aphid species and desired precision level. Calculated stop lines of the aphid species on Satsuma mandarin and Thomson navel orange ranged from 0.48 to 19 and 0.19 to 80.4 aphids per 24 shoots according to aphid species and desired precision level. The performance of the sampling plan was validated by resampling analysis using resampling for validation of sampling plans (RVSP) software. This sampling program is useful for IPM program of the aphids in citrus orchards.

Dicty_cDB: Contig-U15920-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available t... 44 10.0 1 ( EU019869 ) Aphis gossypii from Hibiscus elongation factor 1 ... ...44 10.0 1 ( EU019868 ) Aphis gossypii from Hibiscus mutabilis elongation... 44 10.0 1 ( EF660855 ) Myzus per

Algal growth and species composition under experimental control of herbivory, phosphorus and coral abundance in Glovers Reef, Belize.

Science.gov (United States)

McClanahan, T R; Cokos, B A; Sala, E

2002-06-01

The proliferation of algae on disturbed coral reefs has often been attributed to (1) a loss of large-bodied herbivorous fishes, (2) increases in sea water nutrient concentrations, particularly phosphorus, and (3) a loss of hard coral cover or a combination of these and other factors. We performed replicated small-scale caging experiments in the offshore lagoon of Glovers Reef atoll, Belize where three treatments had closed-top (no large-bodied herbivores) and one treatment had open-top cages (grazing by large-bodied herbivores). Closed-top treatments simulated a reduced-herbivory situation, excluding large fishes but including small herbivorous fishes such as damselfishes and small parrotfishes. Treatments in the closed-top cages included the addition of high phosphorus fertilizer, live branches of Acropora cervicornis and a third unmanipulated control treatment. Colonization, algal biomass and species composition on dead A. palmata "plates" were studied weekly for 50 days in each of the four treatments. Fertilization doubled the concentration of phosphorus from 0.35 to 0.77 microM. Closed-top cages, particularly the fertilizer and A. cervicornis additions, attracted more small-bodied parrotfish and damselfish than the open-top cages such that there was moderate levels of herbivory in closed-top cages. The open-top cages did, however, have a higher abundance of the chemically and morphologically defended erect algal species including Caulerpa cupressoides, Laurencia obtusa, Dictyota menstrualis and Lobophora variegata. The most herbivore-resistant calcareous green algae (i.e. Halimeda) were, however, uncommon in all treatments. Algal biomass increased and fluctuated simultaneously in all treatments over time, but algal biomass, as measured by wet, dry and decalcified weight, did not differ greatly between the treatments with only marginally higher biomass (p reefs except for creating space. In contrast, A. cervicornis appears to attract aggressive damselfish that

Influence of Different Diets on Two-sex Life Table Parameters of Oenopia conglobata contaminata (Menteries

Directory of Open Access Journals (Sweden)

H. Zohdi

2017-08-01

Full Text Available Introduction: The common pistachio psylla (CPP, Agonoscena pistaciae Burckhardt and Lauterer, 1989 (Hem.: Psylloidea: Rhinocolinae is an important pest of pistachio trees. The presence of a large population of psyllid causes severe problems such as falling buds and leaves and therefore this pest causes heavy economic damage to farmers. Predators are the largest and the most diverse natural enemies of the CPP. They are offered as biological control agents against pistachio pests, especially CPP, although they are mostly general predators. Oenopia conglobata contaminata (Menteries is one of the common psylla predators of pistachio orchard that have a significant role in biological control of Agonoscena pistaciae population. Despite the importance of this efficient predator, the limited study has been done on the effect of different hosts on the biological parameters of this lady beetle. In this study, the demographic parameters of this lady beetle by feeding on 4 different prey species, A. pistaciae , Aphis fabae Scopoli (Hem.:Aphididae, Aphis gossypii Glover (Hem.:Aphididae and eggs of Ephestia kuehniella (Zell.(Lep.:Pyralidae were studied in the laboratory conditions (25 ± 2°C, relative humidity of %65 ±5 and photoperiod of 16 hours light and 8 hours of darkness. Materials and Methods: Nymphs of CPP (A.pistaciae and adults of O. conglobata contaminata beetles were collected on the pistachio leaves from a pistachio orchard. Aphids (A. fabae and A. gossypii were reared on the bean and the cotton plants planted in a greenhouse. Eggs of E. kuehniella were prepared from insectarium of Kerman Plant protection management and rearing of E. kuehniella was done in the laboratory conditions in Kerman Agricultural and Natural Resoarce Research Center. Before starting the experiment, one generation of O. conglobata contaminata was reared in the laboratory on the different host separately. One hundred eggs of O. conglobata contaminata were used to

Hosting Capacity of Horticultural Plants for Insect Pests in Brazil Capacidad de Alojamiento de Plantas Hortícolas para Plagas de Insectos en Brasil

Directory of Open Access Journals (Sweden)

Germano L.D Leite

2011-09-01

Full Text Available Factors such as fertilization, allelochemicals, trichomes, weather, and natural enemies can influence pest populations. Thus, it is necessary to understand the factors that predispose vegetable species to pests and the role of polyculture, crop rotation, and neighboring plants. The objective of this research was to study the hosting capacity for pests of Abelmoschus esculentus (L., Brassica oleracea L. vars. acephala and capitata, Capsicum annuum L., Cucurbita moschata (Duchesne, Cucurbita maxima Duchesne and Cucumis sativus L., Lycopersicon esculentum Mill., Solanum gilo Raddi and Solanum melongena L., and Phaseolus vulgaris L. The higher density of Bemisia tabaci (Genn. adults on C. sativus can be due to the higher amount of pentacosane and octacosane in this plant. The occurrence of Brevicoryne brassicae (L. only in Brassica spp. can be accounted for by the nonacosane of these plants. The low trichome density and greater palmitic acid level can explain the greatest damage by Aphis gossypii Glover in A. esculentum. Empoasca sp. was more frequent in P. vulgaris followed by A. esculentum, which are plants with lower K content. Solanum melongena was attacked more by Hydrangea similis (Walker and Epitrix sp. perhaps because of higher palmitic acid and 11,14,17-eicosatrienoic methyl ester concentrations in their leaves. Frankliniella sp. exhibited more damage in C. sativus probably owing to higher pentacosane and octacosane in its leaves. Sistena sp. was more frequent in C. maxima and had higher octadecane levels and trichome density. The presence of ¥-humulene and hexacosane can explain the damage by Tuta absoluta (Meyrick on L. esculentum.Factores tales como la fertilización, aleloquímicos, tricomas, el clima y los enemigos naturales pueden influir en las poblaciones de plagas. Por lo tanto, es necesario comprender los factores que predisponen a las especies vegetales a las plagas y el papel de policultivos, rotación de cultivos y las plantas

Ultrastructure of compatible and incompatible interactions in phloem sieve elements during the stylet penetration by cotton aphids in melon

NARCIS (Netherlands)

Garzo, E.; Fernández-Pascual, Mercedes; Morcillo, Cesar; Fereres, Alberto; Gómez-Guillamón, M.L.; Tjallingii, W.F.

2017-01-01

Resistance of the melon line TGR-1551 to the aphid Aphis gossypii is based on preventing aphids from ingesting phloem sap. In electrical penetration graphs (EPGs), this resistance has been characterized with A. gossypii showing unusually long phloem salivation periods (waveform E1) mostly

Field evaluation of Bt cotton crop impact on nontarget pests: cotton aphid and boll weevil.

Science.gov (United States)

Sujii, E R; Togni, P H B; de A Ribeiro, P; de A Bernardes, T; Milane, P V G N; Paula, D P; Pires, C S S; Fontes, E M G

2013-02-01

Bt cotton plants expressing Cry1Ac protein have high specificity for the control of lepidopteran larvae. However, studies conducted in several countries have shown these plants have a differential impact on nontarget herbivores. The aim of this study was to compare the colonization rates and population abundance of the cotton aphid, Aphis gossypii Glover (Hemiptera: Aphididae) and the boll weevil, Anthonomus grandis Boheman (Coleoptera: Curculionidae), in plots of Bt (Nuopal) and non-Bt cotton (Delta Opal) in an experimental field in Brasilia, DF, Brazil. No difference was observed in the preference and colonization by winged aphids to plants from the two treatments. There was no significant difference in abundance of wingless aphids or in the production of winged aphids between treatments. Apparently, the parameters that control factors such as fecundity, survival, and dispersal were similar on both Bt and non-Bt plants. Monitoring of plants for coccinellids, a specialist predator of aphids, and ants that act on the dispersal of aphids among plants showed no significant difference between Bt and non-Bt plants, supporting the inference above. Regarding the effect on boll weevil, there was also no significant difference between treatments in the total number of fruiting structures attacked in each plot, the percentage of fruiting structures attacked per plant or on the number of weevils emerging from fruits with boll weevil damage from egg-laying, when damaged fruit samples were held in the laboratory. Based on these results, we conclude that there is no impact of Bt cotton crop expressing Cry1Ac on the nontarget herbivores tested under field conditions.

Host Range Specificity of Scymnus camptodromus (Coleoptera: Coccinellidae), A Predator of Hemlock Woolly Adelgid (Hemiptera: Adelgidae).

Science.gov (United States)

Limbu, Samita; Cassidy, Katie; Keena, Melody; Tobin, Patrick; Hoover, Kelli

2016-02-01

Scymnus (Neopullus) camptodromus Yu and Liu (Coleoptera: Coccinellidae) was brought to the United States from China as a potential biological control agent for hemlock woolly adelgid (Adelges tsugae Annand) (Hemiptera: Adelgidae). Scymnus camptodromus phenology is closely synchronized with that of A. tsugae and has several characteristics of a promising biological control agent. As a prerequisite to field release, S. camptodromus was evaluated for potential nontarget impacts. In host range studies, the predator was given the choice of sympatric adelgid and nonadelgid prey items. Nontarget testing showed that S. camptodromus will feed to some degree on other adelgid species, but highly prefers A. tsugae. We also evaluated larval development of S. camptodromus on pine bark adelgid (Pineus strobi (Hartig)) (Hemiptera: Adelgidae) and larch adelgid (Adelges laricis Vallot) (Hemiptera: Adelgidae); a small proportion of predator larvae was able to develop to adulthood on P. strobi or A. laricis alone. Scymnus camptodromus showed no interest in feeding on woolly alder aphid (Paraprociphilus tessellatus Fitch) (Hemiptera: Aphididae) or woolly apple aphid (Eriosoma lanigerum (Hausmann)) (Hemiptera: Aphididae), and minimal interest in cotton aphid (Aphis gossypii Glover) (Hemiptera: Aphididae) in choice and no-choice experiments. Scymnus camptodromus females did not oviposit on any host material other than A. tsugae-infested hemlock. Under the circumstances of the study, S. camptodromus appears to be a specific predator of A. tsugae, with minimal risk to nontarget species. Although the predator can develop on P. strobi, the likelihood that S. camptodromus would oviposit on pine hosts of this adelgid is small.

Tools for evaluating Lipolexis oregmae (Hymenoptera: Aphidiidae) in the field: Effects of host aphid and host plant on mummy location and color plus improved methods for obtaining adults

International Nuclear Information System (INIS)

Singh, R.; Hoy, M.A.

2007-01-01

Lipolexis oregmae Gahan was introduced into Florida in a classical biological control program directed against the brown citrus aphid, Toxoptera citricida (Kirkaldy), on citrus. Prior to evaluating distribution, host range, and potential nontarget effects of L. oregmae in Florida, we evaluated the role of other potential host aphids and host plants on mummy production and location. Under laboratory conditions, this parasitoid produced the most progeny on the target pest, the brown citrus aphid on citrus. This parasitoid, unlike the majority of aphidiids, did not produce mummies on any of the host plants tested when reared in black citrus aphid T. aurantii (Boyer de Fonscolombe) on grapefruit, spirea aphid Aphis spiraecola Patch on grapefruit and pittosporum, cowpea aphid A. craccivora Koch on grapefruit and cowpeas, or melon aphid A. gossypii Glover on grapefruit and cucumber. Thus, sampling for L. oregmae mummies of these host aphids and host plants must involve holding foliage in the laboratory until mummies are produced. This parasitoid requires high relative humidity to produce adults because no adults emerged when mummies were held in gelatin capsules, but high rates of emergence were observed when mummies were held on 1.5% agar plates. In addition, we compared the color of 6 aphid hosts and the color of mummies produced by L. oregmae when reared in them to determine if color of mummies could be used to identify L. oregmae . Mummy color varied between aphid hosts and tested host plants, and is not a useful tool for identifying L. oregmae for nontarget effects. (author) [es

Densidades y frecuencias de liberación de Encarsia formosa (Hymenoptera: Aphelinidae sobre Trialeurodes vaporariorum (Homoptera: Aleyrodidae en tomate

Directory of Open Access Journals (Sweden)

Tello Paola

2007-12-01

Full Text Available

La mosca blanca de los invernaderos, Trialeurodes vaporariorum (Westwood (Homoptera: Aleyrodidae es una de las plagas más importantes de cultivos de tomate bajo invernadero en la Sabana de Bogotá. Para su control tradicionalmente se acude a la aplicación de insecticidas. Sin embargo, también son contempladas liberaciones del parasitoide Encarsia formosa (Gahan (Hymenoptera: Aphelinidae. Para estandarizar el proceso de cría masiva de E. formosa, se evaluaron tres densidades diferentes de liberación de las avispas (6, 12 y 18 avispas/planta en tres frecuencias de liberación (1, 2 y 3 veces/semana, sobre plantas de tomate de ocho semanas de edad con tres niveles de infestación (15, 30 y 45 ninfas de mosca blanca/hoja, susceptibles de ser parasitadas. El mayor porcentaje de parasitismo (70% en ninfas de tercer instar se logró cuando se liberaron seis avispas por planta, dosificadas en tres momentos diferentes en la misma semana. El menor porcentaje de parasitismo (50%, se obtuvo cuando se realizó una sola liberación de 6, 12 o 18 avispas. Los resultados anteriores permiten concluir que se puede lograr un porcentaje de parasitismo en torno a un 70% de la infestación de mosca blanca (hasta 45 ninfas/hoja en plantas de tomate con pocas avispas de E. formosa (seis cuando se liberan en tres momentos diferentes.

Effect of insecticides on mealybug destroyer (Coleoptera: Coccinellidae) and parasitoid Leptomastix dactylopii (Hymenoptera: Encyrtidae), natural enemies of citrus mealybug (Homoptera: Pseudococcidae).

Science.gov (United States)

Cloyd, Raymond A; Dickinson, Amy

2006-10-01

In this study, we measured, under laboratory conditions, the direct and indirect effects of insecticides on mealybug destroyer, Cryptolaemus montrouzieri Mulsant (Coleoptera: Coccinellidae), and parasitoid Leptomastix dactylopii Howard (Hymenoptera: Encyrtidae), natural enemies of citrus mealybug, Planococcus citri (Risso) (Homoptera: Pseudococcidae). The adult stages of both natural enemies were exposed to sprays of the insecticides buprofezin, pyriproxyfen, flonicamid, acetamiprid, dinotefuran, and clothianidin at label-recommended rates to assess direct mortality after 24, 48, and 72 h, respectively. The effects of the insecticides on L. dactylopii parasitization rate and percentage of parasitoid emergence also were monitored using the label and 4x the recommended label rate. Dinotefuran was extremely detrimental to the adult parasitoid at the label rate with 100% mortality after 24 h. Buprofezin, pyriproxyfen, and flonicamid were not harmful to L. dactylopii when applied at the label rate. At 4x the recommended label rate, dinotefuran, acetamiprid, and clothianidin were all harmful to the parasitoid with 100% mortality 72 h after application. Both buprofezin and flonicamid were not toxic to L. dactylopii with 100% adult survival after 72 h. Pyriproxyfen and flonicamid, at both the label and 4x the recommended label rate, did not negatively affect L. dactylopii parasitization rate or percentage of parasitoid emergence. Acetamiprid, dinotefuran, and clothianidin were toxic to C. montrouzieri adults with 100% mortality after 48 h, whereas buprofezin, pyriproxyfen, and flonicamid demonstrated minimal (10-20% mortality after 48 h) harmful effects to the predator. Based on the results from our study, the indirect effects of the insect growth regulator (IGR) buprofezin were not decisive; however, the IGR pyriproxyfen and the insecticide flonicamid were not directly or indirectly harmful to the predator C. montrouzieri and parastioid L. dactylopii, indicating that

Identification of top-down forces regulating cotton aphid population growth in transgenic Bt cotton in central China.

Directory of Open Access Journals (Sweden)

Peng Han

Full Text Available The cotton aphid Aphis gossypii Glover is the main aphid pest in cotton fields in the Yangtze River Valley Cotton-planting Zone (YRZ in central China. Various natural enemies may attack the cotton aphid in Bt cotton fields but no studies have identified potential specific top-down forces that could help manage this pest in the YRZ in China. In order to identify possibilities for managing the cotton aphid, we monitored cotton aphid population dynamics and identified the effect of natural enemies on cotton aphid population growth using various exclusion cages in transgenic Cry1Ac (Bt+CpTI (Cowpea trypsin inhibitor cotton field in 2011. The aphid population growth in the open field (control was significantly lower than those protected or restricted from exposure to natural enemies in the various exclusion cage types tested. The ladybird predator Propylaea japonica Thunberg represented 65% of Coccinellidae predators, and other predators consisted mainly of syrphids (2.1% and spiders (1.5%. The aphid parasitoids Aphidiines represented 76.7% of the total count of the natural enemy guild (mainly Lysiphlebia japonica Ashmead and Binodoxys indicus Subba Rao & Sharma. Our results showed that P. japonica can effectively delay the establishment and subsequent population growth of aphids during the cotton growing season. Aphidiines could also reduce aphid density although their impact may be shadowed by the presence of coccinellids in the open field (likely both owing to resource competition and intraguild predation. The implications of these results are discussed in a framework of the compatibility of transgenic crops and top-down forces exerted by natural enemy guild.

Morphometric relationship, phylogenetic correlation, and character evolution in the species-rich genus Aphis (Hemiptera: Aphididae.

Directory of Open Access Journals (Sweden)

Hyojoong Kim

2010-07-01

Full Text Available The species-rich genus Aphis consists of more than 500 species, many of them host-specific on a wide range of plants, yet very similar in general appearance due to convergence toward particular morphological types. Most species have been historically clustered into four main phenotypic groups (gossypii, craccivora, fabae, and spiraecola groups. To confirm the morphological hypotheses between these groups and to examine the characteristics that determine them, multivariate morphometric analyses were performed using 28 characters measured/counted from 40 species. To infer whether the morphological relationships are correlated with the genetic relationships, we compared the morphometric dataset with a phylogeny reconstructed from the combined dataset of three mtDNA and one nuclear DNA regions.Based on a comparison of morphological and molecular datasets, we confirmed morphological reduction or regression in the gossypii group unlike in related groups. Most morphological characteristics of the gossypii group were less variable than for the other groups. Due to these, the gossypii group could be morphologically well separated from the craccivora, fabae, and spiraecola groups. In addition, the correlation of the rates of evolution between morphological and DNA datasets was highly significant in their diversification.The morphological separation between the gossypii group and the other species-groups are congruent with their phylogenetic relationships. Analysis of trait evolution revealed that the morphological traits found to be significant based on the morphometric analyses were confidently correlated with the phylogeny. The dominant patterns of trait evolution resulting in increased rates of short branches and temporally later evolution are likely suitable for the modality of Aphis speciation because they have adapted species-specifically, rapidly, and more recently on many different host plants.

Modeling and Control for Microgrids

Science.gov (United States)

Steenis, Joel

Traditional approaches to modeling microgrids include the behavior of each inverter operating in a particular network configuration and at a particular operating point. Such models quickly become computationally intensive for large systems. Similarly, traditional approaches to control do not use advanced methodologies and suffer from poor performance and limited operating range. In this document a linear model is derived for an inverter connected to the Thevenin equivalent of a microgrid. This model is then compared to a nonlinear simulation model and analyzed using the open and closed loop systems in both the time and frequency domains. The modeling error is quantified with emphasis on its use for controller design purposes. Control design examples are given using a Glover McFarlane controller, gain scheduled Glover McFarlane controller, and bumpless transfer controller which are compared to the standard droop control approach. These examples serve as a guide to illustrate the use of multi-variable modeling techniques in the context of robust controller design and show that gain scheduled MIMO control techniques can extend the operating range of a microgrid. A hardware implementation is used to compare constant gain droop controllers with Glover McFarlane controllers and shows a clear advantage of the Glover McFarlane approach.

Indian Bt cotton varieties do not affect the performance of cotton aphids.

Directory of Open Access Journals (Sweden)

Nora C Lawo

Full Text Available Cotton varieties expressing Cry proteins derived from the soil bacterium Bacillus thuringiensis (Bt are grown worldwide for the management of pest Lepidoptera. To prevent non-target pest outbreaks and to retain the biological control function provided by predators and parasitoids, the potential risk that Bt crops may pose to non-target arthropods is addressed prior to their commercialization. Aphids play an important role in agricultural systems since they serve as prey or host to a number of predators and parasitoids and their honeydew is an important energy source for several arthropods. To explore possible indirect effects of Bt crops we here examined the impact of Bt cotton on aphids and their honeydew. In climate chambers we assessed the performance of cotton aphids, Aphis gossypii Glover (Hemiptera: Aphididae when grown on three Indian Bt (Cry1Ac cotton varieties (MECH 12, MECH 162, MECH 184 and their non-transformed near isolines. Furthermore, we examined whether aphids pick up the Bt protein and analyzed the sugar composition of aphid honeydew to evaluate its suitability for honeydew-feeders. Plant transformation did not have any influence on aphid performance. However, some variation was observed among the three cotton varieties which might partly be explained by the variation in trichome density. None of the aphid samples contained Bt protein. As a consequence, natural enemies that feed on aphids are not exposed to the Cry protein. A significant difference in the sugar composition of aphid honeydew was detected among cotton varieties as well as between transformed and non-transformed plants. However, it is questionable if this variation is of ecological relevance, especially as honeydew is not the only sugar source parasitoids feed on in cotton fields. Our study allows the conclusion that Bt cotton poses a negligible risk for aphid antagonists and that aphids should remain under natural control in Bt cotton fields.

Differential Life History Trait Associations of Aphids with Nonpersistent Viruses in Cucurbits.

Science.gov (United States)

Angelella, G M; Egel, D S; Holland, J D; Nemacheck, J A; Williams, C E; Kaplan, I

2015-06-01

The diversity of vectors and fleeting nature of virus acquisition and transmission renders nonpersistent viruses a challenge to manage. We assessed the importance of noncolonizing versus colonizing vectors with a 2-yr survey of aphids and nonpersistent viruses on commercial pumpkin farms. We quantified aphid alightment using pan traps, while testing leaf samples with multiplex RT-PCR targeting cucumber mosaic virus (CMV), zucchini yellow mosaic virus (ZYMV), watermelon mosaic virus (WMV), and papaya ringspot virus (PRSV). Overall, we identified 53 aphid species (3,899 individuals), from which the melon aphid, Aphis gossypii Glover, a pumpkin-colonizing species, predominated (76 and 37% of samples in 2010 and 2011, respectively). CMV and ZYMV were not detected, but WMV and PRSV were prevalent, both regionally (WMV: 28/29 fields, PRSV: 21/29 fields) and within fields (infection rates = 69 and 55% for WMV in 2010 and 2011; 28 and 25% for PRSV in 2010 and 2011). However, early-season samples showed extremely low infection levels, suggesting cucurbit viruses are not seed-transmitted and implicating aphid activity as a causal factor driving virus spread. Interestingly, neither noncolonizer and colonizer alightment nor total aphid alightment were good predictors of virus presence, but community analyses revealed species-specific relationships. For example, cowpea aphid (Aphis craccivora Koch) and spotted alfalfa aphid (Therioaphis trifolii Monell f. maculata) were associated with PRSV infection, whereas the oleander aphid (Aphis nerii Bover de Fonscolombe) was associated with WMV spread within fields. These outcomes highlight the need for tailored management plans targeting key vectors of nonpersistent viruses in agricultural systems. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Cucumber Plants Baited with Methyl Salicylate Accelerates Scymnus (Pullus) sodalis (Coleoptera: Coccinellidae) Visiting to Reduce Cotton Aphid (Hemiptera: Aphididae) Infestation.

Science.gov (United States)

Dong, Y J; Hwang, S Y

2017-10-01

The cotton aphid, Aphis gossypii (Glover) (Hemiptera: Aphididae), is a major pest of many crops worldwide and a major cucumber plant pest in Taiwan. Because cotton aphids rapidly develop insecticide resistance and because of the insecticide residue problem, a safe and sustainable method is required to replace conventional chemical control methods. Methyl salicylate (MeSA), a herbivore-induced plant volatile, has been shown to affect aphids' behavior and attract the natural enemies of aphids for reducing their population. Therefore, this study examined the direct effects of MeSA on cotton aphids' settling preference, population development, and attractiveness to natural enemies. The efficiency of using MeSA and the commercial insecticide pymetrozine for reducing the cotton aphid population in laboratory and outdoor cucumber plant pot was also examined. The results showed no difference in winged aphids' settling preference and population development between the MeSA and blank treatments. Cucumber plants infested with cotton aphids and baited with 0.1% or 10% MeSA contained significantly higher numbers of the natural enemy of cotton aphids, namely Scymnus (Pullus) sodalis (Weise) (Coleoptera: Coccinellidae), and MeSA-treated cucumber plants contained a lower number of aphids. Significantly lower cotton aphid numbers were found on cucumber plants within a 10-m range of MeSA application. In addition, fruit yield showed no difference between the MeSA and pymetrozine treatments. According to our findings, 0.1% MeSA application can replace insecticides as a cotton aphid control tool. However, large-scale experiments are necessary to confirm its efficiency and related conservation biological control strategies before further use. © The Author 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

A Molecular Phylogeny of Hemiptera Inferred from Mitochondrial Genome Sequences

Science.gov (United States)

Song, Nan; Liang, Ai-Ping; Bu, Cui-Ping

2012-01-01

Classically, Hemiptera is comprised of two suborders: Homoptera and Heteroptera. Homoptera includes Cicadomorpha, Fulgoromorpha and Sternorrhyncha. However, according to previous molecular phylogenetic studies based on 18S rDNA, Fulgoromorpha has a closer relationship to Heteroptera than to other hemipterans, leaving Homoptera as paraphyletic. Therefore, the position of Fulgoromorpha is important for studying phylogenetic structure of Hemiptera. We inferred the evolutionary affiliations of twenty-five superfamilies of Hemiptera using mitochondrial protein-coding genes and rRNAs. We sequenced three mitogenomes, from Pyrops candelaria, Lycorma delicatula and Ricania marginalis, representing two additional families in Fulgoromorpha. Pyrops and Lycorma are representatives of an additional major family Fulgoridae in Fulgoromorpha, whereas Ricania is a second representative of the highly derived clade Ricaniidae. The organization and size of these mitogenomes are similar to those of the sequenced fulgoroid species. Our consensus phylogeny of Hemiptera largely supported the relationships (((Fulgoromorpha,Sternorrhyncha),Cicadomorpha),Heteroptera), and thus supported the classic phylogeny of Hemiptera. Selection of optimal evolutionary models (exclusion and inclusion of two rRNA genes or of third codon positions of protein-coding genes) demonstrated that rapidly evolving and saturated sites should be removed from the analyses. PMID:23144967

A molecular phylogeny of Hemiptera inferred from mitochondrial genome sequences.

Directory of Open Access Journals (Sweden)

Nan Song

Full Text Available Classically, Hemiptera is comprised of two suborders: Homoptera and Heteroptera. Homoptera includes Cicadomorpha, Fulgoromorpha and Sternorrhyncha. However, according to previous molecular phylogenetic studies based on 18S rDNA, Fulgoromorpha has a closer relationship to Heteroptera than to other hemipterans, leaving Homoptera as paraphyletic. Therefore, the position of Fulgoromorpha is important for studying phylogenetic structure of Hemiptera. We inferred the evolutionary affiliations of twenty-five superfamilies of Hemiptera using mitochondrial protein-coding genes and rRNAs. We sequenced three mitogenomes, from Pyrops candelaria, Lycorma delicatula and Ricania marginalis, representing two additional families in Fulgoromorpha. Pyrops and Lycorma are representatives of an additional major family Fulgoridae in Fulgoromorpha, whereas Ricania is a second representative of the highly derived clade Ricaniidae. The organization and size of these mitogenomes are similar to those of the sequenced fulgoroid species. Our consensus phylogeny of Hemiptera largely supported the relationships (((Fulgoromorpha,Sternorrhyncha,Cicadomorpha,Heteroptera, and thus supported the classic phylogeny of Hemiptera. Selection of optimal evolutionary models (exclusion and inclusion of two rRNA genes or of third codon positions of protein-coding genes demonstrated that rapidly evolving and saturated sites should be removed from the analyses.

Analysis of the populations genetic variability of Tagosodes orizicolus (Homoptera: Delphacidae), virus vector of the rice white leaf

International Nuclear Information System (INIS)

Hernandez Alfaro, Myriam

2006-01-01

Tagosodes orizicolus (Homoptera: Delphacidae), is a monophagous insect of the rice and virus vector of the white leaf (RHBV). It is distributed in America Central, El Caribe, part of the America del Sur and in Costa Rica it is in all the producing zones of rice. The genetic variability was analyzed by means of RAPD-PCR of individuals from three populations of Costa Rica: Parrita, Guanacaste (Liberia) y San Carlos (Santa Clara), that they are found separated geographically. The technique consisted of amplifying regions at random of the genome of these insects utilizing five primers. A total of 72 polymorphic bands were obtained, that upon being analyzed statistically by means of the multivariate analysis program of numerical taxonomy could show a clear genetic distancing among said populations. The genetic distance observed in the molecular analysis can be explained for the climatic and/or geographical isolation of the populations or by the incident of Wolbachia, riquettsia that induces cytoplasmic sterility in insects. These symbionts are transmitted of generation in generation, of the mother to their offspring and they cause reproductive alterations as cytoplasmic incompatibility, parthenogenesis and feminization. The presence of Wolbachia was determined by means of transmission electronic microscopy being observed in the greasy and muscular weave of the abdomen of T. orizicolus. Rickettsias present pleomorphic morphology and form small groups, that are characterized for the presence of electrondense material semidetached to the cell wall with an interior electronlucent. Its size in transverse cuts ranged between 520 nm of length X 470 nm of width. In addition, its presence was detected by means of the amplification by PCR of the genomic DNA of the insects; a specific primer for the DNA ribosomal 16S of Wolbachia was utilized for it. A 86% of insects of the San Carlos population were positive, a 96% was determined for Guanacaste, a 37% for Parrita and a 100% for

Impact of insecticides on non-target arthropods in watermelon cropImpacto de inseticidas em artrópodes não-alvo associados à cultura da melancia

Directory of Open Access Journals (Sweden)

Cíntia Ribeiro Souza

2012-10-01

Full Text Available Watermelon Citrullus lunatus (Thunberg, Matsumura & Nakai is an ecosystem having a variety of arthropods, each one playing a specific role. Although some of them are considered pest to crops, some others are responsible for soil aeration, nutrient release and predation of pest species and are, therefore, considered beneficial to crops. The intensive farming practiced for watermelon cultivation in Brazil is based on the use of tiamethoxam and deltamethrin, which may not only kill target but also nontarget organisms such as beneficial arthropods. Research data regarding the influence of insecticides on arthropods in watermelon cropping is scarce. This study aimed to evaluate the effect of the insecticides deltamethrin and thiamethoxam on soil surface and watermelon canopy arthropod community. The study was carried out in the State of Tocantins, Brazil. Although the application of thiamethoxam and deltamethrin was efficient in controlling populations of Aphis gossypii (Glover, as we expected, they negatively affected non-target arthropods such as detritivores insects in the canopy and soil surface. Ecological implications of the impact of such pesticides on beneficial arthropod species are discussed.A cultura da melancia Citrullus lunatus (Thunberg, Matsumura & Nakai abriga uma grande diversidade de artrópodes, cada um desempenhando um papel específico. Apesar de alguns desses artrópodes serem considerados pragas, outros são responsáveis pela aeração do solo, liberação de nutrientes e predação das espécies-praga, sendo, dessa forma, considerados benéficos às culturas. A agricultura intensiva praticada no Brasil para o cultivo da melancia é baseada no uso dos inseticidas como tiamethoxam e deltametrina, que pode não só matar as pragas, mas também organismos não-alvo. Pesquisas relacionadas à influência de inseticidas sobre artrópodes benéficos na cultura da melancia são escassas. Este estudo foi realizado com o objetivo de

Homoptera, Cicadidae

African Journals Online (AJOL)

1988-10-24

Oct 24, 1988 ... There are also morphological differences between the two taxa which parallel the differences in their .... Female 5 31,0 29,9--32,2 9 26,8 25,3-28,7 -8,11 0,0001. • Student's t test. [. 1mm. A. B. Figure 2 Male genitalia (pygophore and urite). A, P. stridula; ... mainly on trees, all of which were exotics, e.g. Port.

Homoptera: Cicadidae

African Journals Online (AJOL)

1988-10-24

Oct 24, 1988 ... The geographical distributions, habitat preferences, plant associations and seasonal appearance of the platypleurine cicadas occurring on the Natal coastal plain, South Africa, are reported for the first time, and a key to the species is provided. Die geografiese verspreiding, habitatvoorkeur, plantassosiasies ...

Homoptera: Aphididae

African Journals Online (AJOL)

and parasitoids per plant, ladybird beetles per plot, and finally grain yield per plot were recorded. Based on the results of the ANOVA, plant ... is a food, fodder and feed crop belonging to the family Leguminosae (= Fabaceae) ... use of predators, parasitoids and pathogens for pest control, either by introduction from other ...

Simulate rain about action insecticide flonicamid in the control of the cotton aphid=Chuva simulada sobre ação inseticida flonicamid no controle do pulgão-do-algodoeiro.

Directory of Open Access Journals (Sweden)

Paulo Eduardo Degrande

2011-10-01

Full Text Available The cotton production system in Brazil concentrates on the area of the cerrado, characterized by frequent rains that interfere in the effectiveness of the necessary sprays during its cycle. The objective of the work was to evaluate simulate rain of 15 mm in 4 hours after spraying in the control of Aphis gossypii with insecticide flonicamid. Plants of Gossypium hirsutum were cultivated in pots containing soil as substrate in greenhouse conditions. The pots were arranged in randomized complete design with seven treatments and five replicates, consisting of: test without insecticide spraying, without insecticide spraying with rain, flonicamid spraying with simulate rain of 15 mm after 30 minutes, 1, 2 and 4 hours after spraying. Equivalent insecticide was sprayed 75 g of flonicamid by hectare. The efficiency evaluation was accomplished through the individuals of A. gossypii count which started from an artificial infestation 6 days before the application of the treatments. The results were: a 15-mm precipitation during the first four hours after flonicamid spraying interfered negatively in the control of A. gossypii.O cultivo do algodoeiro no Brasil concentra-se na Região do Cerrado, caracterizada por chuvas freqüentes que interferem na eficácia das pulverizações necessárias durante seu ciclo. O objetivo do trabalho foi avaliar chuva simulada de 15 mm nas 4h iniciais após pulverização no controle de A. gossypii com inseticida flonicamid. Plantas de Gossypium hirsutum foram cultivadas em vasos contendo solo como substrato em condições de casa-de-vegetação. Cada parcela foi constituída de um vaso com duas plantas. Utilizou-se delineamento experimental inteiramente casualizado com sete tratamentos e cinco repetições, consistindo de: testemunha sem pulverização de inseticida, testemunha sem pulverização de inseticida com presença de chuva e pulverização de flonicamid com chuva simulada de 15 mm aos 30 min., 1, 2 e 4h após aplica

The EU needs more anticipatory funding of health and environmental research

DEFF Research Database (Denmark)

Hansen, Steffen Foss; Gee, David

2014-01-01

In recent months, there have been several attacks on the Precautionary Principle and how the principle has been used in the EU. For example, the scientific advisor to the President of the European Commission, Ann Glover, has accused Commissioners of having “crazy ideas” about the safety of nanote......In recent months, there have been several attacks on the Precautionary Principle and how the principle has been used in the EU. For example, the scientific advisor to the President of the European Commission, Ann Glover, has accused Commissioners of having “crazy ideas” about the safety...

Carboxylesterase-mediated insecticide resistance: Quantitative increase induces broader metabolic resistance than qualitative change.

Science.gov (United States)

Cui, Feng; Li, Mei-Xia; Chang, Hai-Jing; Mao, Yun; Zhang, Han-Ying; Lu, Li-Xia; Yan, Shuai-Guo; Lang, Ming-Lin; Liu, Li; Qiao, Chuan-Ling

2015-06-01

Carboxylesterases are mainly involved in the mediation of metabolic resistance of many insects to organophosphate (OP) insecticides. Carboxylesterases underwent two divergent evolutionary events: (1) quantitative mechanism characterized by the overproduction of carboxylesterase protein; and (2) qualitative mechanism caused by changes in enzymatic properties because of mutation from glycine/alanine to aspartate at the 151 site (G/A151D) or from tryptophan to leucine at the 271 site (W271L), following the numbering of Drosophila melanogaster AChE. Qualitative mechanism has been observed in few species. However, whether this carboxylesterase mutation mechanism is prevalent in insects remains unclear. In this study, wild-type, G/A151D and W271L mutant carboxylesterases from Culex pipiens and Aphis gossypii were subjected to germline transformation and then transferred to D. melanogaster. These germlines were ubiquitously expressed as induced by tub-Gal4. In carboxylesterase activity assay, the introduced mutant carboxylesterase did not enhance the overall carboxylesterase activity of flies. This result indicated that G/A151D or W271L mutation disrupted the original activities of the enzyme. Less than 1.5-fold OP resistance was only observed in flies expressing A. gossypii mutant carboxylesterases compared with those expressing A. gossypii wild-type carboxylesterase. However, transgenic flies universally showed low resistance to OP insecticides compared with non-transgenic flies. The flies expressing A. gossypii W271L mutant esterase exhibited 1.5-fold resistance to deltamethrin, a pyrethroid insecticide compared with non-transgenic flies. The present transgenic Drosophila system potentially showed that a quantitative increase in carboxylesterases induced broader resistance of insects to insecticides than a qualitative change. Copyright © 2014 Elsevier Inc. All rights reserved.

Intraguild predation by the generalist predator Orius majusculus on the parasitoid Encarsia formosa

DEFF Research Database (Denmark)

Sohrabi, Fariba; Enkegaard, Annie; Shishehbor, Parviz

2013-01-01

Intraguild predation of Orius majusculus (Reuter) (Heteroptera: Anthocoridae) on Encarsia formosa (Gahan) (Hymenoptera: Aphelinidae), both natural enemies of Bemisia tabaci (Gennadius) (Homoptera: Aleyrodidae), was studied under laboratory conditions. The experiments quantified prey consumption b...

ORF Alignment: NC_005786 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ssypii ATCC 10895] ref|NP_984597.1| AEL263Cp ... [Eremothecium gossypii] ... Length = 128 ... Query: 4 ... KDIRT...GDRVLCKVGDFPPWPAVVVPQRFLSKLVYSGKRSKSYVCVAFFNDDSYYWKEPRH 63 ... KDIRTGDRVLCKVGDFPPWPAVVVP...QRFLSKLVYSGKRSKSYVCVAFFNDDSYYWKEPRH Sbjct: 1 ... KDIRTGDRVLCKVGDFPPWPAVVVPQRFLSKLVY

ORF Alignment: NC_005787 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available sypii ATCC 10895] ref|NP_985616.1| AFR069Cp ... [Eremothecium gossypii] ... Length = 62 ... Query: 34 GAGAGCPVCQNCHTST...TPLWRRDEHGAVLCNACGLFLKLHGRPRPISLKTDVIKSRN 90 ... GAGAGCPVCQNCHTSTTPLWRRDEHGAVLCNAC...GLFLKLHGRPRPISLKTDVIKSRN Sbjct: 1 ... GAGAGCPVCQNCHTSTTPLWRRDEHGAVLCNACGLFLKLHGRPRPISLKTDVIKSRN 57

Monitoring of aphid flight activities in seed potato crops in Serbia

Directory of Open Access Journals (Sweden)

Andja Vucetic

2013-07-01

Full Text Available Aphid flight activities in seed potato fields have been studied by the yellow water traps. It is a good method for monitoring aphids as vectors of viruses, but this study also showed it is a suitable method for insect-diversity research. During the four-year studies, over 11.500 specimens were collected and a total of 107 different taxa of aphids were identified. The most abundant species were polyphagous species, such as: Acyrthosiphon pisum (Haris, Aphis fabae Scopoli, Aphis gossypii Glover and Brachycaudus helichrysi (Kaltenbach. The results of the studies show that diversity of aphids in different regions of Serbia is similar regardless of the altitude and the diversity of terrain. At most sites it ranged from 2 to 3. The highest value was recorded in Begeč, locality in northern part of Serbia, in year 2008, and it was 2.92. The maximum values of the Shannon-Weaver diversity index at all sites were recorded in the first weeks of the monitoring of aphid flight activities. Morisita-Horn similarity index shows no significant differences between sites regardless of altitudes. The sites are grouped by year, not by similarity of relief. In spite of these results, the Chi-square analysis showed highly significant difference in vector frequencies among seasons and sites with more pronounced differences for PVY. As a consequence of differences in vector frequencies, the vector pressure index in some regions was different also. The number of vectors and vector pressure index vary depending on the altitude of localities. At localities at altitudes under 1000 m, they were high. The highest index was at Kotraža, locality in central part of Serbia, in 2007, when PVY index exceeded the value of 180, while for PLRV it was 60. At high altitudes on mountain Golija, above 1100 m, the number of aphids was low, as well as the vector pressure index which indicates that these regions are suitable for producing virus-free seed potato.

Understanding biological control of greenhouse whitefly with the parasitoid Encarsia formosa : from individual behaviour to population dynamics

NARCIS (Netherlands)

Roermund, van H.J.W.

1995-01-01

The greenhouse whitefly, Trialeurodes vaporariorum (Westwood) (Homoptera, Aleyrodidae), is a very common, highly polyphagous pest insect all over the world. Biological control of whiteflies with the parasitoid Encarsia formosa Gahan (Hymenoptera, Aphelinidae) was already applied in the 1920s in

Tissue location of resistance in apple to the rosy apple aphid established by electrical penetration graphs

NARCIS (Netherlands)

Marchetti, E.; Civolani, S.; Leis, M.; Chicca, M.; Tjallingii, W.F.; Pasqualini, E.; Baroni, P.

2009-01-01

A study of the constitutive resistance of the apple cultivar Florina, Malus domestica Borkh. (Rosaceae), to the rosy apple aphid, Dysaphis plantaginea (Passerini) (Homoptera Aphididae), was performed for the first time by the electrical penetration graph (DC-EPG) system, using the susceptible apple

Fungal Endophytes of Wild Barley and their Effects on Diuraphis noxia Population Development

Science.gov (United States)

S.L. Clement; A. Dan Wilson; D.G. Lester; C.M. Davitt

1997-01-01

Laboratory experiments were conducted to compare the expression of Diuraphis noxia (Mordvilko) (Homoptera: Aphididae) resistance in four plant introduction (PI) lines of wild barley (Hordeum) infected with different species or strains of endophytic fungi (tribe Balansieae, family Clavicipitaceae, Neotyphodium gen. nov. [formerly...

Infection of potato plants with potato leafroll virus changes attraction and feeding behaviour of Myzus persicae

NARCIS (Netherlands)

Alvarez, A.E.; Garzo, E.; Verbeek, M.; Vosman, B.; Dicke, M.; Tjallingii, W.F.

2007-01-01

Potato leafroll virus (PLRV; genus Polerovirus, family Luteoviridae) is a persistently transmitted circulative virus that depends on aphids for spreading. The primary vector of PLRV is the aphid Myzus persicae (Sulzer) (Homoptera: Aphididae). Solanum tuberosum L. potato cv. Kardal (Solanaceae) has a

Nigerian Journal of Horticultural Science - Vol 13, No 1 (2008)

African Journals Online (AJOL)

Spread of the spiraling white fly Aleurodicus dispersus (Homoptera: Aleyrodidae) and its parasitoids Encarcia species (Hymenoptera: Aphelinidae) on horticultural plants in ... Nutrient release patterns of kola pod husk and pacesetter grade b fertilizer during incubation in the laboratory · EMAIL FULL TEXT EMAIL FULL TEXT

Characterizing pathways of invasion using Sternorryhncha on imported plant material in cargo

Science.gov (United States)

Timothy T. Work

2011-01-01

Non-indigenous Homoptera, mainly scales, aphids, and mealy bugs, intercepted on plants destined for cultivation represent an elevated risk for the establishment of invasive insects in North America. These insects [grouped as the suborder Sternorrhyncha] are often parthenogenic and are imported on viable host plants.

Resistance to lettuce aphid (Nasonovia ribisnigri) biotype 0 in wild lettuce accessions PI 491093 and PI 274378

Science.gov (United States)

Lettuce aphid, Nasonovia ribisnigri Mosley (Homoptera : Aphididae), is a major insect pest of lettuce, Lactuca sativa L, in many commercial lettuce productions areas around the world. Resistance to lettuce aphid was first reported in Lactuca virosa L. accession IVT 280 and characterized as complete,...

Genetics Home Reference: lymphedema-distichiasis syndrome

Science.gov (United States)

... G, Jones MC, Kerstjens-Frederikse WS, Lidral AC, McDonald M, Nelson CC, Witte M, Glover TW. Clinical ... 10 All Bulletins Features What is direct-to-consumer genetic testing? What are genome editing and CRISPR- ...

Previsual detection of two conifer-infesting adelgid species in North American forest

Science.gov (United States)

Stephen Cook; Karen Humes; Ryan Hruska; Christopher Williams; Grant Fraley

2010-01-01

The balsam woolly adelgid, Adelges piceae, and hemlock woolly adelgid, A. tsugae (Homoptera: Adelgidae), are invasive pests of coniferous forests in both the Eastern and Western United States. Balsam woolly adelgid is capable of attacking and killing native North American firs, with Fraser fir (Abies fraseri...

Short Communication: Occurrence of the pea aphid, Acyrthosiphon ...

African Journals Online (AJOL)

The occurrence of pea aphid, Acyrthosiphon pisum (Harris) (Homoptera: Aphididae), on wild annual and perennial leguminous plants was studied at two locations (Adet and Wondata) in West Gojam, Ethiopia in 1999/2000 seasons. Annual and perennial leguminous wild or volunteer plants encountered in the study areas ...

Metaheuristic approaches to order sequencing on a unidirectional ...

African Journals Online (AJOL)

is that tabu search (TS) incorporates “intelligence. ..... location that will benefit the solution quality by considering implications that may arise ..... [12] Glover F, 1986, Future paths for integer programming and links to artificial intelligence, ...

Coat protein sequence shows that Cucumber mosaic virus isolate ...

Indian Academy of Sciences (India)

Madhu

A viral disease was identified on geraniums (Pelargonium spp.) grown in a greenhouse at the .... DNA was cloned in p-GEM Teasy vector (Promega, USA) as per the ... M. persicae and A. gossypii transmitted the virus in non persistent manner ...

Applicability of empirical correlations for estimating global solar radiation

International Nuclear Information System (INIS)

Gopinathan, K.K.; Baholo, M.

1987-01-01

Three empirical models suggested by different investigators, for estimating monthly mean daily global radiation on a horizontal surface, are compared statistically to test their universal applicability. The models thus compared are those suggested by Rietveld, Glover and McCulloch and Gopinathan. The models are compared by calculating the root mean square error, mean bias error and mean relative percentage error values. The model suggested by Gopinathan yields the best results in terms of root mean square, mean bias and mean percentage errors. The model by Rietveld is the second best and the model by Glover and McCulloch comes at third place. However, the differences in the magnitude of errors among the three models are very small and all the three models can be considered to be accurate for global radiation estimation for any location in the world

77 FR 67366 - Federal Acquisition Regulation; Information Collection; Quality Assurance Requirements

Science.gov (United States)

2012-11-09

.... Glover, Sr., Procurement Analyst, Contract Policy Division, GSA (202) 501-1448 or email [email protected] . SUPPLEMENTARY INFORMATION: A. Purpose Supplies and services acquired under Government contracts..., acceptance, warranty, and other measures associated with quality requirements. Standard clauses related to...

2528-IJBCS-Article-Cocou A Djihinto

African Journals Online (AJOL)

hp

(endosulfan 700 g/ha) pour le contrôle des populations de Aphis gossypii, Pectinophora gossypiella et .... chaque ligne mesure 20 mètres de longeur. .... performance de Fanga 500 EC en milieu réel ..... fenêtre et gestion de Helicoverpa.

Infeksi Cucumber mosaic virus dan Chilli veinal mottle virus pada Cabai di Kabupaten Rejang Lebong, Bengkulu

Directory of Open Access Journals (Sweden)

Mimi Sutrawati

2013-04-01

Full Text Available Mosaic disease caused by Cucumber mosaic virus (CMV and Chilli veinal mottle Virus (ChiVMV has been distributed widely in chilli in Indonesia and considered as important disease. A research was conducted to investigate the spread and incidence of CMV and ChiVMV in Rejang Lebong, Bengkulu and to identify its insect vector. Symptomatic and asymptomatic leaf samples were collected systematically from several chillipepper fields for further detection by DAS-ELISA (Double antibody sandwich-enzyme linked immunosorbant assay using specific antibody for CMV and ChiVMV. The result showed that infection of both CMV and ChiVMV was found with disease incidence reached 20-50%, whereas infection only by ChiVMV or CMV were 50-80% and 20-50%, respectively. One species of aphid, i.e. Aphis gossypii was found from the fields.Key words: Aphis gossypii, CMV, ChiVMV, disease incidence

Significance and transmission of maize streak virus disease in Africa ...

African Journals Online (AJOL)

STORAGESEVER

2008-12-29

Dec 29, 2008 ... soil nutrients, altitude and temperature on the biology of maize streak virus (MSV) / vector populations is discussed. ... status of maize host plants and its effects on population dynamics of Cicadulina mbila Naudé. (Homoptera: ..... time necessary for the leafhopper to reach the mesophyll of the leaf and ingest ...

A review and critical analysis of how cognitive neuroscientific investigations using dance can contribute to sport psychology

NARCIS (Netherlands)

Cross, E.S.; Acquah, D.; Ramsey, R.

2014-01-01

Whether watching Michael Jackson moonwalk or Savion Glover tap dance, it is striking how skilfully some people can move their bodies. The emerging field of cognitive neuroscience has produced important advances in understanding the control and perception of complex action. Here we outline the merits

Military Housing Privatization Initiative (MHPI), Eglin AFB, Florida and Hurlburt Field, Florida. Final Environmental Impact Statement

Science.gov (United States)

2011-05-01

Gene G. Sanderson George E. Cox Gerald A. Rush* Gerald Goodson Ginny Graybiel Glenda L. Glover Gordon Eldridge Gordon Goodin Greg Artabasy Greg... Fanc ~np. Thank you very much. COLONEL CUMBIE: Thank you, sir. !Vlr. Robert Larson . MR. LARSON: My name is Robert Larson . The Military Housing

77 FR 66464 - Federal Acquisition Regulation; Submission for OMB Review; Value Engineering Requirements

Science.gov (United States)

2012-11-05

...; whether our estimate of the public burden of this collection of information is accurate, and based on... provided. FOR FURTHER INFORMATION CONTACT: Mr. Curtis E. Glover, Sr., Procurement Analyst, Contract Policy Division, GSA, (202) 501-1448 or email at [email protected] . A. Purpose Per Federal Acquisition...

A reassessment of the early archaeological record at Leang Burung 2, a Late Pleistocene rock-shelter site on the Indonesian island of Sulawesi

NARCIS (Netherlands)

Brumm, Adam; Hakim, Budianto; Ramli, Muhammad; Aubert, Maxime; van den Bergh, Gerrit D.; Li, Bo; Burhan, Basran; Saiful, Andi Muhammad; Siagian, Linda; Sardi, Ratno; Jusdi, Andi; Said, Abdullah; Mubarak, Andi Pampang; Moore, Mark W.; Roberts, Richard G.; Zhao, Jian-xin; McGahan, David; Jones, Brian G.; Perston, Yinika; Szabó, Katherine; Mahmud, M. Irfan; Westaway, Kira; [Unknown], Jatmiko; Saptomo, E. Wahyu; van der Kaars, Sander; Grün, Rainer; Wood, Rachel; Dodson, John; Morwood, Michael J.

2018-01-01

This paper presents a reassessment of the archaeological record at Leang Burung 2, a key early human occupation site in the Late Pleistocene of Southeast Asia. Excavated originally by Ian Glover in 1975, this limestone rock-shelter in the Maros karsts of Sulawesi, Indonesia, has long held

Handbook of metaheuristics

CERN Document Server

Potvin, Jean-Yves

2010-01-01

“… an excellent book if you want to learn about a number of individual metaheuristics." (U. Aickelin, Journal of the Operational Research Society, Issue 56, 2005, on the First Edition) The first edition of the Handbook of Metaheuristics was published in 2003 under the editorship of Fred Glover and Gary A. Kochenberger. Given the numerous developments observed in the field of metaheuristics in recent years, it appeared that the time was ripe for a second edition of the Handbook. When Glover and Kochenberger were unable to prepare this second edition, they suggested that Michel Gendreau and Jean-Yves Potvin should take over the editorship, and so this important new edition is now available. Through its 21 chapters, this second edition is designed to provide a broad coverage of the concepts, implementations and applications in this important field of optimization. Original contributors either revised or updated their work, or provided entirely new chapters. The Handbook now includes updated chapters on the b...

Estimation of the number of aphids carrying Citrus tristeza virus that visit adult citrus trees.

Science.gov (United States)

Marroquín, Carlos; Olmos, Antonio; Teresa Gorris, María; Bertolini, Edson; Carmen Martínez, M; Carbonell, Emilio A; Hermoso de Mendoza, Alfonso; Cambra, Mariano

2004-03-01

Aphid species were counted on citrus trees in orchards in Valencia, Spain, in the spring and autumn of 1997, 1998 and 1999. Moericke yellow water traps, the 'sticky shoot' method and counts of established colonies were used in extensive surveys in which 29,502 aphids were recorded and identified. Aphis spiraecola and Aphis gossypii were the most abundant aphid species. The numbers of aphid species landing on mature trees of grapefruit, sweet orange, lemon and clementine and satsuma mandarins, were estimated by counting the numbers of young shoots/tree and aphids trapped on sticky shoots. The proportions of the different aphid species captured were: A. gossypii (53%), A. spiraecola (32%), Toxoptera aurantii (11%), Myzus persicae (1%), Aphis craccivora (1%) and other species (2%). Clementine was the most visited species with 266,700 aphids landing/tree in spring 2000, followed by lemon (147,000), sweet orange (129,150), grapefruit (103,200), and satsuma (92,400). The numbers and relative percentages of aphids carrying Citrus tristeza virus (CTV) were assessed by nested RT-PCR in single closed tubes and analysed by extraction of RNA-CTV targets from trapped aphids. An average of 37,190 CTV-carrying aphids visited each tree in spring 2000 (29 per shoot). The percentage detection of viral RNA in the aphid species that landed were 27% for A. gossypii, 23% for A. spiraecola and 19% for T. aurantii. This high incidence of aphids carrying CTV is consistent with the high prevalence and rapid spread of CTV in sweet orange, clementine, and satsuma mandarins in recent years in the region. The infection rate was proportional to the number of aphids landing/tree.

Impacto do algodoeiro Bt na dinâmica populacional do pulgão-do-algodoeiro em casa de vegetação Impact of Bt cotton on the population dynamics of the cotton aphid in greenhouse

Directory of Open Access Journals (Sweden)

Edison Ryoiti Sujii

2008-10-01

Full Text Available O objetivo deste trabalho foi desenvolver um protocolo experimental para avaliar o impacto do algodoeiro Bt na bionomia e na escolha de plantas para colonização pelo pulgão-do-algodoeiro (Aphis gossypii. A bionomia do pulgão foi avaliada em casa de vegetação com insetos criados em gaiolas individuais com plantas de algodão Bt, da variedade DP 404 BG (Bollgard, ou sua isolinha não transformada DP 4049. Gaiolas contendo vasos com plantas de algodoeiro Bt e não-Bt foram usadas como arena de escolha, para a avaliação de preferência de adultos alados. O período pré-reprodutivo e reprodutivo, a longevidade, a curva de sobrevivência, a produção de prole total e diária por fêmea e a curva acumulada de produção de prole da população não apresentaram diferenças significativas. Não foi observada diferença na escolha de plantas para colonização por indivíduos alados, o que indica taxas equivalentes de colonização nas populações iniciais. O algodoeiro Bt não afeta a dinâmica populacional de A. gossypii e não aumenta seu potencial de risco como praga.The objective of this work was to develop an experimental protocol to assess the impact of Bt cotton on bionomics and on plant choice for Aphis gossypii colonization. The bionomics of the cotton aphid was assessed in greenhouse with insects reared in individual cages containing Bt cotton plants of the variety DP 404 BG (Bollgard or its nontransformed isoline DP 4049. Cages with Bt cotton and non-Bt cotton were used as choosing arena for evaluation of winged adults preference. There was no significant difference for pre-reproduction period (immature phase, reproduction period, longevity, survivorship curve total and daily production of offspring by female, and curve of accumulated production of offspring by the population. There was no preference of colonization for any plant by winged adults, which indicates equivalent rates of colonization of the initial populations. Bt

A Technical and Practical Study of Composting as a Solid Waste Management Alternative for the Air Force

Science.gov (United States)

1992-09-01

52 0C Phvsoderma zeae- Brown spot of corn > 80C maydis Giberella zeae Seedling blight of corn > 651C ascospores Glomeralla gossypii Cotton anthracnose ...Pyrenophora teres Net blotch, barley 45°C conidia 55°C mycelium Septoria lycopersici Leafspot, tomatoes 43°C spores (2:221) 44 The extent of

Children's Use of Allocentric Cues in Visually- and Memory-Guided Reach Space

Science.gov (United States)

Cordova, Alberto; Gabbard, Carl

2012-01-01

Theory suggests that the vision-for-perception and vision-for-action processing streams operate under very different temporal constraints (Glover, 2004; Goodale, Jackobson, & Keillor, 1994; Graham, Bradshaw, & Davis, 1998; Hu, Eagleson, & Goodale, 1999). With the present study, children and young adults were asked to estimate how far a cued target…

JSTO Science and Technology Update. Volume 1, Number 2, Winter 2011

Science.gov (United States)

2011-01-01

the organism from lethality. Experimental animal model and techniques to evaluate radioprotective efficacy of GT3 Adult male CD2F1 mice were injected...Pharmac. Biochem. Behav. 27: 573–576. 22. Glover D, Riley LJ Jr, Carmichael K, Spar B, Glick JH, Slatopolsky E, Attie M, Goldfarb S (1983). Hypocalcemia

Magnetic rock properties of the gabbros from the ODP Drill Hole ...

Indian Academy of Sciences (India)

R.Narasimhan(krishtel emaging) 1461 1996 Oct 15 13:05:22

most coarse-grained oxide mineral bearing rocks record low Koenigsberger ratio (2 to 5) and median .... K. S. Krishna. Figure 2. (c) Stable remanence data of oxide gabbro (sample 29R-4, 54) which is nearly ..... the oxide gabbro with a mean around 3500×10−6 SI ..... Glover L 1994 The EDGE Experiment and the US East.

Polynomial Approximation Algorithms for the TSP and the QAP with a Factorial Domination Number

DEFF Research Database (Denmark)

Gutin, Gregory; Yeo, Anders

2002-01-01

Glover and Punnen (J. Oper. Res. Soc. 48 (1997) 502) asked whether there exists a polynomial time algorithm that always produces a tour which is not worse than at least n!/p(n) tours for some polynomial p(n) for every TSP instance on n cities. They conjectured that, unless P = NP, the answer to t...

An Extended Microcomputer-Based Network Optimization Package.

Science.gov (United States)

1982-10-01

fee a)S. SECURITY CLASS. (44 tis fdoen Unclassified IS& D OCASIfrCATION/OOW#GMAINiG 16o. DiSloRISuTION STATEMENT (a# IN#@ RapeffJ Approved for public...Generalized Netowrks ," Mathematics of Operations Research, Vol. 4, No. 1 (1979), pp. 39-59. 31. Glover, F. and Klingman, D., "A Note on Computational

Next-to-next-leading order correction to 3-jet rate and event-shape ...

Indian Academy of Sciences (India)

portunity to test QCD by measuring the energy dependence of different ... event shape data was not satisfactory largely due to the scale uncertainty of the pertur- .... )3 d ¯C dy. + O. ( α4 s. ) . (5). Here the event-shape distribution is normalized to the ..... [1] A Gehrmann-De Ridder, T Gehrmann, E W N Glover and G Heinrich, J.

Geophysical Imaging for Investigating the Delivery and Distribution of Amendments in the Heterogeneous Subsurface of the F.E. Warren AFB

Science.gov (United States)

2012-12-01

grain-fluid interface (Revil and Glover 1997, 1998). The electrical current distribution can be visualized by equipotential surfaces , with current flow...dimensional µg/L micrograms per liter µS/cm micro-Siemens per centimeter bgs below ground surface CERCLA Comprehensive Environmental Response...during, and after fracture emplacement using both surface and crosshole-based configurations. Several seismic methods were tested, including

Intraguild Predation Responses in Two Aphidophagous Coccinellids Identify Differences among Juvenile Stages and Aphid Densities.

Science.gov (United States)

Rondoni, Gabriele; Ielo, Fulvio; Ricci, Carlo; Conti, Eric

2014-12-08

(1) Intraguild predation (IGP) can occur among aphidophagous predators thus reducing their effectiveness in controlling crop pests. Among ladybirds, Coccinella septempunctata L. and Hippodamia variegata Goeze are the most effective predators upon Aphis gossypii Glov., which is an economically important pest of melon. Understanding their likelihood to engage in reciprocal predation is a key point for conservation of biological control. Here, we aim to investigate, under laboratory conditions, the level of IGP between the two above mentioned aphidophagous species. (2) Fourth-instars of the two species were isolated in petri dishes with combinations of different stages of the heterospecific ladybird and different densities of A. gossypii. The occurrence of IGP events was recorded after six hours. (3) C. septempunctata predated H. variegata at a higher rate than vice versa (70% vs. 43% overall). Higher density of the aphid or older juvenile stage of the IG-prey (22% of fourth instars vs. 74% of eggs and second instars) reduces the likelihood of predation. (4) To our knowledge, IGP between C. septempunctata and H. variegata was investigated for the first time. Results represent a baseline, necessary to predict the likelihood of IGP occurrence in the field.

Annual predictions of the peak numbers of Sitobion avenae infesting winter wheat

Czech Academy of Sciences Publication Activity Database

Honěk, A.; Martinková, Z.; Dixon, Anthony F. G.; Saska, P.

2017-01-01

Roč. 141, č. 5 (2017), s. 352-362 ISSN 0931-2048 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0073 Institutional support: RVO:86652079 Keywords : metopolophium-dirhodum wlk * cereal aphid populations * rhopalosiphum-padi l * english grain aphid * field populations * growth-stages * fixed levels * yield loss * homoptera * dynamics * abundance * ears * growth * leaves * maximum * population Subject RIV: EH - Ecology, Behaviour OBOR OECD: Biodiversity conservation Impact factor: 1.641, year: 2016

The Effect of Heat Input and Composition on Weld Metal Microstructures in Thin Section HY-130 GMAW(Gas Metal Are Welding) Weldments

Science.gov (United States)

1988-12-01

weldments, Glover et al. [Ref. Ej show, via a schematic CCT diagram , that austenite should transform to coarse polygonal ferrite with regions of pearlite...are essentially subjected to continuous cooling during solidification, so the resultant microstructures should be predictable from CCT diagrams . Unfortunately...cooling rate variaticn just within a single weld pass. Although individual CCT diagrams for weld metals are generally not available, the influence of

Scramjet Isolator Modeling and Control

Science.gov (United States)

2011-12-01

Layer Interactions,” (NATO) AGARD CP 193, May 1976. 17. Cox, C., Lewis, C., Pap, R., Glover, C., Priddy, K., Edwards, J., and McCarty, D., “Prediction...Static Polynomial Model . . . . . . . . . . . . . . . . . . 73 5.2 Continuous Linear Model with Static Polynomial Input . 75 5.3 ARX Models with Static...Vector of NARX model regression values . . . . . . . . . . 70 Nr Number of samples for a run . . . . . . . . . . . . . . . . 73 ΘNL Vector of

Acyrthosiphon pisum (Harris) (Homoptera: Aphididae) infestation ...

African Journals Online (AJOL)

Plant height, plant density per 0.25 m2, number of pea aphids and parasitoids per plant, ladybird beetles per plot, and finally grain yield per plot were recorded. Based on the results of the ANOVA, plant height was significantly different between treated and untreated plots especially after the vegetative stage. The density of ...

Implications of Technology on the Future Workforce

Science.gov (United States)

2017-08-02

industrial base to obtain similar benefits and significant cost savings – Talent to be reallocated for core missions by reducing FTEs associated with...USN Representative Capt Thomas Koch, USMC Representative Mr. Taylor Glover 17-S-2249 CLEARED For Open Publication Aug 18, 2017 Department of Defense...OFFICE OF PREPUBLICATION AND SECURITY REVIEW These are the final briefing slides as approved by the Defense Business Board in the public meeting held

Characteristics of Watermelon Mosaic Virus Transmission Occurring in Korean Ginseng

Directory of Open Access Journals (Sweden)

Seung-Kook Choi

2014-09-01

Full Text Available Korean ginseng (Panax ginseng is the most popular herb for medical purpose in Korea. Recently, viral diseases from Korean ginseng showing various degrees of severe mottling, variegation and mosaic symptoms have caused quantity losses of Korean ginseng in a large number of farms. Watermelon mosaic virus (named WMVgin was identified as a causal agent for the disease of Korean ginseng. Interestingly, WMV-gin failed to infect both Korean ginseng plant and susceptible host species including cucurbitaceous plants by mechanical inoculation. However, WMV-gin could successfully infect Korean ginseng by transmission of two aphid species (Myzus persicae and Aphis gossypii. It is likely that transmission of WMV-gin was done by both the aphid species during feeding behavior of the two aphid species on Korean ginseng, though the aphids dislike feeding in Korea ginseng. Similarly, a strain of WMV (WMV-wm isolated from watermelon was transmitted successfully to Korean ginseng plant by the two aphid species, but not by mechanical inoculations. Transmission assays using M. persicae and A. gossypii clearly showed both WMV-gin and WMV-wm were not transmitted from infected Korean ginseng plant to cucurbit species that are good host species for WMV. These results suggest WMV disease occurring in Korean ginseng plant can be controlled by ecological approaches.

Determination of Selenium Toxicity for Survival and Reproduction of Enchytraeid Worms in a Sandy Loam Soil

Science.gov (United States)

2016-07-01

LOAM SOIL ECBC-TR-1388 Roman G. Kuperman Ronald T. Checkai Michael Simini Carlton T. Phillips RESEARCH AND TECHNOLOGY DIRECTORATE Richard M...plastic wrap was stretched over the top of each container and secured with a rubber band. Three pinholes were made in the plastic wrap to 6...172–178. Glover, J.; Levander, O.; Parizek, J.; Vouk, V. Selenium. In Handbook on the Toxicology of Metals; Friberg, L., Norberg, G.F., Vouk, V.B

REVIEW: EXPLORERS AND SCIENTISTS IN CHINA'S BORDERLANDS

OpenAIRE

Gregory Rohlf

2013-01-01

Review of: Denise M Glover, Stevan Harrel, Charles F McKhann, and Margaret Byrne Swain (eds). 2011. Explorers and Scientists in China's Borderlands, 1880-1950. Seattle: University of Washington Press. This collection of eight biographical essays from a 2007 symposium makes for engaging reading and holds together well as a book. The authors, mainly anthropologists, examine the lives of ten explorers who were active primarily in the first half of the twentieth century. Some worked for d...

Microstructural Characterization of HSLA-100 GMA-Weldments

Science.gov (United States)

1987-09-01

Intermeiate Oxygen Regime ----------- 66 D.) Schematic CCT Diagram - --------------- 66 9 ACKNOWLEDGEMENTS I wish to express my appreciation to my thesis...have been observed in this research [review Figures 31 (a), (b) and 35 (a)]. Figure 38 (d) shows a schematic CCT diagram reported by Glover (Ref. 5) and...Regime B.) High Ox. gen Regime C. )Interme late Oxygen Regime D.1 Schematic CCT Diagram 66 LIST OF REFERENCES 1. Anderson, T.L., Hyatt J A West, J.C

Food Composition of the Snake-Eyed Lizard, Ophisops elegans Ménétriés, 1832 (Reptilia: Sauria: Lacertidae from Gökçeada (Imbros, Turkey

Directory of Open Access Journals (Sweden)

Cemal Varol Tok

2016-06-01

Full Text Available The study presents data on the food composition of the snake-eyed lizard (Ophisops elegans, from Gökçeada (Imbros, Çanakkale, Turkey. A total of 94 preys were determined in thedigestive systems of 20 individuals (10 males, 10 females examined in the study. Insects (67%constitute most of its food composition. Major prey groups in the food composition are included inAranea (13%, Lepidoptera (13%, Coleoptera (19%, and Homoptera (20% in numeric proportion.No significant difference was observed between sexes considering food composition.

Use of preserved museum fish to evaluate historical and current mercury contamination in fish from two rivers in Oklahoma, USA.

Science.gov (United States)

Hill, J Jaron; Chumchal, Matthew M; Drenner, Ray W; Pinder, John E; Drenner, S Matthew

2010-02-01

We examined the effects of a commonly used preservation technique on mercury concentration in fish tissue. After fixing fish muscle tissue in formalin followed by preservation in isopropanol, we found that mercury concentration in fish muscle tissue increased by 18%, reaching an asymptote after 40 days. We used formalin-isopropanol-preserved longear sunfish (Lepomis megalotis) from the Sam Noble Oklahoma Museum of Natural History to examine historical changes and predict current mercury concentrations in fish from two rivers in southeastern Oklahoma. Glover River was free-flowing, while Mountain Fork River was impounded in 1970 and a coldwater trout fishery was established upstream from the collection site in 1989. Mercury concentrations in longear sunfish from Glover River showed no historical changes from 1963 to 2001. Mercury concentrations in longear sunfish from Mountain Fork River showed no change from 1925 to 1993 but declined significantly from 1993 to 2003. We also compared mercury concentrations of the most recently collected longear sunfish in the museum to mercury concentrations of unpreserved fish collected from the rivers in 2006. Concentrations of mercury in museum fish were not significantly different from mercury concentrations in unpreserved fish we collected from the rivers. Our study indicates that preserved museum fish specimens can be used to evaluate historical changes and predict current levels of mercury contamination in fish.

Parameters for the Evaluation of the Fate, Transport, and Environmental Impacts of Chemical Agents in Marine Environments

Science.gov (United States)

2007-07-01

Anal. Bering/Chukchi, accessed 3 January 2007, http://www.osdpd.noaa.gov/PSB/EPS/SST/data/beringst.c.gif. RE-2 15 Brewer , P. G.; Glover, D. M...Highly Purified Mustard Gas and its Action on Yeast , ” J. Am. Chem. Soc., 1947, 69(7), 1808-1809. 135 Redemann, C. E.; Chaikin, S. W.; Fearing, R. B...171 MacNaughton, M. G.; Brewer , J. H., Environmental Chemistry and Fate of Chemical Warfare Agents, Southwest Research Institute, San Antonio TX, 1994

PHYCAA: Data-driven measurement and removal of physiological noise in BOLD fMRI

DEFF Research Database (Denmark)

Churchill, Nathan W.; Yourganov, Grigori; Spring, Robyn

2012-01-01

, autocorrelated physiological noise sources with reproducible spatial structure, using an adaptation of Canonical Correlation Analysis performed in a split-half resampling framework. The technique is able to identify physiological effects with vascular-linked spatial structure, and an intrinsic dimensionality...... with physiological noise, and real data-driven model prediction and reproducibility, for both block and event-related task designs. This is demonstrated compared to no physiological noise correction, and to the widely used RETROICOR (Glover et al., 2000) physiological denoising algorithm, which uses externally...

NPS Adds Another Astronaut Alumnus With NASA’s Newest Class

OpenAIRE

Kuska, Dale M.

2013-01-01

Article taken from the NPS website: http://www.nps.edu/About/News/NPS-Adds-Another-Astronaut-Alumnus-With-NASAs-Newest-Class.html When NASA Administrator Charles Bolden announced the latest class of NASA’s eight astronaut candidates, June 17, the Naval Postgraduate School (NPS) was able to add yet another space-traveling alumnus to its ranks, now totaling 41 and counting. Lt. Cmdr. Victor Glover, an F/A-18 combat pilot currently serving as a Legislative Fellow in the office of Senat...

The genome sequence of pepper vein yellows virus (family Luteoviridae, genus Polerovirus)

OpenAIRE

Murakami, Ritsuko; Nakashima, Nobuhiko; Hinomoto, Norihide; Kawano, Shinji; Toyosato, Tetsuya

2011-01-01

The complete genome of pepper vein yellows virus (PeVYV) was sequenced using random amplification of RNA samples isolated from vector insects (Aphis gossypii) that had been given access to PeVYV-infected plants. The PeVYV genome consisted of 6244 nucleotides and had a genomic organization characteristic of members of the genus Polerovirus. PeVYV had highest amino acid sequence identities in ORF0 to ORF3 (75.9 - 91.9%) with tobacco vein distorting polerovirus, with which it was only 25.1% iden...

Assessing the effects of cultivating genetically modified glyphosate-tolerant varieties of soybeans (Glycine max (L.) Merr.) on populations of field arthropods.

Science.gov (United States)

Imura, Osamu; Shi, Kun; Iimura, Keiji; Takamizo, Tadashi

2010-01-01

We assessed the effects of cultivating two genetically modified (GM) glyphosate-tolerant soybean varieties (Glycine max (L.) Merr.) derived from Event 40-3-2 and a Japanese conventional variety on arthropods under field conditions, with weed control using glyphosate and conventional weed control for two years. Plant height and dry weight of the conventional variety were significantly larger than those of the GM varieties, but the GM varieties bore more pods than the conventional variety. We found arthropods of nine taxonomic orders (Araneae, Acari, Thysanoptera, Homoptera, Heteroptera, Coleoptera, Diptera, Lepidoptera, and Hymenoptera) on the plants. The arthropod incidence (number per plant unit weight pooled for each taxonomic order) on the soybean stems and leaves generally did not differ significantly between the GM and conventional varieties. However, the incidence of Thysanoptera and total incidence (all orders combined) were greater on the GM variety in the second year. The weed control regimes had no significant influence on the arthropod incidence on the soybean stems and leaves. The number of flower-inhabiting Thysanoptera (the dominant arthropod in the flowers) was not significantly different between the GM and conventional varieties. Asphondylia yushimai (Diptera, Cecidomyiidae) was more numerous on the pods of the GM variety in both years. Neither the soybean variety nor the weed control regime significantly affected the density of soil macro-organisms. However, the glyphosate weed control affected arthropods between the rows of plants by decreasing the abundances of Homoptera, Heteroptera, Coleoptera and Lepidoptera, and diversity of arthropods. © ISBR, EDP Sciences, 2011.

Incidence and epidemiology of Citrus tristeza virus in the Valencian community of Spain.

Science.gov (United States)

Cambra, M; Gorris, M T; Marroquín, C; Román, M P; Olmos, A; Martínez, M C; de Mendoza, A H; López, A; Navarro, L

2000-11-01

The first outbreak of citrus tristeza disease in Spain caused by Citrus tristeza virus (CTV) was recorded in 1957 in the Valencian Community (VC). In total c. 40 million trees, mainly of sweet orange and mandarin grafted on sour orange rootstocks, declined due to CTV. Large-scale surveys in different municipalities of the VC indicated that the disease spread very fast. Incidence increased from 11% in 1989 to 53% in 1998. Toxoptera aurantii and Aphis spiraecola (inefficient aphid vectors of CTV) predominated before 1985-87. Since then the relatively efficient vector Aphis gossypii has become dominant and induced an epidemic that has been modelled. The large number of A.gossypii that visited each clementine tree (estimated to exceed 97000 per year) explained the difference between the temporal pattern of spread of CTV in clementine which followed the Gompertz model and that in sweet orange (logistic model). The susceptibility of the different citrus species to CTV infection by aphids seems to depend on the number of young, succulent shoots produced. The epidemiological data allowed specific recommendations to be made to growers in order to facilitate a change to a modern citrus industry based on the use of selected varieties grafted on tristeza-tolerant rootstocks produced within a certification scheme. This has been done already in almost 90% of the VC citrus-growing area. The tristeza problem has been solved unless more aggressive isolates are introduced and become prevalent.

Familial predictors of childhood shyness: a study of the United Arab Emirates population.

Science.gov (United States)

Eapen, V; Ghubash, R; Salem, M O; Sabri, S

2005-01-01

Phobic anxiety disorders generally breed true. In this regard, family studies have suggested an association between childhood shyness and maternal social phobia. In this study, the relationship between childhood shyness and maternal social anxiety was examined. 203 5-year-old children from an Arabian Gulf community and their mothers were evaluated. The children were assessed in stage 1 using the shyness scale of Stevenson-Hinde and Glover and the Preschool Behavior Checklist (PBCL), while mothers completed the Liebowitz Social Anxiety Scale. In the second stage, blind clinical interviews were carried out to ascertain the diagnosis of psychiatric diagnoses, if any, using DSM-IV criteria. 27% of the children were identified as shy using the shyness scale of Stevenson-Hinde and Glover and 19% scored above the cutoff for behavioral disturbance on the PBCL. Child shyness was associated with female gender and maternal social anxiety as indicated by scores on the Liebowitz Social Anxiety Scale, while an inverse relationship was noted with behavioral disturbance. The odds of the child having a high shyness score was increased if the mother had social anxiety (odds ratio = 2.14) and the child lived in a family that was 'not socially active' (odds ratio = 1.42). Our initial findings suggest that there may be a complex interaction between maternal social anxiety and family sociability in childhood shyness. Prospective longitudinal work is indicated. Copyright 2005 S. Karger AG, Basel.

Biological and behavior aspects of Chrysoperla externa (Hagen, 1861 on cotton plantsAspectos biológicos e comportamentais de Chrysoperla externa (Hagen, 1861 em algodoeiro

Directory of Open Access Journals (Sweden)

Luciano Pacelli Medeiros Macedo

2010-02-01

Full Text Available It was aimed to study biological and behavior aspects of larvae and adults of Chrysoperla externa in greenhouse, on cotton plants. Recently hatched larvae were released on the upper third of cotton plants, which were previously infested with Aphis gossypii,. After emergence, adults were separated by sex and packed in cylindrical PVC recipients with cotton plant. We evaluated the duration of each larval, pre-pupal and pupal periods, pre-oviposition, oviposition, effective oviposition and post-oviposition periods, male and female logevity, daily and total oviposition capacity. The behavior of pupal stage was also evaluated, which released three larvae of the 3rd instar per cotton plant and they were put on the lower, medium and upper sections. As treatments, it was used naked soil, dried leaves from cotton plant, crushed rock nº 1; and crushed rock nº 1 + dried leaves. Larvae from different instars were released on the upper section of the cotton plants infested with A. gossypii to verify the search timing that marked the period the prey was exposed to the predator. C. externa larvae passed through all the phases of their biological cycle and there was no significant influence on the type of the soil covering used on pupal stage, since all of them were significantly higher on naked soil. There was no significative difference on the prey search by C. externa larvae.Objetivou-se estudar aspectos biológicos e comportamentais de larvas e adultos de Chrysoperla externa em casa-de-vegetação, em plantas de algodão. Larvas recém eclodidas foram liberadas no terço superior de plantas de algodão previamente infestadas com Aphis gossypii, onde permaneceram até a pupação. Após a emergência, adultos foram separados por sexo, acondicionados em recipientes cilíndricos de PVC contendo uma planta de algodoeiro. Avaliaram-se a duração de cada ínstar, dos períodos larval, pré-pupal e pupal, dos períodos de pré-oviposição, oviposi

[An unpublished contribution of Melanie Klein "On Reassurance"].

Science.gov (United States)

Frank, Claudia; Klein, Melanie

2005-01-01

Melanie Klein's unpublished paper on reassurance is presented in German translation. The author shows that it was a contribution to Glover's investigation on psychoanalytic technique in the 1930s. The paper is discussed against the background of the technical discussions conducted in London at that time (e. g. M. Schmideberg, J. Strachey) and of Klein's relevant publications. Although Klein consistently considered "correct" interpretation to be the most effective means of reassurance, she occasionally also accepted a non-interpreting approach. In this respect the paper presented here goes further than any other of her writings.

Whitefly Pest Species (Homoptera: Aleyrodidae) on Citrus Trees

OpenAIRE

Katja Žanić; Sonja Kačić; Miro Katalinić

2000-01-01

Today, the Citrus whitefly, Dialeurodes citri (Ashmead), is a very important pest on all Citrus species throughout the citrus growing areas in Croatia. It causes direct damage by sucking the plant juice from the leaves. Furthermore, immatures excrete honeydew that stimulates sooy mold. The presence of sooty mold on contaminated leaves interferes with the photosynthesis of plants. Citrus fruits coated by sooty mold lose its market value. Because Dialeurodes citri is poorly known in Croatia, th...

Comparative cytogenetics of Auchenorrhyncha (Hemiptera, Homoptera): a review

Science.gov (United States)

Kuznetsova, Valentina; Aguin-Pombo, Dora

2015-01-01

Abstract A comprehensive review of cytogenetic features is provided for the large hemipteran suborder Auchenorrhyncha, which currently contains approximately 42,000 valid species. This review is based on the analysis of 819 species, 483 genera, and 31 families representing all presently recognized Auchenorrhyncha superfamilies, e.i. Cicadoidea (cicadas), Cercopoidea (spittle bugs), Membracoidea (leafhoppers and treehoppers), Myerslopioidea (ground-dwelling leafhoppers), and Fulgoroidea (planthoppers). History and present status of chromosome studies are described, as well as the structure of chromosomes, chromosome counts, trends and mechanisms of evolution of karyotypes and sex determining systems, their variation at different taxonomic levels and most characteristic (modal) states, occurrence of parthenogenesis, polyploidy, B-chromosomes and chromosome rearrangements, and methods used for cytogenetic analysis of Auchenorrhyncha. PMID:26807037

Etude morphologique et biologique de la coccinelle Scymnus couturieri Chazeau (Coleoptera-Coccinellidae prédatrice de la cochenille farineuse du manioc Phenacoccus manihoti Matile-Ferrero

Directory of Open Access Journals (Sweden)

Obame Minko, D.

1999-01-01

Full Text Available Morphological and Biological Study of Scymnus couturieri Chazeau (Coleoptera-Coccinellidae, Predator of Cassava Mealybug Phenacoccus manihoti Matile-Ferrero (Homoptera-Pseudococcidae in Ivory Coast. Scymnus couturieri is a coccinellidae which was first described from Ivory Coast (2. But that morphological description was just based on the adult. The trophic action developed by Scymnus couturieri in the regulation of the abundance of the cassava mealybug led us to precise that description and to extend our knowledge of the coccinellidae by studying the morphological aspects and the biological parameters. The study brings to the fore the holometaboly development, the low fecondity and the long-lasting biological cycle of the predator.

Comparison of exclusion and imidacloprid for reduction of oviposition damage to young trees by periodical cicadas (Hemiptera: Cicadidae).

Science.gov (United States)

Ahern, Robert G; Frank, Steven D; Raupp, Michael J

2005-12-01

Insecticides are traditionally used to control periodical cicadas (Homoptera: Cicadidae) and to reduce associated injury caused by oviposition. However, research has shown that conventional insecticides have low or variable season-long efficacy in reducing injury caused by cicadas. New systemic neonicotinoid insecticides provide excellent levels of control against a variety of sucking insects. We compared the efficacy of a neonicotinoid insecticide, imidacloprid, and a nonchemical control measure, netting, to reduce cicada injury. Netted trees sustained very little injury, whereas unprotected trees were heavily damaged. Fewer eggnests, scars, and flags were observed on trees treated with imidacloprid compared with unprotected trees; however, the hatching of cicada eggs was unaffected by imidacloprid.

Inheritance of resistance to Colletotrichum gossypii var. cephalosporioides in cotton

Directory of Open Access Journals (Sweden)

Mansuêmia Alves Couto de Oliveira

2010-01-01

Full Text Available The objective of this study was to analyze the inheritance of the resistance to cotton ramulosis. For thispurpose, two groups of lines with contrasting performance for the evaluated trait were crossed. The disease-susceptibleparents were Delta Opal, CNPA 999 and CNPA 2161, and those with resistance BRS Facual, CNPA 2043 and CNPA 2984,resulting in nine crosses, always of one resistant and one susceptible parent, totalizing 42 treatments. The experiment was setup in a randomized complete block design with three replications. It was verified that the genetic control of ramulosisresistance is predominantly oligogenic, and the number of genes involved depends on the parents that participate in eachcross, due to the possibility of differential loci fixation. Evidence of partial dominance in the sense of increasing diseaseresistance was found, but there were also indications that dominance is not unidirectional.

Ocorrência de afídeos causando danos em mangueira (Mangifera indica L., no Vale do São Francisco

Directory of Open Access Journals (Sweden)

FERREIRA RACHEL GONÇALVES

2002-01-01

Full Text Available Observaram-se em pomares de mangueiras (Mangifera indica L., no semi-árido nordestino, altas infestações de afídeos causando danos às folhas novas e brotações da planta. Diversas amostras foram coletadas, tendo sido identificadas três espécies: Aphis craccivora, Aphis gossypii e Toxoptera aurantii. As duas primeiras espécies estão sendo relatadas pela primeira vez como pragas, em mangueiras, no Brasil. Espécimens de referência encontram-se depositados no Laboratório de Entomologia da Embrapa Semi-Árido, localizada em Petrolina-PE.

Metaheuristics progress as real problem solvers

CERN Document Server

Nonobe, Koji; Yagiura, Mutsunori

2005-01-01

Metaheuristics: Progress as Real Problem Solvers is a peer-reviewed volume of eighteen current, cutting-edge papers by leading researchers in the field. Included are an invited paper by F. Glover and G. Kochenberger, which discusses the concept of Metaheuristic agent processes, and a tutorial paper by M.G.C. Resende and C.C. Ribeiro discussing GRASP with path-relinking. Other papers discuss problem-solving approaches to timetabling, automated planograms, elevators, space allocation, shift design, cutting stock, flexible shop scheduling, colorectal cancer and cartography. A final group of methodology papers clarify various aspects of Metaheuristics from the computational view point.

7th February 2011 - Scottish Cabinet Secretary for Education and Lifelong Learning M. Russell MSP signing the guest book with Beams Department Head P. Collier and Adviser J. Ellis

CERN Multimedia

Maximilien Brice

2011-01-01

01-17:Scottish Cabinet Secretary for Education and Lifelong Learning M. Russell MSP signing the guest book with Beams Department Head P. Collier and Adviser J. Ellis 18-22: Teachers and Pupils signing the guest book 23-27: visiting the CERN control centre with P. Collier 28-32: visiting the LHCb underground area 33-74: visitng the ATLAS underground area Other members of the delegation: Chief Scientific Adviser to the Scottish Government and Chair in Molecular and Cell Biology at the University of Aberdeen A. Glover; Assistant Private Secretary M. Gallagher; Associate Director Institute for Gravitational Research, University of Glasgow J.Hough.

Insect symbiosis: derivation of yeast-like endosymbionts within an entomopathogenic filamentous lineage.

Science.gov (United States)

Suh, S O; Noda, H; Blackwell, M

2001-06-01

Yeast-like endosymbionts (YLSs) of insects often are restricted to specific hosts and are essential to the host's survival. For example, in planthoppers (Homoptera: Delphacidae), endosymbionts function in sterol utilization and nitrogen recycling for the hosts. Our study, designed to investigate evolutionary changes in the YLS lineage involved in the planthopper association, strongly suggests an origin of the YLSs from within the filamentous ascomycetes (Euascomycetes), not the true yeasts (Saccharomycetes), as their morphology might indicate. During divergence of the planthopper YLSs, dramatic changes would have occurred in the insect-fungus interaction and the fungal morphology that have previously been undescribed in filamentous ascomycetes. Phylogenetic trees were based on individual and combined data sets of 2.6 kb of the nuclear small- and large-subunit ribosomal RNA genes for YLSs from three rice planthoppers (Laodelphax striatellus, Nilaparvata lugens, and Sogatella furcifera) compared with 56 other fungi. Parsimony analysis placed the planthopper YLSs within Cordyceps (Euascomycetes: Hypocreales: Clavicipitaceae), a genus of filamentous insects and a few fungal pathogenic ascomycetes. Another YLS species restricted to the aphid Hamiltonaphis styraci (Homoptera: Aphididae) was a sister taxon to the planthopper YLSS: Filamentous insect pathogens (Metarhizium and Beauveria) specific to the same species of insect hosts as the YLSs also formed lineages within the Clavicipitaceae, but these were distinct from the clade comprising YLS species. Trees constrained to include the YLSs in families of the Hypocreales other than the Clavicipitaceae were rejected by the Kishino-Hasegawa test. In addition, the results of this study support a hypothesis of two independent origins of insect-associated YLSs from among filamentous ascomycetes: the planthopper YLSs in the Clavicipitaceae and the YLSs associated with anobiid beetles (Symbiotaphrina species). Several lineages of

Entomopathogenic fungi from 'El Eden' Ecological Reserve, Quintana Roo, Mexico.

Science.gov (United States)

Torres-Barragán; Anaya, Ana Luisa; Alatorre, Raquel; Toriello, Conchita

2004-07-01

Entomopathogenic fungi were isolated and identified from insects collected from the tropical forest and an agricultural area at El Eden Ecological Reserve, Quintana Roo, Mexico. These fungi were studied to determine their potential as biological control agents of greenhouse Trialeurodes vaporariorum (Homoptera: Aleyrodidae), and to contribute to the knowledge of biodiversity of this area. No pest insects were observed in the tropical forest. In contrast, all insects collected in the agricultural area were considered important pests by the local farmers, with the whitefly, as the most relevant, plentiful in Cucurbitaceae plants. From approximately 3400 collected insects in three different surveys, different anamorphic Ascomycetes were recovered. One isolate of Aspergillus sp., two of Penicillium sp., three of Paecilomyces marquandii, and three of Verticillium sp. out of 308 insects (2.9%) from three insect orders, Hymenoptera, Diptera and Isoptera in the tropical forest. In contrast, a higher number of fungal isolates were recovered from the agricultural area: three isolates from Aspergillus parasiticus, 100 of Fusarium moniliforme, one of Aschersonia sp., and 246 of Fusarium oxysporum out of 3100 insects (11.3%) from three insect orders, Homoptera, Coleoptera and Lepidoptera. The results of this study show Fusarium moniliforme and F oxysporum as highly virulent to infected insects in the agricultural area, with 100 and 246 isolates respectively, out of 350 infected insects of 3100 studied specimens. Laboratory whitefly nymph bioassays with isolates Ed29a of F. moniliforme, Ed322 of F. oxysporum, and Ed22 of P marquandii showed 96 to 97.5% insect mortality with no significant differences (P < 0.05) among them. F. oxysporum Ed322 produced no mortality when inoculated on tomato, bean, squash and maize seedlings (with and without injuries) compared to the 100% mortality caused by phytopathogenic strains, F. oxysporum f. sp. lycopersici and F. oxysporum f. sp. radicis

Biological control of fruit flies (Diptera: Tephritidae) through parasitoid augmentative releases: Current status

International Nuclear Information System (INIS)

Montoya, Pablo; Liedo, Pablo

2000-01-01

Fruit flies are among the main pests affecting the world fruit industry (Aluja 1993). Bait sprays have traditionally been used successfully to control them; however, the side effects on the environment and health hazards commonly associated with pesticides, have resulted in strong public opposition to the use of bait sprays. This is particularly so when sprays are applied in urban areas or in coffee plantations where, although Medflies are present, they do not pose a danger to crops. Alternative methods that are effective and environmental friendly to suppress fruit fly populations are highly desirable. Biological control, the use of natural enemies to suppress pest populations, represents such an alternative. Some of the most successful cases of biological control are the control of Iceria purchasi Maskell (Homoptera: Margarodidae) by Rodolia cardinalis Mulsant (Coleoptera: Coccinellidae) in California (De Bach 1968, van den Bosch et al. 1982), and the control of Aleurocanthus woglumi Ashby (Homoptera: Aleyrodidae) mainly by Encarsia (=Prospaltella) opulenta Silv. (Hymenoptera: Aphelinidae) in Mexico (Jimenez 1961, 1971), both using the classical approach. However, this approach has been limited to certain conditions of environmental stability and biodiversity which are only found in a few ecosystems. Other factors, such as types of pests, the economic threshold and product quality requirements represent additional limitations. The best option in many cases could be augmentative biological control, which could overcome some of the deficiencies of the classical approach (Sivinski 1996). According to Knipling (1992) and Barclay (1987), augmentative biological control can be considered as a formal alternative for suppressing pest populations and even for use in eradication programmes, after integration with the sterile insect technique (SIT). In this approach, mass production of natural enemies is required and this production has to be cost effective

The tri-trophic interactions hypothesis: interactive effects of host plant quality, diet breadth and natural enemies on herbivores.

Directory of Open Access Journals (Sweden)

Kailen A Mooney

Full Text Available Several influential hypotheses in plant-herbivore and herbivore-predator interactions consider the interactive effects of plant quality, herbivore diet breadth, and predation on herbivore performance. Yet individually and collectively, these hypotheses fail to address the simultaneous influence of all three factors. Here we review existing hypotheses, and propose the tri-trophic interactions (TTI hypothesis to consolidate and integrate their predictions. The TTI hypothesis predicts that dietary specialist herbivores (as compared to generalists should escape predators and be competitively dominant due to faster growth rates, and that such differences should be greater on low quality (as compared to high quality host plants. To provide a preliminary test of these predictions, we conducted an empirical study comparing the effects of plant (Baccharis salicifolia quality and predators between a specialist (Uroleucon macolai and a generalist (Aphis gossypii aphid herbivore. Consistent with predictions, these three factors interactively determine herbivore performance in ways not addressed by existing hypotheses. Compared to the specialist, the generalist was less fecund, competitively inferior, and more sensitive to low plant quality. Correspondingly, predator effects were contingent upon plant quality only for the generalist. Contrary to predictions, predator effects were weaker for the generalist and on low-quality plants, likely due to density-dependent benefits provided to the generalist by mutualist ants. Because the TTI hypothesis predicts the superior performance of specialists, mutualist ants may be critical to A. gossypii persistence under competition from U. macolai. In summary, the integrative nature of the TTI hypothesis offers novel insight into the determinants of plant-herbivore and herbivore-predator interactions and the coexistence of specialist and generalist herbivores.

Distributional patterns and possible origin of leafhoppers (Homoptera, Cicadellidae

Directory of Open Access Journals (Sweden)

Mervin W. Nielson

2000-03-01

Full Text Available The zoogeographical distribution of 42 cicadellid subfamilies and their assigned tribes and genera is compiled with distributional maps and proposed dispersal pathways of genera that are shared interzoogeographically. Possible origin of the subfamilies and tribes is proposed in an ancestral context from which the more modern extant groups evolved whereas origin of genera is in a more modern context. Notwithstanding their complex biogeography, the distributional data of the higher groups indicate that all of the cosmopolitan and near cosmopolitan subfamilies arose during early Cretaceous or possibly the late Jurassic period (140-116 m.y.a. when continental drift was in its early stages. Nearly all of the New World and some Old World subfamilies are considered of more recent origin (late Cretaceous-Tertiary. Ninety percent of the known genera (2,126 are endemic to their respective zoogeographical region and subregion, thus indicating relatively high host specificity and low rate of dispersal. The majority (76% of known extant genera are pantropical in origin, suggesting early or possible Gondwanaland origin of their ancestors. Dispersal pathways of genera shared by more than one zoogeographical region were generally south to north (Neotropical/Nearctic, Oriental/Palaearctic or west to east (Palaearctic/Nearctic, Oriental/Australian, from regions of high diversity to regions of low diversity and from warmer climates to cooler climates. The most diverse and richest leafhopper fauna are present in the Neotropical and Ethiopian regions although taxal affinities between them are poorest. The most depauperate fauna are in the Nearctic region and in Australia, reflecting the impact of isolating and ecological factors on distribution and radiation. Ecological barriers were more evident between the Ethiopian and Oriental fauna than between any other zoogeographical combination. Taxal affinities appeared to be correlated with close continental proximities. Vicariance (physical was the principal event that appealed to explain the distribution of many subfamilies and tribes whereas dispersal accounted for distribution of the majority of interzoogeographical genera.

Appearance of Neotoxoptera formosana (Homoptera: Aphididae) in The Netherlands

NARCIS (Netherlands)

Piron, P.G.M.

2010-01-01

Neotoxoptera formosana (Takahashi) is a pest of wild and cultivated Allium species, but never iwht disastrous consequences. In 1984, N. formosana was found in France. This was the first finding in Europe. Since then, N. formosana has been observed also in other European countries. The first record

Calling songs of some South African cicadas (Homoptera: Cicadidae)

African Journals Online (AJOL)

1987-07-13

Jul 13, 1987 ... Figure 11 Posture of male cicadas during calling song, illustrated by a specimen ... parameters of the smaller samples falls within that of the largest conspecific ... under the control of the neuromuscular system (Pringle. 1954b).

Migration, trapping and local dynamics of whiteflies (Homoptera: Aleyrodidae)

DEFF Research Database (Denmark)

Riis, Lisbeth; Nachman, Gösta

2006-01-01

to population growth. 4 A model for changes in whitefly density during an entire bean (Phaseolus vulgaris L.) crop cycle, including an immigration parameter, was also developed. 5 Non-attractant window traps surrounding an annual field crop were assumed to intercept whiteflies immigrating into and emigrating...

Aspects of the ecology of spittlebugs (Homoptera: Cercopidae) in ...

African Journals Online (AJOL)

Species type and pattern of distribution of spittlebugs was studied from 6th March to 15th December 2009 within the University of Nigeria, Nsukka campus. Three spittlebug species namely, Deois flavopicta, Aphrophora saratogensis and Philaenus spumarius were identified within the University campus. Whereas A.

PRODUCT NEEM AZAL T/S - BROAD-SPECTRUM PHYPOPESTICIDE FOR CONTROL OF PESTS ON VEGETABLE CROPS

Directory of Open Access Journals (Sweden)

Vinelina Yankova

2016-09-01

Full Text Available Experiments for determination of the effectiveness of product Neem Azal T/S (a. i. azadirachtin were conducted at a concentration of 0,3% against some major pests in vegetable crops grown in greenhouses at the Maritsa Vegetable Crops research Institute, Plovdiv during the period 2010-2016. It was established very good insecticidal and acaricidal action of phytopesticide against: cotton aphid (Aphis gossypii Glov.; green peach aphid (Myzus persicae Sulz.; western flower trips (Frankliniella occidentalis Perg.; cotton bollworm (Helicoverpa armigera Hubn.; tomato borer (Tuta absoluta Meyrick and two-spotted spider mite (Tetranichus urticae Koch.. This product is a successful alternative to using chemical insecticides and acaricides.

Diet reconstruction and resource partitioning of a Caribbean marine mesopredator using stable isotope bayesian modelling.

Directory of Open Access Journals (Sweden)

Alexander Tilley

Full Text Available The trophic ecology of epibenthic mesopredators is not well understood in terms of prey partitioning with sympatric elasmobranchs or their effects on prey communities, yet the importance of omnivores in community trophic dynamics is being increasingly realised. This study used stable isotope analysis of (15N and (13C to model diet composition of wild southern stingrays Dasyatis americana and compare trophic niche space to nurse sharks Ginglymostoma cirratum and Caribbean reef sharks Carcharhinus perezi on Glovers Reef Atoll, Belize. Bayesian stable isotope mixing models were used to investigate prey choice as well as viable Diet-Tissue Discrimination Factors for use with stingrays. Stingray δ(15N values showed the greatest variation and a positive relationship with size, with an isotopic niche width approximately twice that of sympatric species. Shark species exhibited comparatively restricted δ(15N values and greater δ(13C variation, with very little overlap of stingray niche space. Mixing models suggest bivalves and annelids are proportionally more important prey in the stingray diet than crustaceans and teleosts at Glovers Reef, in contrast to all but one published diet study using stomach contents from other locations. Incorporating gut contents information from the literature, we suggest diet-tissue discrimination factors values of Δ(15N ≈ 2.7‰ and Δ(13C ≈ 0.9‰ for stingrays in the absence of validation experiments. The wide trophic niche and lower trophic level exhibited by stingrays compared to sympatric sharks supports their putative role as important base stabilisers in benthic systems, with the potential to absorb trophic perturbations through numerous opportunistic prey interactions.

Diet reconstruction and resource partitioning of a Caribbean marine mesopredator using stable isotope bayesian modelling.

Science.gov (United States)

Tilley, Alexander; López-Angarita, Juliana; Turner, John R

2013-01-01

The trophic ecology of epibenthic mesopredators is not well understood in terms of prey partitioning with sympatric elasmobranchs or their effects on prey communities, yet the importance of omnivores in community trophic dynamics is being increasingly realised. This study used stable isotope analysis of (15)N and (13)C to model diet composition of wild southern stingrays Dasyatis americana and compare trophic niche space to nurse sharks Ginglymostoma cirratum and Caribbean reef sharks Carcharhinus perezi on Glovers Reef Atoll, Belize. Bayesian stable isotope mixing models were used to investigate prey choice as well as viable Diet-Tissue Discrimination Factors for use with stingrays. Stingray δ(15)N values showed the greatest variation and a positive relationship with size, with an isotopic niche width approximately twice that of sympatric species. Shark species exhibited comparatively restricted δ(15)N values and greater δ(13)C variation, with very little overlap of stingray niche space. Mixing models suggest bivalves and annelids are proportionally more important prey in the stingray diet than crustaceans and teleosts at Glovers Reef, in contrast to all but one published diet study using stomach contents from other locations. Incorporating gut contents information from the literature, we suggest diet-tissue discrimination factors values of Δ(15)N ≈ 2.7‰ and Δ(13)C ≈ 0.9‰ for stingrays in the absence of validation experiments. The wide trophic niche and lower trophic level exhibited by stingrays compared to sympatric sharks supports their putative role as important base stabilisers in benthic systems, with the potential to absorb trophic perturbations through numerous opportunistic prey interactions.

The strange rays of Professor Roentgen

International Nuclear Information System (INIS)

Guinier, A.

1995-01-01

This paper relates the historical discovery of X radiations in 1895 by the German Physicist Wilhelm Conrad Roendgen in his laboratory of Wurzburg University. Independently of Roendgen, several physicists such as Charles Glover Barkla, Jean Perrin or Max von Laue have tried to determine the nature of X rays. In 1912, in Cambridge (UK) William Henry and William Lawrence Bragg have used the X-ray diffraction property, discovered by Laue's team, to explore the atomic structure of crystals. The recent development of computers technology has considerably increased the automation of data collection and the analysis of complex diffraction diagrams. (J.S.). 3 refs., 3 photos

The strange rays of Professor Roentgen; Les etranges rayons du Professeur Roentgen

Energy Technology Data Exchange (ETDEWEB)

Guinier, A. [Paris-11 Univ., 91 - Orsay (France)

1995-12-31

This paper relates the historical discovery of X radiations in 1895 by the German Physicist Wilhelm Conrad Roendgen in his laboratory of Wurzburg University. Independently of Roendgen, several physicists such as Charles Glover Barkla, Jean Perrin or Max von Laue have tried to determine the nature of X rays. In 1912, in Cambridge (UK) William Henry and William Lawrence Bragg have used the X-ray diffraction property, discovered by Laue`s team, to explore the atomic structure of crystals. The recent development of computers technology has considerably increased the automation of data collection and the analysis of complex diffraction diagrams. (J.S.). 3 refs., 3 photos.

EPIDEMIOLOGICAL ASPECTS OF COTTON RAMULOSIS (Colletotrichum gossypii SOUTH. Var. cephalosporioides COSTA ASPECTOS EPIDEMIOLÓGICOS DA RAMULOSE (Colletotrichum gossypii South. var. cephalosporioides Costa DO ALGODOEIRO (Gossypium hirsutum L.

Directory of Open Access Journals (Sweden)

Fuad Calil

2007-09-01

Full Text Available

These experiments deal with the effects of outbreak of early, medium and late developing ramulosis on the IAC-13.l variety of cotton, which was seeded at three different intervals in Itauçu (Goiás—Brazil. The effects of the ramulosis on the height and weight of the plants, on the number of bolls, and on the weight of the cotton seeds and lints, were studied. The experiments were installed in a flat area of red latosoil. The experimental design was one of random blocks with six repetitions and the plants were classified, at the end of their vegetative growth, into the following categories: healthy, early ramulosis, medium ramulosis and late developing ramulosis. The early and medium ramulosis affected more significantly the studied parameters, and it was observed that varieties of cotton which were moderately resistant in relation to ramulosis, can be severely affected during growing seasons of heavy rains such as the 1975/76 season.

Estudaram-se os efeitos da incidência precoce, mediana e tardia de ramulose sobre o peso e altura das plantas, número de capulhos, peso das sementes e da pluma de algodoeiro do cultivar IAC-l3.l em três épocas de semeadura (21/10/75, 21/11/75 e 23/12/75 no município de Itauçu (GO. O experimento foi instalado em região plana com latossolo vermelho. Foram utilizados blocos casualizados com seis repetições e plantas no final do ciclo vegetativo foram classificadas em quatro tipos: sadias, com ramulose precoce, com ramulose mediana ou com ramulose tardia. Concluiu-se que a forma precoce e também a mediana foram as que afetaram mais significativamente os parâmetros aferidos, e que cultivares tidos como de razoável comportamento em relação à ramulose, podem ser severamente afetados em anos agrícolas muito chuvosos como foi o de 1975/76.

Influence of cover crops on insect pests and predators in conservation tillage cotton.

Science.gov (United States)

Tillman, Glynn; Schomberg, Harry; Phatak, Sharad; Mullinix, Benjamin; Lachnicht, Sharon; Timper, Patricia; Olson, Dawn

2004-08-01

In fall 2000, an on-farm sustainable agricultural research project was established for cotton, Gossypium hirsutum L., in Tift County, Georgia. The objective of our 2-yr research project was to determine the impact of several cover crops on pest and predator insects in cotton. The five cover crop treatments included 1) cereal rye, Secale cereale L., a standard grass cover crop; 2) crimson clover, Trifolium incarnatum L., a standard legume cover crop; 3) a legume mixture of balansa clover, Trifolium michelianum Savi; crimson clover; and hairy vetch, Vicia villosa Roth; 4) a legume mixture + rye combination; and 5) no cover crop in conventionally tilled fields. Three main groups or species of pests were collected in cover crops and cotton: 1) the heliothines Heliothis virescens (F.) and Helicoverpa zea (Boddie); 2) the tarnished plant bug, Lygus lineolaris (Palisot de Beauvois); and 3) stink bugs. The main stink bugs collected were the southern green stink bug, Nezara viridula (L.); the brown stink bug, Euschistus servus (Say); and the green stink bug, Acrosternum hilare (Say). Cotton aphids, Aphis gossypii Glover, were collected only on cotton. For both years of the study, the heliothines were the only pests that exceeded their economic threshold in cotton, and the number of times this threshold was exceeded in cotton was higher in control cotton than in crimson clover and rye cotton. Heliothine predators and aphidophagous lady beetles occurred in cover crops and cotton during both years of the experiment. Geocoris punctipes (Say), Orius insidiosus (Say), and red imported fire ant, Solenopsis invicta Buren were relatively the most abundant heliothine predators observed. Lady beetles included the convergent lady beetle, Hippodamia convergens Guérin-Méneville; the sevenspotted lady beetle, Coccinella septempunctata L.; spotted lady beetle, Coleomegilla maculata (DeGeer); and the multicolored Asian lady beetle, Harmonia axyridis (Pallas). Density of G. punctipes was

Shallot aphids, Myzus ascalonicus, in strawberry

DEFF Research Database (Denmark)

Enkegaard, Annie; Sigsgaard, Lene; Kristensen, Kristian

2013-01-01

The parasitization capacity of 3 parasitoids and the predation capacity of 3 predators towards the shallot aphid, Myzus ascalonicus Doncaster (Homoptera: Aphididae), on strawberry, Fragaria x ananassa Duchesne (Rosales: Rosaceae) cv. Honeoye, were examined in laboratory experiments. In Petri dish...... other parasitoid-induced causes. However, the host feeding rate was reduced to only 1.2 ± 0.8%, and no significant parasitization mortality was observed on strawberry plants, suggesting that host plants interfered with A. abdominalis activity. This parasitoid does not, therefore, seem to be suited...... to either inoculative or inundative biocontrol of shallot aphids in strawberry. The three predators studied were the green lacewing, Chrysoperla carnea Steph. (Neuroptera: Chrysopi-dae), the two-spotted lady beetle, Adalia bipunctata L. (Coleoptera: Coccinellidae), and the gall midge Aphidoletes aphidimyza...

Food habits of introduced rodents in high-elevation shrubland of Haleakala National Park, Maui, Hawai'i

Science.gov (United States)

Cole, F. Russell; Loope, Lloyd L.; Medeiros, Arthur C.; Howe, Cameron E.; Anderson, Laurel J.

2000-01-01

Mus musculus and Rattus rattus are ubiquitous consumers in the high-elevation shrubland of Haleakala National Park. Food habits of these two rodent species were determined from stomach samples obtained by snaptrapping along transects located at four different elevations during November 1984 and February, May, and August 1985. Mus musculus fed primarily on fruits, grass seeds, and arthropods. Rattus rattus ate various fruits, dicot leaves, and arthropods. Arthropods, many of which are endemic, were taken frequently by Mus musculus throughout the year at the highest elevation where plant food resources were scarce. Araneida, Lepidoptera (primarily larvae), Coleoptera, and Homoptera were the main arthropod taxa taken. These rodents, particularly Mus musculus, exert strong predation pressure on populations of arthropod species, including locally endemic species on upper Haleakala Volcano.

Observaciones preliminares del comportamiento agronómico de Canavalia ensiformis L en condiciones del Valle del Cauca

Directory of Open Access Journals (Sweden)

Castellar P. Nelson

1986-03-01

Full Text Available Se realizaron observaciones sobre aspectos fitosanitarios, morfológicos y fenológicos, aspectos agronómicos, nodulación y componentes del rendimiento para tres distancias de siembra. La especie presenta tres hábitos de crecimiento (arbustivo determinado, arbustivo con guía corta e indeterminado con guía larga trepador. La fase vegetativa dura 69 d días y 122 días la reproductiva Los insectos con mayor potencial de daño son Corythuca gossypii, Anticarsia gemmatalis y Caryedes grammicus, este último registrado por primera vez en el mundo. Se presentaron virosis. Antracnosis, y mildeo polvoso. El virus se clasificó como Potyvirus (CMV, quinto virus a nivel mundial en esta especie. La mejor distancia de siembra fue 1 x 0.6 m, siendo el número de vainas por planta el factor que más influye en el rendimiento.The present study had as objective, to realize the prelyminar observations of the Canavalia ensiformis behaviour in the Cauca's Valley. Observations were made about phytopatologics and entomologics, morphologics and phenologics aspects, agronomic bahevior, nodulation and the yield's components for 3 distances of sowing. C. ensiformis presents 3 growth's habits: determinated shrub, shrub habit with short guide and indeterminated habit with long guide, climbing. C. ensiformis presents one vegetative of 69 days and one reproductive phase of 122 days. The pests insects with more damage's potential are: Corythuca gossypii, Anticarsia gemmatalis y Caryedes grammicus, this later the first report in the world. Virosis, anthracnosis and powdery mildew were the diseases with higher incidence. The virus was named CMV, one potyvirus, which constitute the 5 thin the world for Canavalia. The distance 1 x 0.6 m was the best treatment among the evaluated, and the number of pods for plant is the principal component of the yield.

Seasonal phenology and species composition of the aphid fauna in a northern crop production area.

Directory of Open Access Journals (Sweden)

Sascha M Kirchner

Full Text Available BACKGROUND: The species diversity of aphids and seasonal timing of their flight activity can have significant impacts on crop production, as aphid species differ in their ability to transmit plant viruses and flight timing affects virus epidemiology. The aim of the study was to characterise the species composition and phenology of aphid fauna in Finland in one of the northernmost intensive crop production areas of the world (latitude 64°. METHODOLOGY/PRINCIPAL FINDINGS: Flight activity was monitored in four growing seasons (2007-010 using yellow pan traps (YPTs placed in 4-8 seed potato fields and a Rothamsted suction trap. A total of 58,528 winged aphids were obtained, identified to 83 taxa based on morphology, and 34 species were additionally characterised by DNA barcoding. Seasonal flight activity patterns analysed based on YPT catch fell into three main phenology clusters. Monoecious taxa showed early or middle-season flight activity and belonged to species living on shrubs/trees or herbaceous plants, respectively. Heteroecious taxa occurred over the entire potato growing season (ca. 90 days. Abundance of aphids followed a clear 3-year cycle based on suction trap data covering a decade. Rhopalosiphum padi occurring at the end of the potato growing season was the most abundant species. The flight activity of Aphis fabae, the main vector of Potato virus Y in the region, and Aphis gossypii peaked in the beginning of potato growing season. CONCLUSIONS/SIGNIFICANCE: Detailed information was obtained on phenology of a large number aphid species, of which many are agriculturally important pests acting as vectors of plant viruses. Aphis gossypii is known as a pest in greenhouses, but our study shows that it occurs also in the field, even far in the north. The novel information on aphid phenology and ecology has wide implications for prospective pest management, particularly in light of climate change.

Near infrared hyperspectral images and pattern recognition techniques used to identify etiological agents of cotton anthracnose and ramulosis

Directory of Open Access Journals (Sweden)

Priscila S.R. Aires

2018-04-01

Full Text Available Hyperspectral imaging near infrared (HSI-NIR has the potential to be used as a non-destructive approach for the analysis of new microbiological matrices of agriculture interest. This article describes a new method for accurately and rapidly classifying the etiological agents Colletotrichum gossypii (CG and C. gossypii var. cephalosporioides (CGC grown in a culture medium, using scattering reflectance HSI-NIR and multivariate pattern recognition analysis. Five strains of CG and 46 strains of CGC were used. CG and CGC strains were grown on Czapek-agar medium at 25 °C under a 12-hour photoperiod for 15 days. Molecular identification was performed as a reference for the CG and CGC classes by polymerase chain reaction of the intergenic spacer region of rDNA. The scattering coefficient µs and the absorption coefficient µa were obtained, which resulted in a µs value for CG of 1.37 × 1019 and for CGC of 5.83 × 10–11. These results showed that the use of the standard normal variate was no longer essential and reduced the spectral range from 1000–2500 nm to 1000–1381 nm. The results evidenced two type II errors for the CG 457-2 and CGC 39 samples in the soft independent modelling model of the analogy model. There were no classification errors using the algorithm of the successive projections for variable selection in linear discriminant analysis (SPA-LDA. A parallel validation of the results obtained with SPA-LDA was performed using a box plot analysis with the 11 variables selected by SPA, in which there were no outliers for the HSI-NIR models. The new HSI-NIR and SPA-LDA procedures for the classification of CG and CGC etiological agents are noted for their greater analytical speed, accuracy, simplicity, lower cost and non-destructive nature.

Filamentous Growth in Eremothecium Fungi

DEFF Research Database (Denmark)

Oskarsson, Therese

, this thesis deals with some of the aspects of hyphal growth, which is an important virulence factor for pathogenic fungi infecting both humans and plants. Hyphal establishment through continuous polar growth is a complex process, requiring the careful coordination of a large subset of proteins involved......-regulatory activity of AgGts1, the protein could have additional actin organizing properties. In the second and third part, this thesis addresses the use of A. gossypii and its relative E. cymbalariae as model organisms for filamentous growth. A series of assays analyzed the capability of Eremothecium genus fungi...... of molecular tools for E. cymbalariae to enable a faster and more efficient approach for genetic comparisons between Eremothecium genus fungi....

The genome sequence of pepper vein yellows virus (family Luteoviridae, genus Polerovirus).

Science.gov (United States)

Murakami, Ritsuko; Nakashima, Nobuhiko; Hinomoto, Norihide; Kawano, Shinji; Toyosato, Tetsuya

2011-05-01

The complete genome of pepper vein yellows virus (PeVYV) was sequenced using random amplification of RNA samples isolated from vector insects (Aphis gossypii) that had been given access to PeVYV-infected plants. The PeVYV genome consisted of 6244 nucleotides and had a genomic organization characteristic of members of the genus Polerovirus. PeVYV had highest amino acid sequence identities in ORF0 to ORF3 (75.9 - 91.9%) with tobacco vein distorting polerovirus, with which it was only 25.1% identical in ORF5. These sequence comparisons and previously studied biological properties indicate that PeVYV is a distinctly different virus and belongs to a new species of the genus Polerovirus.

Power, command and violence in von Trier’s Manderlay. A political and philosophical analysis of pseudo-democracies.

Directory of Open Access Journals (Sweden)

Sara Marino

2016-10-01

Full Text Available Alabama, 1933. A caravan of limousines carrying gangsters arrives in Manderlay, a small village where slavery still exists as an institution. Mam (Lauren Bacall rules the plantation assisted by her foreman Wilhelm (Danny Glover, a slave who believes his people are not ready for the responsibilities of freedom. Driving up to the gates of the plantation, Grace (Bryce Dallas Howard declares that the slaves must be informed how to enjoy freedom and thus becoming good citizens. Drawing on a textual and visual analysis of Manderlay, the article explores how democracy arises from the exercise of violence and power, as well as the inability of Western societies to deal with the dogma of difference.

A synopsis of the tribe Micrutalini Haupt (Homoptera, Membracidae, Smiliinae

Directory of Open Access Journals (Sweden)

Albino M. Sakakibara

1999-01-01

Full Text Available The tribe Micrutalini and its two genera, Trachytalis Fowler and Micrutalis Fowler, are redescribed. The following species are treated and, in some cases, nomenclatura! changes introduced: Trachytalis isabellina Fowler, 1895; T. distinguenda Fowler, 1895; T. retrofasciata (Lethierry, 1890, comb.n.; Micrutalis alrovena Goding, 1930; M. balteata (Fairmaire, 1846 = Aculalis lucidus Buckton, 1902, syn.n.; M. bella Goding, 1929; M. biguttula (Fairmaire, 1846, comb.n.; M. binaria (Fairmaire, 1846 = Acutalis flavivenlris Lethierry, 1890, syn.n.; M. callan-gensis Goding, 1930; M. calva (Say, 1830; M. discalis (Walker, 1858; M. dorsalis (Fitch, 1851; M. dubia Fowler, 1895 = M. zeteki Goding, 1928, syn.n.; M. flava Goding, 1929; M. flavozonala (Fairmaire, 1846, comb.n. = Acutalis geniculata Stál, 1862, syn.n. = Acutalis modesta Stál, 1862, syn.n.; M. godfreyi Sakakibara, 1976; M. incerla Sakakibara, 1976; M. lata Goding, 1930; M. litlerala (Fairmaire, 1846, comb.n.;M lugubrina(Stál, 1862;M malleiferaFovj]er, 1895 = M binariamutabilis Fowler, 1895, syn.n.; M. minutus Buckton, 1902; M. nigrolineata (Stál, 1864; M. nigromarginata Funkhouser, 1940; M. notalipennis Fowler, 1895; M. occidentalis (Goding, 1893; M. pollens Fowler, 1895; M. parva (Goding, 1893; M. plagíala (Stál, l&62 = AcutalisvariabiIisBerg, 1879,syn.n. =M. chapadensisGoding, 1930,syn.n.; M. punctifera (Walker, 1858; M. semialba (Stál, 1862; M. stipulipennis Buckton, 1902; M. tau Goding, 1930; M. trifurcala Goding, 1893; M. tripunctata (Fairmaire, 1846 = Acutalis moesta Stál, 1859, syn.n. = M. tartaredoides Goding, 1930, syn.n.. New species: Micrutalis diminuta sp.n. (Ecuador, Pichincha; Micrutalis divisa sp.n. (Brazil, Mato Grosso; Micrutalis henki sp.n. (Panama, Canal Zone; Micrutalis infúscala sp.n. (Venezuela, Portuguesa; Micrutalis margínala sp.n. (Brazil, Mato Grosso; Micrutalis meridana sp.n. (Venezuela, Mérida; Micrutalis mucuya sp.n. (Venezuela, Mérida; Micrutalis robustula sp.n. (Venezuela, Caracas; M. seminigra sp.n. (Brazil, Paraná; Micrutalis turriba sp.n. (Costa Rica, Turrialba. Lectotypes are designated for: Acutalis balteata Fairmaire, 1846, Aculalis binaria Fairmaire, 1846, Acutalis flavozonala Fairmaire, 1846, una Acutalis tripunctata Fairmaire, 1846. New taxonomic position: Micrutalis melanogramma (Petty, 1833 is transferred to Melu-sinella Metcalf, 1952 (Ceresini - Melusinella melanogramma (Petty, 1833, comb.n. = Melusinella nervosa (Fairmaire, 1846, syn.n.. Species incertae sedis: Tragopa ephippium Burmeister, 1836.

Particle film affects black pecan aphid (Homoptera: Aphididae) on pecan.

Science.gov (United States)

Cottrell, Ted E; Wood, Bruce W; Reilly, Charles C

2002-08-01

Three species of aphids attack pecan foliage, Carya illinoensis (Wang.) K. Koch, and cause economic damage. We tested a kaolin-based particle film against one of these aphid species, black pecan aphid, Melanocallis caryaefoliae (Davis). Effect of particle film on host selection, adult mortality, and production of nymphs by M. caryaefoliae was tested on seedling pecans in the laboratory. Fewer M. caryaefoliae adults selected treated foliage compared with untreated foliage. A higher percentage of adults that did select treated foliage were recovered from upper leaf surfaces compared with the percentage of adults recovered from upper leaf surfaces of untreated leaves. Observations with a microscope revealed an accumulation of particle film on aphid body parts, especially on tarsi, and strongly suggests that aphid mobility was restricted. Adult mortality was higher on treated foliage and led to an overall decrease in production of nymphs on those seedlings. In addition, we measured spectral properties of treated seedling pecan foliage. Light reflectance by treated foliage was increased and absorptance decreased compared with control foliage whereas transmittance of light through control and particle film-treated leaves was similar. We did not detect any phytotoxic effect on pecan due to application of particle film.

Food habits of Nyctinomops macrotis at a maternity roost in New Mexico, as indicated by analysis of guano

Science.gov (United States)

Sparks, D.W.; Valdez, E.W.

2003-01-01

We examined 56 fecal pellets from under a maternity colony of big free-tailed bats (Nyctinomops macrotis) in the Jemez Mountains of northern New Mexico. The most important food items, listed in order of decreasing percent volume, were Cicadellidae, leafhoppers (26.7% volume, 58.9% frequency); Ichneumonidae, Ichneumon wasps (19.3% volume, 35.7% frequency); and Lepidoptera, moths (17.2% volume, 82.1% frequency). Overall, the most important orders as prey consumed, listed by decreasing percent volume, were Homoptera (27.6% volume, 62.5% frequency), Hymenoptera (19.5% volume, 37.5% frequency), Lepidoptera (17.2% volume, 82.1% frequency), Hemiptera (11.7% volume, 37.5% frequency), and Diptera (10.6% volume, 50.0% frequency). Our study documents an unusually varied diet, as previous studies indicated that these bats fed almost exclusively on moths.

Molecular Mechanisms Regulating Sporulation in the Filamentous Fungus Ashbya gossypii

DEFF Research Database (Denmark)

Wasserstrom, Lisa

Sporulation is a complex developmental program that fungi enter to ensure survival in unfavorable environmental conditions. Many fungal species are able to produce spores sexually through meiosis, which is beneficial since it introduces genetic variability into a population. The sexually reproduc...

Screening of broad spectrum natural pesticides against conserved target arginine kinase in cotton pests by molecular modeling.

Science.gov (United States)

Sakthivel, Seethalakshmi; Habeeb, S K M; Raman, Chandrasekar

2018-03-12

Cotton is an economically important crop and its production is challenged by the diversity of pests and related insecticide resistance. Identification of the conserved target across the cotton pest will help to design broad spectrum insecticide. In this study, we have identified conserved sequences by Expressed Sequence Tag profiling from three cotton pests namely Aphis gossypii, Helicoverpa armigera, and Spodoptera exigua. One target protein arginine kinase having a key role in insect physiology and energy metabolism was studied further using homology modeling, virtual screening, molecular docking, and molecular dynamics simulation to identify potential biopesticide compounds from the Zinc natural database. We have identified four compounds having excellent inhibitor potential against the identified broad spectrum target which are highly specific to invertebrates.

Predatory behavior of Pseudodorus clavatus (Diptera, Syrphidae on aphids tended by ants

Directory of Open Access Journals (Sweden)

Alexandra Bächtold

2013-12-01

Full Text Available Predatory behavior of Pseudodorus clavatus (Diptera, Syrphidae on aphids tended by ants. In this study, we examined the interactions between myrmecophilous aphids, their ant-guards and a predatory syrphid species, Pseudodorus clavatus (F.. Larvae of this predator were found in the colonies of three aphid species: Aphis gossypii, A. spiraecola and Toxoptera sp., which were tended by eight ant species, especially Camponotus. Hoverfly larvae managed to infiltrate the aphid colonies and consume nymphs. Predator larvae exhibited inconspicuous movements and were not detected by ants which were commonly observed touching and antennating the larvae they come into contact. These results suggest that behavioral and chemical cues are involved in the infiltration and on the successful predation of syrphids upon aphids.

Revisão do gênero Potnia Stål (Homoptera, Membracidae, Membracinae, Hoplophorionini Revision of the genus Potnia Stål (Homoptera, Membracidae, Membracinae, Hoplophorionini

Directory of Open Access Journals (Sweden)

Antônio J Creão-Duarte

1996-01-01

Full Text Available Fifteen species of Potnia Stål, 1866 are presented with descriptions, illustrations and a key for identification. The following nomenclatural changes are introduced: P. knightae sp.n. (from Guiana, P. miracyae sp.n. (from Costa Rica, P. diringshofeni sp.n. (from Brasil, P. webbi sp.n. (from Brazil, P. turrialbensis sp.n. (from Costa Rica, P. pinheiroi sp.n. (from Brazil, P. tapuruquarensis sp.n. (from Brasil, P. cornigera sp.n. (from Brazil and P. inca sp.n. (from Peru. Potnia venosa (Germar, 1821 = Aconophora nigrivittata Walker, 1851, syn.n. = Potnia perobtusa Fowler, 1894, syn.n.. Potnia brevicornis Fowler, 1894, sp. reval. = Potnia brunneifrontis Funkhouser, 1943, syn.n. = Potnia maculata Funkhouser, 1943, syn.n.. Potnia jacula (Fabricius, 1803 = Potnia orthosoma Fonseca & Diringshofen, 1974, syn.n.

RETHINKING THE ROLE OF SMALL-GROUP COLLABORATORS AND ADVERSARIES IN THE LONDON KLEINIAN DEVELOPMENT (1914-1968).

Science.gov (United States)

Aguayo, Joseph; Regeczkey, Agnes

2016-07-01

The authors historically situate the London Kleinian development in terms of the small-group collaborations and adversaries that arose during the course of Melanie Klein's career. Some collaborations later became personally adversarial (e.g., those Klein had with Glover and Schmideberg); other adversarial relationships forever remained that way (with A. Freud); while still other long-term collaborations became theoretically contentious (such as with Winnicott and Heimann). After the Controversial Discussions in 1944, Klein marginalized one group of supporters (Heimann, Winnicott, and Riviere) in favor of another group (Rosenfeld, Segal, and Bion). After Klein's death in 1960, Bion maintained loyalty to Klein's ideas while quietly distancing his work from the London Klein group, immigrating to the United States in 1968. © 2016 The Psychoanalytic Quarterly, Inc.

Ant tending influences soldier production in a social aphid.

Science.gov (United States)

Shingleton, A W; Foster, W A

2000-09-22

The aphid Pseudoregma sundanica (Van der Goot) (Homoptera: Aphididae) has two defence strategies. It is obligatorily tended by various species of ant and also produces sterile soldiers. We investigated how they allocate their investment in these two strategies. We measured the size, number of soldiers, number and species of tending ant, and number and species of predators in P. sundanica populations. We found that the level of ant tending correlated negatively with soldier investment in P. sundanica. The species of tending ant also influenced soldier investment. We excluded ants from aphid populations and recorded changes in population size and structure over four weeks. Ant exclusion led to population decline and extinction. At the same time, surviving populations showed a significant increase in soldier investment. The data demonstrate that social aphids can adjust their investment in soldiers in direct response to environmental change.

[Anthropoentomophagic biodiversity of the Zongolica region, Veracruz, Mexico].

Science.gov (United States)

Ramos-Elorduy, Julieta; Landero-Torres, Ivonne; Murguía-González, Joaquín; Pino, José M M

2008-03-01

Anthropoentomophagic biodiversity of the Zongolica region, Veracruz, Mexico. During two and a half years (2003-2005) we recorded the insect species used as food at Zongolica, Veracruz State, Mexico. Interviews were made among people (200) of this municipality to know which insects they consumed. The total of registered species was 57 (Orthoptera, Hemiptera, Homoptera, Megaloptera, Coleoptera, Lepidoptera and Hymenoptera). The Orthoptera was the most frequently ingested. Twenty-four of these species were new records for edible insects of Mexico. They are eaten in immature stages or as adults, generally only roasted. Consumption is seasonal. Some species are commercialized in the "tianguis" (little town markets) and/or in the larger Zongolica market. There is a "protoculture" of three species, one cockroach (Periplaneta australasiae Fabricius) and two moths (Latebraria amphipyroides Guenée and Arsenura armida armida Cramer). In Zongolica, anthropoentomophagy is an ancestral habit.

Secondary metabolites from the endophytic fungus Talaromyces pinophilus.

Science.gov (United States)

Vinale, F; Nicoletti, R; Lacatena, F; Marra, R; Sacco, A; Lombardi, N; d'Errico, G; Digilio, M C; Lorito, M; Woo, S L

2017-08-01

Endophytic fungi have a great influence on plant health and growth, and are an important source of bioactive natural compounds. Organic extracts obtained from the culture filtrate of an endophytic strain of Talaromyces pinophilus isolated from strawberry tree (Arbutus unedo) were studied. Metabolomic analysis revealed the presence of three bioactive metabolites, the siderophore ferrirubin, the platelet-aggregation inhibitor herquline B and the antibiotic 3-O-methylfunicone. The latter was the major metabolite produced by this strain and displayed toxic effects against the pea aphid Acyrthosiphon pisum (Homoptera Aphidiidae). This toxicity represents an additional indication that the widespread endophytic occurrence of T. pinophilus may be related to a possible role in defensive mutualism. Moreover, the toxic activity on aphids could promote further study on 3-O-methylfunicone, or its derivatives, as an alternative to synthetic chemicals in agriculture.

The effect of insecticide applications to melon crop on melon aphid and its natural enemies

International Nuclear Information System (INIS)

Guerra, J.; Gonzalez, J.E.; Ceballos, J.; Checa, B.

1999-01-01

Melons are an important export crop for Panama and are cultivated on more than 1000 ha of land. Long growing season, extending well into January, allows several generations and build up of heavy populations of an important insect pest, Aphis gossypii, the melon aphid. Growers find it difficult to cultivate melons without several applications of insecticides. Although the insecticide applications control the aphids, they may also have adverse effects on the natural enemies of the aphid, in particular the two predatory insects Cycloneda sanguinea and Chrysoperla carnea. The purpose of this research was to evaluate the impact of insecticide applications on these insects and on the yield of melons, and to estimate residues of the applied insecticides in soil. The insecticides were applied as four different type of treatments to melon crop. The treatments were (i) three periodic applications of endosulfan (Thiodan 35EC), each at 0.52 kg a.i./ha, (ii) three applications of fenitrothion (Sumithion 50WP), each at 0.35 kg a.i./ha, (iii) two applications of fenitrothion and one of endosulfan, and (iv) grower's treatment, which included applications of six different insecticides. The effect of the insecticide applications was evaluated by estimating numbers of each of the three type of insects before and within 72 hours after the applications and estimating yield of melons. All insecticide treatments reduced the populations of Aphis gossypii, but they also reduced the numbers of the benificial insects. Endosulfan was somewhat less toxic to C. carnea than the other insecticides were, since greater number of C. carnea were recorded from the plots treated with endosulfan than the other treated plots. The best yield of melons was recorded in the plots which were sprayed with fenitrothion, followed by the plots sprayed with endosulfan. and then those with grower's insecticides. Soon after the application of endosulfan the residue in the soil was 0.2 mg/kg, but it declined to less

Responses of Russian Wheat Aphid (Homoptera: Aphididae) to Aphid Alarm Pheromone

OpenAIRE

Shah, P. A.; Pickett, J. A.; Vandenberg, J. D.

2017-01-01

In a series of laboratory tests, Russian wheat aphids, Diuraphis noxia (Mordvilko), responded to synthetic aphid alarm pheromone, (E)-β-farnesene, by removing stylets and leaving feeding sites or by crawling out of test arenas. Late instars and adults were more responsive than early instars. In dose-response assays, EC50 estimates ranged from 0.94 to 8.95 mg/ml among 3 experiments. In arenas, D. noxia also responded to the proximity of cornicle-damaged nymphs of either the green peach aphid, ...

Evaluation of insecticides against cotton whitefly, bemisia tabachi (Genn.) (Homoptera: Aleyrodidae)

International Nuclear Information System (INIS)

Razaq, M.; Aslam, M.; Sharif, K.; Salman, B.; Aleem, F.

2003-01-01

The experiment was conducted to evaluate the efficacy of lmidacloprid (Confidor 200SL), Acetamaprid (Mospilon 20SP), Methamidophos (Tamaron 600SL), Endosulfan (Thioluxon 35EC), Buprofezin (Sitara 25WP), Fenpropathrin (Fenthrin 20EC) and Diafenthiuron (Polo 500 SC) against whitefly, Bemisia tabaci (Genn.) on cotton variety CIM-473 during the crop year 2002. The crop was sprayed twice in September. After seven days of the first spray, the lowest population (0.6/leaf) of whitefly was observed in plots treated with Endosulfan 35EC followed by Acetamaprid 20SP(1.1/leaf), while the plots receiving Buprofezin 25 WP + Fenpropathrin 20 EC, Methamidophos 600SL and Imidacloprid 200SL had population of whitefly statistically similar. Seven days after second spray Acetamaprid 20SP and Diafenthiuron 500SC treated plots had the lowest population (1.4 per leaf) of whitefly followed by Imidacloprid 200SL (1.8 per leaf) and Fenpropathrin 20EC (1.9 per leaf).(author)

Cytogenetic and taxonomic studies of some legless mealybugs (Homoptera, Coccinea, Pseudococcidae

Directory of Open Access Journals (Sweden)

Ilya A. Gavrilov-Zimin

2016-11-01

Full Text Available A new monotypic genus and species, Komodesia circuliplurima gen. et sp. n., from Flores Is. (Indonesia and the new species, Antonina diversiglandulosa sp. n., from Southern Thailand are described and illustrated. Chromosomes of these species and also the ones of Antonina purpurea Signoret, 1872 and A. thaiensis Takahashi, 1942 are studied for the first time: 2n = 30, 20, 12 and 22+Bs correspondingly; the male embryos of all four species demonstrate Lecanoid paternal heterochromatinization of one haploid set of chromosomes. The karyotypes of three widely distributed species, Antonina pretiosa Ferris, 1953, A. graminis (Maskell, 1897 and Chaetococcus bambusae (Maskell, 1893, are studied based on material from other regions in comparison with previously published data. Photographs of the karyotypes are provided for the first time for all seven species. The terminological problems connected with the identification and naming of the three scale insect genetic systems, Lecanoid, Comstockioid and Diaspidoid, are discussed.

Hemlock woolly adelgid (Homoptera: Adelgidae): stylet bundle insertion and feeding sites

Science.gov (United States)

Rebecca F. Young; Kathleen S. Shields; Graeme P. Berlyn

1995-01-01

Stylet bundle insertion site, path traveled, and feeding site were examined for the hemlock woolly adelgid, Adelges tsugae Annand, on needles from current and previous years of eastern hemlock, Tsuga canadensis Carriere. The stylet bundle is composed of 4 individual stylets--2 outer mandibular stylets and 2 inner maxillary stylets...

Extended survival of spiders (Aranaeae) feeding on whitefly (Homoptera: Aleyrodidae) honeydew

Science.gov (United States)

Honeydew produced by homopteran insects such as aphids, whiteflies and mealybugs, can be abundant in some crops and may represent an important food resource for spiders and other honeydew feeding natural enemies. Woolly whiteflies are common in south Texas citrus, and spiders consistently make up a...

Biosynthesis of riboflavin: mechanism of formation of the ribitylamino linkage

International Nuclear Information System (INIS)

Keller, P.J.; Van, Q.L.; Kim, S.U.; Bown, D.H.; Chen, H.C.; Kohnle, A.; Bacher, A.; Floss, H.G.

1988-01-01

Feeding experiments with Ashbya gossypii followed by NMR analysis of the resulting riboflavin showed incorporation of deuterium from D-[2- 2 H]ribose at C-2' and from D-[1- 2 H] ribose in the pro-R position at C-1' of the ribityl side chain. The results rule out an Amadori rearrangement mechanism for the reduction of the ribosylamino to the ribitylamino linkage and point to formation of a Schiff base that is reduced stereospecifically opposite to the face from which the oxygen has departed. As prerequisite for the analysis, the 1 H NMR signals for the pro-R and pro-S hydrogens at C-1' of 6,7-dimethyl-8-ribityllumazine and riboflavin and its tetraacetate were assigned with the aid of synthetic stereospecifically deuteriated samples

Biodiversidad antropoentomofágica de la región de Zongolica, Veracruz, México

Directory of Open Access Journals (Sweden)

Julieta Ramos-Elorduy

2008-03-01

Full Text Available Durante dos años y medio (2003-2005 se rastrearon a los insectos que se ingieren en el área de Zongolica, Veracruz: para ello se entrevistó a la gente de ese municipio (200, para conocer cuáles especies ingerían. El total de especies registradas, ascendió a 57 distribuidas en los órdenes Orthoptera, Hemiptera, Homoptera, Megaloptera, Coleoptera, Lepidoptera e Hymenoptera, correspondiendo el mayor consumo al primer orden. De las especies registradas, 24 son nuevos registros de insectos comestibles para México. Estos se consumen tanto en estado inmaduro como en estado adulto y generalmente se ingieren asados. Hay una secuenciación estacional en el consumo de las diferentes especies y algunas de ellas (las cucarachas, la cuetla, la cuecla, los chapulines, los toritos, etc. se comercializan en los tianguis (puestos de venta callejeros informales que se realizan un día a la semana en diversos lugares del país o en el día de mercado en Zongolica. Existe el "protococultivo" de tres especies: una cucaracha (Periplaneta australasiae Fabricius y dos mariposas (Latebraria amphipyroides Guenée y Arsenura armida armida Cramer. La antropoentomofagía es un hábito ancestral en Zongolica.Anthropoentomophagic biodiversity of the Zongolica region, Veracruz, Mexico. During two and a half years (2003-2005 we recorded the insect species used as food at Zongolica, Veracruz State, Mexico. Interviews were made among people (200 of this municipality to know which insects they consumed. The total of registered species was 57 (Orthoptera, Hemiptera, Homoptera, Megaloptera, Coleoptera, Lepidoptera and Hymenoptera. The Orthoptera was the most frequently ingested. Twenty-four of these species were new records for edible insects of Mexico. They are eaten in immature stages or as adults, generally only roasted. Consumption is seasonal. Some species are commercialized in the "tianguis" (little town markets and/or in the larger Zongolica market. There is a

Aspectos biológicos y poblacionales de Nasonovia ribisnigri y Aulacorthum solani sobre lechuga

Directory of Open Access Journals (Sweden)

Vasicek Araceli

2002-01-01

Full Text Available Se estimó la influencia de los cultivares Criolla Blanca, Cuatro Estaciones y Gallega, sobre la biología y los parámetros poblacionales de Nasonovia ribisnigri y Aulacorthum solani (Homoptera: Aphidoidea a 10±1ºC y HR de 90%. Los períodos ninfal, pre-reproductivo y post-reproductivo de N. ribisnigri fueron más largos sobre Cuatro Estaciones, no así el reproductivo. En A. solani el período ninfal fue más largo sobre Criolla Blanca y Cuatro Estaciones resultando el reproductivo mayor sobre Cuatro Estaciones. Las tasas intrínsecas de crecimiento natural (r m de N. ribisnigri y A. solani fueron mayores sobre Criolla Blanca y Gallega, respectivamente. De acuerdo a la especie predominante convendría utilizar Cuatro Estaciones para N. ribisnigri y Criolla Blanca para A. solani, en épocas frías.

Bioproduction of riboflavin: a bright yellow history.

Science.gov (United States)

Revuelta, José Luis; Ledesma-Amaro, Rodrigo; Lozano-Martinez, Patricia; Díaz-Fernández, David; Buey, Rubén M; Jiménez, Alberto

2017-05-01

Riboflavin (vitamin B 2 ) is an essential nutrient for humans and animals that must be obtained from the diet. To ensure an optimal supply, riboflavin is used on a large scale as additive in the food and feed industries. Here, we describe a historical overview of the industrial process of riboflavin production starting from its discovery and the need to produce the vitamin in bulk at prices that would allow for their use in human and animal nutrition. Riboflavin was produced industrially by chemical synthesis for many decades. At present, the development of economical and eco-efficient fermentation processes, which are mainly based on Bacillus subtilis and Ashbya gossypii strains, has replaced the synthetic process at industrial scale. A detailed account is given of the development of the riboflavin overproducer strains as well as future prospects for its improvement.

Characterization of a new potyvirus causing mosaic and flower variegation in Catharanthus roseus in Brazil

Directory of Open Access Journals (Sweden)

Sheila Conceição Maciel

2011-12-01

Full Text Available Catharanthus roseus is a perennial, evergreen herb in the family Apocynaceae, which is used as ornamental and for popular medicine to treat a wide assortment of human diseases. This paper describes a new potyvirus found causing mosaic symptom, foliar malformation and flower variegation in C. roseus. Of 28 test-plants inoculated mechanically with this potyvirus, only C. roseus and Nicotiana benthamiana developed systemic mosaic, whereas Chenopodium amaranticolor and C. quinoa exhibited chlorotic local lesions. The virus was transmitted by Aphis gossypii and Myzus nicotianae. When the nucleotide sequence of the CP gene (768nt was compared with other members of the Potyviridae family, the highest identities varied from 67 to 76 %. For the 3' UTR (286nt, identities varied from 16.8 to 28.6 %. The name Catharanthus mosaic virus (CatMV is proposed for this new potyvirus.

Utilization of Lactobacillus fermentum andSaccharomyces cerevisiae as starter cultures in the production of ‘dolo'

DEFF Research Database (Denmark)

Glover, R.L.K.; Sawadogo-Lingani, H.; Diawara, B.

2009-01-01

Objective:  The present study was carried out to evaluate the potential of representative strains ofpredominant lactic acid bacteria and yeast as starter cultures in the production of dolo (a type of sorghum beer) of comparable consistency and organoleptic quality to the commercial product......H, lactic acid bacteria and yeast growth were determined at the beginning and end of fermentation. Products were subjected to sensory evaluation for taste, aroma and mouth feel and results analyzed using the Students (t) test. Dolo produced from starter combinations of one strain of L. fermentum and both S...... cultures in the production of (a type of sorghum beer) of comparable consistency and organoleptic quality to the commercial product in Burkina Faso. Two strains each of and from previous studies (Sawadogo- Lingani 2007; Glover ., 2005) were used as starter cultures in producing both under laboratory...

Metcalfa pruinosa (Say (Homoptera: Auchenorrhyncha anew harmful species for entomofauna of Serbia

Directory of Open Access Journals (Sweden)

Mihajlović Ljubodrag

2007-01-01

Full Text Available In the early autumn 2006, a Nonarctic species of cicadas Metcalfa pruinosa (Say (Auchenorrhyncha: Flatidae was identified in Belgrade (Košutnjak. In Europe, this species was identified for the first time in Italy in 1979. In Slovenia, it was identified in 1990 in west Istria, and in 2001 in the neighbourhood of Ljubljana. In the park forest Košutnjak (Belgrade mass occurrence of M. pruinosa was recorded in the area of about 5 ha. The larvae developed on woody species in the genera: Acer, Aesculus, Gleditchia Robinia, Ailanthus, Populus, Platanus, Prunus, Pyrus, Ulmus, Tilia, Cornus Fraxinus, Quercus and Thuja, što is konstatovano based on damages of larvae while numerous adults were found on trees and branches of the same plants.

The taxonomy and biogeography of the genus Thaumastopsaltira Kirkaldy, 1900 (Homoptera, Tibicinidae)

NARCIS (Netherlands)

Boer, de A.J.

1992-01-01

The taxonomic concept of the genus Thaumastopsaltria Kirkaldy is redefined on the basis of the shape of postclypeus and the length of the ovipositor. Tegmen venation is shown to be unreliable for this purpose. T. nana (Jacobi) does not fit this new concept and is, pending its transfer to another

Comparison of the ionizing radiation effects on cochineal, annatto and turmeric natural dyes

Science.gov (United States)

Cosentino, Helio M.; Takinami, Patricia Y. I.; del Mastro, Nelida L.

2016-07-01

As studies on radiation stability of food dyes are scarce, commercially important natural food grade dyes were evaluated in terms of their sensitivity against gamma ionizing radiation. Cochineal, annatto and turmeric dyes with suitable concentrations were subjected to increasing doses up to 32 kGy and analyzed by spectrophotometry and capillary electrophoresis. The results showed different pattern of absorbance versus absorbed dose for the three systems. Carmine, the glucosidal coloring matter from the scale insect Coccus cacti L., Homoptera (cochineal) remained almost unaffected by radiation up to doses of about 32 kGy (absorbance at 494 nm). Meanwhile, at that dose, a plant-derived product annatto or urucum (Bixa orellana L.) tincture presented a nearly 58% reduction in color intensity. Tincture of curcumin (diferuloylmethane) the active ingredient in the eastern spice turmeric (Curcuma longa) showed to be highly sensitive to radiation when diluted. These data shall be taken in account whenever food products containing these food colors were going to undergo radiation processing.

Functional characterization of carboxylesterase gene mutations involved in Aphis gossypii resistance to organophosphate insecticides.

Science.gov (United States)

Gong, Y-H; Ai, G-M; Li, M; Shi, X-Y; Diao, Q-Y; Gao, X-W

2017-12-01

Carboxylesterases (CarEs) play an important role in detoxifying insecticides in insects. Over-expression and structural modification of CarEs have been implicated in the development of organophosphate (OP) insecticide resistance in insects. A previous study identified four nonsynonymous mutations (resulting in four amino acid residue substitutions) in the open reading frame of the carboxylesterase gene of resistant cotton aphids compared to the omethoate susceptible strain, which has possibly influenced the development of resistance to omethoate (a systemic OP insecticide). The current study further characterized the function of these mutations, both alone and in combination, in the hydrolysis of OP insecticides. The metabolism results suggest that the combination of four mutations, mainly existing in the laboratory-selected OP-resistant cotton aphid population, increased the OP hydrolase activity (approximately twofold) at the cost of detectable carboxylesterase activity. The functional studies of single or multiple mutations suggest the positive effect of H104R, A128V and T333P on the acquisition of OP hydrolase activity, especially the combination of H104R with A128V or T333P. K484R substitution decreased both the OP hydrolase activity and the CarE activity, indicating that this mutation primarily drives the negative effect on the acquisition of OP hydrolase activity amongst these four mutations in the resistant strain. The modelling and docking results are basically consistent with the metabolic results, which strongly suggest that the structural gene modification is the molecular basis for the OP resistance in this laboratory-selected cotton aphid strain. © 2017 The Royal Entomological Society.

Biodiversidad del complejo de artrópodos asociados al follaje de la vegetación del norte de Chile, II región Biodiversity of the canopy arthropods associated to vegetation of the north of Chile, II region

Directory of Open Access Journals (Sweden)

FRANCISCO SAIZ

2000-12-01

, estableciéndose el siguiente gradiente decreciente: DL > DI > TM > TA. El contenido de cenizas de hojas y tallos también varía considerablemente y sigue el mismo patrón de variación que el contenido de agua. El contenido de nitrógeno foliar en las distintas zonas ecológicas estudiadas no varía tanto como el de agua, a excepción de TA en que son marcadamente inferiores. En cambio, en tallos es poco variable y no sigue el patrón de distribución foliar de este elemento, ni los patrones de distribución de los otros nutrientes considerados. En un enfoque global de las cuatro zonas se establece un gradiente decreciente de contenidos de agua, nitrógeno y cenizas desde el DL hasta la zona TA, concordante con el incremento en altitud, especialmente en lo referente a hojas. La familia Asteraceae muestra un definido gradiente decreciente del contenido de agua desde la costa a la alta cordillera. En cuanto al contenido foliar de cenizas difiere significativamente sólo entre DL y TM. En tallos no difiere significativamente. En total se colectaron 12.893 individuos de artrópodos asociados al follaje, distribuidos en 464 morfoespecies y 19 grupos zoológicos, considerando aparte a los antiguos Homoptera. Este grupo, junto a Hemiptera y larvas de Lepidoptera, destaca en cuanto a abundancia de especies dentro de los insectos fitófagos, así como Hymenoptera dentro de los parasitoides y Araneae entre los depredadores. En cuanto a las zonas ecológicas, el DL y TM presentan la mayor abundancia de artrópodos, tanto en especies como en individuos, así como de especies de plantas sobre las cuales se colectaron. La similaridad de la artropodofauna entre zonas ecológicas es mínima desde el punto de vista de la presencia de especies; en cambio, considerando sus abundancias, se detecta una tendencia a asociarse DI con TM y a aislarse el DL, al igual que ocurre con la vegetación. Desde el punto de vista de las diversidades específicas globales (H´ de los artrópodos se

Combined phylogeny and neighborhood analysis of the evolution of the ABC transporters conferring multiple drug resistance in hemiascomycete yeasts

Directory of Open Access Journals (Sweden)

Goffeau André

2009-10-01

Full Text Available Abstract Background Pleiotropic Drug Resistant transporters (PDR are members of the ATP-Binding Cassette (ABC subfamily which export antifungals and other xenobiotics in fungi and plants. This subfamily of transmembrane transporters has nine known members in Saccharomyces cerevisiae. We have analyzed the complex evolution of the pleiotropic drug resistance proteins (Pdrp subfamily where gene duplications and deletions occur independently in individual genomes. This study was carried out on 62 Pdrp from nine hemiascomycetous species, seven of which span 6 of the 14 clades of the Saccharomyces complex while the two others species, Debaryomyces hansenii and Yarrowia lipolytica, are further apart from an evolutive point of view. Results Combined phylogenetic and neighborhood analyses enabled us to identify five Pdrp clusters in the Saccharomyces complex. Three of them comprise orthologs of the Pdrp sensu stricto, Pdr5p, Pdr10p, Pdr12p, Pdr15p, Snq2p and YNR070wp. The evolutive pathway of the orthologs of Snq2 and YNR070w is particularly complex due to a tandem gene array in Eremothecium gossypii, Kluyveromyces lactis and Saccharomyces (Lachancea kluyveri. This pathway and different cases of duplications and deletions were clarified by using a neighborhood analysis based on synteny. For the two distant species, Yarrowia lipolytica and Debaryomyces hansenii, no neighborhood evidence is available for these clusters and many homologs of Pdr5 and Pdr15 are phylogenetically assigned to species-based clusters. Two other clusters comprise the orthologs of the sensu lato Pdrp, Aus1p/Pdr11p and YOL075cp respectively. The evolutionary pathway of these clusters is simpler. Nevertheless, orthologs of these genes are missing in some species. Conclusion Numerous duplications were traced among the Hemiascomycetous Pdrp studied. The role of the Whole Genome Duplication (WGD is sorted out and our analyses confirm the common ancestrality of Pdr5p and Pdr15p. A tandem

Combined phylogeny and neighborhood analysis of the evolution of the ABC transporters conferring multiple drug resistance in hemiascomycete yeasts.

Science.gov (United States)

Seret, Marie-Line; Diffels, Julie F; Goffeau, André; Baret, Philippe V

2009-10-01

Pleiotropic Drug Resistant transporters (PDR) are members of the ATP-Binding Cassette (ABC) subfamily which export antifungals and other xenobiotics in fungi and plants. This subfamily of transmembrane transporters has nine known members in Saccharomyces cerevisiae. We have analyzed the complex evolution of the pleiotropic drug resistance proteins (Pdrp) subfamily where gene duplications and deletions occur independently in individual genomes. This study was carried out on 62 Pdrp from nine hemiascomycetous species, seven of which span 6 of the 14 clades of the Saccharomyces complex while the two others species, Debaryomyces hansenii and Yarrowia lipolytica, are further apart from an evolutive point of view. Combined phylogenetic and neighborhood analyses enabled us to identify five Pdrp clusters in the Saccharomyces complex. Three of them comprise orthologs of the Pdrp sensu stricto, Pdr5p, Pdr10p, Pdr12p, Pdr15p, Snq2p and YNR070wp. The evolutive pathway of the orthologs of Snq2 and YNR070w is particularly complex due to a tandem gene array in Eremothecium gossypii, Kluyveromyces lactis and Saccharomyces (Lachancea) kluyveri. This pathway and different cases of duplications and deletions were clarified by using a neighborhood analysis based on synteny. For the two distant species, Yarrowia lipolytica and Debaryomyces hansenii, no neighborhood evidence is available for these clusters and many homologs of Pdr5 and Pdr15 are phylogenetically assigned to species-based clusters. Two other clusters comprise the orthologs of the sensu lato Pdrp, Aus1p/Pdr11p and YOL075cp respectively. The evolutionary pathway of these clusters is simpler. Nevertheless, orthologs of these genes are missing in some species. Numerous duplications were traced among the Hemiascomycetous Pdrp studied. The role of the Whole Genome Duplication (WGD) is sorted out and our analyses confirm the common ancestrality of Pdr5p and Pdr15p. A tandem gene array is observed in Eremothecium gossypii. One

A phylogenetic analysis of the sugar porters in hemiascomycetous yeasts.

Science.gov (United States)

Palma, Margarida; Goffeau, André; Spencer-Martins, Isabel; Baret, Philippe V

2007-01-01

A total of 214 members of the sugar porter (SP) family (TC 2.A.1.1) from eight hemiascomycetous yeasts: Saccharomyces cerevisiae, Candida glabrata, Kluyveromyces lactis, Ashbya (Eremothecium) gossypii, Debaryomyces hansenii, Yarrowia lipolytica, Candida albicans and Pichia stipitis, were identified. The yeast SPs were classified in 13 different phylogenetic clusters. Specific sugar substrates could be allocated to nine phylogenetic clusters, including two novel TC clusters that are specific to fungi, i.e. the glycerol:H(+) symporter (2.A.1.1.38) and the high-affinity glucose transporter (2.A.1.1.39). Four phylogenetic clusters are identified by the preliminary fifth number Z23, Z24, Z25 and Z26 and the substrates of their members remain undetermined. The amplification of the SP clusters across the Hemiascomycetes reflects adaptation to specific carbon and energy sources available in the habitat of each yeast species. (c) 2007 S. Karger AG, Basel.

Guanine nucleotide binding to the Bateman domain mediates the allosteric inhibition of eukaryotic IMP dehydrogenases

Science.gov (United States)

Buey, Rubén M.; Ledesma-Amaro, Rodrigo; Velázquez-Campoy, Adrián; Balsera, Mónica; Chagoyen, Mónica; de Pereda, José M.; Revuelta, José L.

2015-11-01

Inosine-5'-monophosphate dehydrogenase (IMPDH) plays key roles in purine nucleotide metabolism and cell proliferation. Although IMPDH is a widely studied therapeutic target, there is limited information about its physiological regulation. Using Ashbya gossypii as a model, we describe the molecular mechanism and the structural basis for the allosteric regulation of IMPDH by guanine nucleotides. We report that GTP and GDP bind to the regulatory Bateman domain, inducing octamers with compromised catalytic activity. Our data suggest that eukaryotic and prokaryotic IMPDHs might have developed different regulatory mechanisms, with GTP/GDP inhibiting only eukaryotic IMPDHs. Interestingly, mutations associated with human retinopathies map into the guanine nucleotide-binding sites including a previously undescribed non-canonical site and disrupt allosteric inhibition. Together, our results shed light on the mechanisms of the allosteric regulation of enzymes mediated by Bateman domains and provide a molecular basis for certain retinopathies, opening the door to new therapeutic approaches.

Occurrence, Distribution and Properties of Alfalfa Mosaic Virus

Directory of Open Access Journals (Sweden)

A.D. Zadjaii

2002-01-01

Full Text Available Alfalfa Mosaic Virus (AlflMV was recorded on 21 hosts comprising of four field crops, 14 vegetables, one ornamental plant and two new weed species (Heliotropium europaeum and Ammi majus belonging to nine families. The virus was identified and confirmed on the basis of its biological, serological (ELISA and physical properties. The leaves, stem and crown from systemically infected alfalfa plant contained high concentration of the virus. It was nonpersistently transmitted by cotton aphids (Aphis gossypii. The wide host range, including virus reservoirs, seed-borne infection and insect transmission account for high incidence and distribution of AlfMV in the country. The virus isolate had a dilution end point between 1 x 10-3 to l x 10-4, 65-67 °C thermal inactivation point and a few days in-vitro longevity and appears to be similar to the AlfMV-S strain.

The genus Baeturia Stål as represented in New Guinea (Homoptera, Cicadidae)

NARCIS (Netherlands)

Blöte, H.C.

1960-01-01

Until now only three species of the genus Baeturia have been recorded from New Guinea, viz., B. bicolorata Distant, B. viridicata Distant, and B. nana Jacobi. As I had the opportunity to study a fairly large collection of this group from different sources, collected in New Guinea, it appeared to me

Energetics of emergence in the cicadas, Cyclochila australasiae and Abricta curvicosta (Homoptera: Cicadidae).

Science.gov (United States)

Harvey, Prudence M; Thompson, Michael B

2006-09-01

The final moult in cicadas marks a major transition in lifestyle and is a behaviour that makes the cicada vulnerable to predation. Consequently, emergence times are short and, we predict, therefore the rate of energy consumption would be high. Hence, we measured the energetic cost of emergence in Cyclochila australasiae (green grocer) and Abricta curvicosta (floury baker) cicadas during the final moult from nymph to adult cicada. Maximum energy expended whilst emerging was compared between the sexes and species. Even though C. australasiae take longer to emerge than A. curvicosta, the mass-specific cost of emergence is not different between the two species (C. australasiae: 11.34+/-2.55 J g(-1); A. curvicosta: 12.91+/-1.90 J g(-1)). The mass-specific metabolic rates of fully emerged adults of both species are approximately twice those of the nymphs and the maximum metabolic rate during emergence is about 1.5 times higher than the resting metabolic rate of emerged adults. Emergence times, as indicated by rates of oxygen consumption, are longer than expected and probably reflect limitations in the oxygen capacity of the cicadas during moulting.

Influences of pea morphology and interacting factors on pea aphid (Homoptera: Aphididae) reproduction.

Science.gov (United States)

Buchman, N; Cuddington, K

2009-08-01

It has been claimed that plant architecture can alter aphid reproductive rates, but the mechanism driving this effect has not been identified. We studied interactions between plant architecture, aphid density, environmental conditions, and nutrient availability on the reproduction of pea aphids [Acyrthosiphon pisum (Harris)] using four near-isogenic peas (Pisum sativum L.) that differ in morphology. Manipulations of aphid density (1, 5, and 10 adults per plant) allowed us to examine any effects of plant morphology on crowding and consequently reproduction. Pea morphology per se did not alter pea aphid crowding, as measured by mean nearest neighbor distance, and there was no effect on reproduction. In addition, reproduction increased with increasing adult density, indicating positive density dependence. In a separate experiment, peas were fertilized to determine whether differences between nutrient availability of the four different morphologies might drive any observed differences in aphid reproduction. Although plant nitrogen content was altered by fertilization treatments, this did not have an impact on aphid reproduction. Greenhouse experiments, however, suggested that pea morphology can interact with environmental conditions to reduce aphid reproduction under some conditions. We conclude that plant morphology only influences aphid reproduction when environmental conditions are less than optimal.

Dinamika Populasi Diaphorina citri Kuwayama (Homoptera: Psyllidae dan Deteksi CVPD dengan Teknik PCR

Directory of Open Access Journals (Sweden)

I NYOMAN WIJAYA

2015-09-01

Full Text Available The research was conducted in the field of Taro village Gianyar regency and Katung village Bangli regency and at the Laboratory of Biotechnology Faculty of Agricultural Udayana University. The purpose of the research were to investigate population dynamic of Diaphorina citri Kuwayama and other insects that were assosiated with citrus cv. siam; and molecular detection of CVPD patogen in its vector, other phytophagous insects on citrus cv.siam and kemuning [Murraya paniculata (L. Jack.] The result of this study showed that in six month period there was one peak of D. citri population which was associated with the flushing period of citrus at Taro as well Katung villages. The peak of D. citri population of Taro village was higher than that of Katung village. Two species of parasitoids and four spesies of predators were found in the field and may contribute in the suppression of D. citri population. The parasitoids identified were Tamarixia radiata Wat. and Diaphorencyrtus alligharensi Shaffe, whereas the predators were Curinus coeruleus Mulsant, Phiddipus sp., Menochilus sexmaculatus Fabricius and Oxyopes javanus Thorell. T. radiata has been proven to be an effective nymph parasitoid that could suppress the population development of D. citri in citrus orchads. The research revealed that kemuning could serve as a source of infection because it is also a host of CVPD disease as well as of D. citri. Toxoptera citricidus Kirkaldy and Maleuterpes dentipes Hell. were not proven to contain CVPD disease.

The Hawaiian cave planthoppers (Homoptera: Fulgoroidea: Cixiidae - A model for rapid subterranean speciation?

Directory of Open Access Journals (Sweden)

Hannelore Hoch

1997-01-01

Full Text Available After the successful colonization of a single ancestral species in the Hawaiian Islands, planthoppers of the cixiid genus Oliarus underwent intensive adaptive radiation resulting in 80 described endemic species. Oliarus habitats range from montaneous rain forests to dry coastal biotopes and subterranean environments. At least 7 independant evolutionary lines represented by different species have adapted to lava tubes on Molokai (1, Maui (3, and Hawaii Island (3. Behavioral and morphological studies on one of these evolutionary lines on Hawaii Island, the blind, flight- and pigmentless Oliarus polyphentus have provided evidence for reproductive isolation between allopatric populations which may in fact be separate species. Significant differences in song parameters were observed even between populations from neighbouring lava tubes, although the planthoppers are capable of underground migration through the voids and cracks of the mesocavernous rock system which is extant in young basalt: after a little more than 20 years, lava tubes within the Mauna Ulu 1974 flow had been colonized by O. ‘polyphenius” individuals, most probably originating from a near-by forestkipuka. Amazingly, this species complex is found on the youngest of the Hawaiian Islands, with probably less than 0.5 m.y., which suggests rapid speciation processes. Field observations have led to the development of a hypothesis to match underground speciation with the dynamics of vegetational succession on the surface of active volcanoes. Planthopper range partitioning and geographic separation of populations by young lava flows, founder events and small population size may be important factors involved in rapid divergence.

Collective defense of Aphis nerii and Uroleucon hypochoeridis (Homoptera, Aphididae against natural enemies.

Directory of Open Access Journals (Sweden)

Manfred Hartbauer

2010-04-01

Full Text Available The prevalent way aphids accomplish colony defense against natural enemies is a mutualistic relationship with ants or the occurrence of a specialised soldier caste typical for eusocial aphids, or even both. Despite a group-living life style of those aphid species lacking these defense lines, communal defense against natural predators has not yet been observed there. Individuals of Aphis nerii (Oleander aphid and Uroleucon hypochoeridis, an aphid species feeding on Hypochoeris radicata (hairy cat's ear, show a behavioral response to visual stimulation in the form of spinning or twitching, which is often accompanied by coordinated kicks executed with hind legs. Interestingly, this behaviour is highly synchronized among members of a colony and repetitive visual stimulation caused strong habituation. Observations of natural aphid colonies revealed that a collective twitching and kicking response (CTKR was frequently evoked during oviposition attempts of the parasitoid wasp Aphidius colemani and during attacks of aphidophagous larvae. CTKR effectively interrupted oviposition attempts of this parasitoid wasp and even repelled this parasitoid from colonies after evoking consecutive CTKRs. In contrast, solitary feeding A. nerii individuals were not able to successfully repel this parasitoid wasp. In addition, CTKR was also evoked through gentle substrate vibrations. Laser vibrometry of the substrate revealed twitching-associated vibrations that form a train of sharp acceleration peaks in the course of a CTKR. This suggests that visual signals in combination with twitching-related substrate vibrations may play an important role in synchronising defense among members of a colony. In both aphid species collective defense in encounters with different natural enemies was executed in a stereotypical way and was similar to CTKR evoked through visual stimulation. This cooperative defense behavior provides an example of a surprising sociality that can be found in some aphid species that are not expected to be social at all.

Oxygenated phosphine fumigation for control of Nasonovia ribisnigri (Homoptera: Aphididae) on harvested lettuce.

Science.gov (United States)

Liu, Yong-Biao

2012-06-01

Low temperature regular phosphine fumigations under the normal oxygen level and oxygenated phosphine fumigations under superatmospheric oxygen levels were compared for efficacy against the aphid, Nasonovia ribisnigri (Mosley), and effects on postharvest quality of romaine and head lettuce. Low temperature regular phosphine fumigation was effective against the aphid. However, a 3 d treatment with high phosphine concentrations of > or = 2,000 ppm was needed for complete control of the aphid. Oxygen greatly increased phosphine toxicity and significantly reduced both treatment time and phosphine concentration for control of N. ribisnigri. At 1,000 ppm phosphine, 72 h regular fumigations at 6 degrees C did not achieve 100% mortality of the aphid. The 1,000 ppm phosphine fumigation under 60% O2 killed all aphids in 30 h. Both a 72 h regular fumigation with 2,200 ppm phosphine and a 48 h oxygenated fumigation with 1,000 ppm phosphine under 60% O2 were tested on romaine and head lettuce at 3 degrees C. Both treatments achieved complete control of N. ribisnigri. However, the 72 h regular fumigation resulted in significantly higher percentages of lettuce with injuries and significantly lower lettuce internal quality scores than the 48 h oxygenated phosphine fumigation. Although the oxygenated phosphine fumigation also caused injuries to some treated lettuce, lettuce quality remained very good and the treatment is not expected to have a significant impact on marketability of the lettuce. This study demonstrated that oxygenated phosphine fumigation was more effective and less phytotoxic for controlling N. ribisnigri on harvested lettuce than regular phosphine fumigation and is promising for practical use.

Avaliação de inseticidas no controle de Myzus persicae (sulz. (homoptera: aphididae na cultura da alface Evaluation of insecticides to control Myzus persicae (Sulz (Homoptera: Aphididae on lettuce crop

Directory of Open Access Journals (Sweden)

Jeferson Zagonel

2002-09-01

Full Text Available Foi avaliada a eficiência de inseticidas no controle de Myzus persicae (Sulz. na cultura da alface, cv. Verônica, em experimento conduzido na UEPG, em 1999. Usou-se delineamento experimental de blocos ao acaso com seis tratamentos e quatro repetições. Os tratamentos constaram de thiamethoxam nas doses de 50; 75 e 100 g i.a./ha; imidacloprid na dose de 140 g i.a./ha; pymetrozine na dose de 150 g i.a./ha e testemunha sem pulverização. Os tratamentos foram aplicados nas mudas em bandejas, um dia antes do transplantio. Avaliou-se a fitotoxicidade, o número de pulgões por planta, a porcentagem de plantas com pulgões e a eficiência dos inseticidas. O thiamethoxam nas doses de 50; 75 e 100 g i.a./ha foi eficiente no controle de M. persicae durante todo o ciclo, mostrando eficiência igual ou superior a 98,6%, similar ao imidacloprid. O pymetrozine apresentou eficiência no controle de M. persicae até 21 dias após o transplante das mudas. Os inseticidas não causaram efeitos fitotóxicos nas plantas de alface; além disso, houve produção de plantas com maior massa fresca em relação à testemunha.A field trial was carried out at Universidade Estadual de Ponta Grossa, State of Paraná, Brazil, in 1999, to evaluate the efficiency of insecticides in controlling Myzus persicae (Sulz on lettuce cv. Veronica. The experimental design was of completely randomized blocks with six treatments and four replications. The treatments consisted of thiamethoxam (50; 75 and 100 g i.a/ha imidacloprid (140 g i.a/ha; pymetrozine (150 g i.a/ha and control. The treatments were applied to seedlings grown in polyestyrene trays one day before the transplanting. The fitotoxicity, the number of aphids/plant, the percentage of plants with aphids and the efficiency of the insecticides were evaluated. Thiamethoxan at doses of 50; 75 and 100 g i.a/ha was efficient to control M. persicae from transplanting till 43 days after showing equal or higher efficiency than 98.6%, similar to imidacloprid. The pymetrozine was efficient to control M. persicae until 21 days after transplanting. Effects of fitotoxicity on lettuce plants were not observed. Higher fresh weight was observed in treated plants in comparison to the one of the control.

Evaluation and application of parasitoids for biological control of Aphis gossypii in glasshouse cucumber crops

NARCIS (Netherlands)

Steenis, van M.

1995-01-01

Introduction
Aphids are an important problem in glasshouse vegetables. Already at low aphid densities fruits can get contaminated with honeydew, which decreases the economical value of the fruits. When aphids feed on the growing tips of the plants, the new shoots can get heavily

Putting science at the heart of European policy

CERN Multimedia

2015-01-01

One year ago, the incoming European Commission President Jean-Claude Juncker shocked the scientific world by scrapping the post of Chief Scientific Advisor. This week, the Commission made amends by launching a well-considered Scientific Advisory Mechanism (SAM) that not only puts science back at the heart of policy, but does so in a much more structured and robust way than conferring such responsibility on a single individual.     The SAM has two independent strands: an advisory group of seven scientists, and funding through the Horizon 2020 programme for national academies and learned societies to network and collaborate on policy issues. Both are backed up by a secretariat at Commission headquarters in Brussels. When Mr Juncker scrapped the role of Chief Scientific Advisor, it was against a backdrop of sometimes vitriolic attacks on the incumbent, Anne Glover, due to her outspoken views on GMOs. Mr Juncker’s move was seen by some as simply giving in to a powerful lob...

International Conference on Recent Developments in Operator Theory and Its Applications

CERN Document Server

Lancaster, P; Shivakumar, P

1996-01-01

The present volume contains the proceedings of the International Conference on Ap­ plications of Operator Theory held in Winnipeg, Canada (October 2nd to 6th, 1994), which was organized by the Institute of Industrial Mathematical Sciences (IIMS) of the University of Manitoba. At this conference 92 participants representing 15 countries par­ ticipated, and 64 papers were presented. This meeting was the second of a linked pair. The first was a program of advanced instruction held at the Fields Institute, Ontario, followed by a research conference. The first of these events gave rise to the volume "Lectures on Operator Theory and its Applications", published by the American Mathematical Society for the Fields Institute in 1995. These two events were the creation of the following Program Committee: M. A. Dahleh (M. I. T. ) P. A. Fillmore (Dalhousie) B. A. Francis (Toronto) F. Ghahramani (Manitoba) K. Glover (Cambridge) I. Gohberg (Tel Aviv) T. Kailath (Stanford) P. Lancaster (Calgary), Chair H. Langer (Vienna) ...

Empirical models for the estimation of global solar radiation with sunshine hours on horizontal surface in various cities of Pakistan

International Nuclear Information System (INIS)

Gadiwala, M.S.; Usman, A.; Akhtar, M.; Jamil, K.

2013-01-01

In developing countries like Pakistan the global solar radiation and its components is not available for all locations due to which there is a requirement of using different models for the estimation of global solar radiation that use climatological parameters of the locations. Only five long-period locations data of solar radiation data is available in Pakistan (Karachi, Quetta, Lahore, Multan and Peshawar). These locations almost encompass the different geographical features of Pakistan. For this reason in this study the Mean monthly global solar radiation has been estimated using empirical models of Angstrom, FAO, Glover Mc-Culloch, Sangeeta & Tiwari for the diversity of approach and use of climatic and geographical parameters. Empirical constants for these models have been estimated and the results obtained by these models have been tested statistically. The results show encouraging agreement between estimated and measured values. The outcome of these empirical models will assist the researchers working on solar energy estimation of the location having similar conditions

Internet-based interface for STRMDEPL08

Science.gov (United States)

Reeves, Howard W.; Asher, A. Jeremiah

2010-01-01

The core of the computer program STRMDEPL08 that estimates streamflow depletion by a pumping well with one of four analytical solutions was re-written in the Javascript software language and made available through an internet-based interface (web page). In the internet-based interface, the user enters data for one of the four analytical solutions, Glover and Balmer (1954), Hantush (1965), Hunt (1999), and Hunt (2003), and the solution is run for constant pumping for a desired number of simulation days. Results are returned in tabular form to the user. For intermittent pumping, the interface allows the user to request that the header information for an input file for the stand-alone executable STRMDEPL08 be created. The user would add the pumping information to this header information and run the STRMDEPL08 executable that is available for download through the U.S. Geological Survey. Results for the internet-based and stand-alone versions of STRMDEPL08 are shown to match.

4th Optimization Day

CERN Document Server

Eberhard, Andrew; Ralph, Daniel; Glover, Barney M

1999-01-01

Although the monograph Progress in Optimization I: Contributions from Aus­ tralasia grew from the idea of publishing a proceedings of the Fourth Optimiza­ tion Day, held in July 1997 at the Royal Melbourne Institute of Technology, the focus soon changed to a refereed volume in optimization. The intention is to publish a similar book annually, following each Optimization Day. The idea of having an annual Optimization Day was conceived by Barney Glover; the first of these Optimization Days was held in 1994 at the University of Ballarat. Barney hoped that such a yearly event would bring together the many, but widely dispersed, researchers in Australia who were publishing in optimization and related areas such as control. The first Optimization Day event was followed by similar conferences at The University of New South Wales (1995), The University of Melbourne (1996), the Royal Melbourne Institute of Technology (1997), and The University of Western Australia (1998). The 1999 conference will return to Ballarat ...

Araucaria forest management by the liocourt method, Painel municipality, SC

Directory of Open Access Journals (Sweden)

André Felipe Hess

2014-12-01

Full Text Available The aim of this study was to describe the diameter distribution and calculate the value of the Liocourt quotient 'q' for the species Araucaria angustifolia (Bertol. Kuntze in natural forest, as well as evaluating competition indexes in a fragment with an area of 74.2 ha. Fixed area sample plots of 400 m2 were used in this study, totaling one hectare sampling area. Trees with DBH > 10 cm were measured in all plots and later distributed in diameter classes for the calculation of the density probability function and competition index. The forest showed a density of 228 trees per hectare and basal area of 19.49 m2·ha-1. The value of the "q" quotient for the forest was 1.1, indicating that the recruitment and mortality rates are in equilibrium. The calculated competition indices showed that the forest is in a competition stage, with Glover and Holl index of 0.9798 and 0.7069 m2 for the BALmod.

Are cicadas (Diceroprocta apache) both a "keystone" and a "critical-link" species in lower Colorado River riparian communities?

Science.gov (United States)

Andersen, Douglas C.

1994-01-01

Apache cicada (Homoptera: Cicadidae: Diceroprocta apache Davis) densities were estimated to be 10 individuals/m2 within a closed-canopy stand of Fremont cottonwood (Populus fremontii) and Goodding willow (Salix gooddingii) in a revegetated site adjacent to the Colorado River near Parker, Arizona. Coupled with data drawn from the literature, I estimate that up to 1.3 cm (13 1/m2) of water may be added to the upper soil layers annually through the feeding activities of cicada nymphs. This is equivalent to 12% of the annual precipitation received in the study area. Apache cicadas may have significant effects on ecosystem functioning via effects on water transport and thus act as a critical-link species in this southwest desert riverine ecosystem. Cicadas emerged later within the cottonwood-willow stand than in relatively open saltcedar-mesquite stands; this difference in temporal dynamics would affect their availability to several insectivorous bird species and may help explain the birds' recent declines. Resource managers in this region should be sensitive to the multiple and strong effects that Apache cicadas may have on ecosystem structure and functioning.

Isolation and in vitro cultivation of the aphid pathogenic fungus Entomophthora planchoniana.

Science.gov (United States)

Freimoser, F M; Jensen, A B; Tuor, U; Aebi, M; Eilenberg, J

2001-12-01

Entomophthora planchoniana is an important fungal pathogen of aphids. Although Entomophthora chromaphidis has been considered a synonym for E. planchoniana, the two species are now separated, and E. planchoniana is reported not to grow in vitro. In this paper, we describe for the first time the isolation and cultivation of this species. Entomophthora planchoniana was isolated from a population of Ovatus crataegarius (Homoptera, Aphididae), which was infected by E. planchoniana only. The isolates did not sporulate, but the sequence of the small subunit rDNA and the restriction fragment length polymorphism patterns of the first part of the large subunit rDNA and the ITS II region confirm that the isolates were E. planchoniana. The isolated fungus grew in a medium consisting of Grace's insect cell culture medium supplemented with lactalbumin hydrolysate, yeastolate, and 10% fetal bovine serum or in GLEN medium with 10% fetal bovine serum. Vegetative cells of E. planchoniana were long and club-shaped and did not stain with Calcofluor, thus suggesting that they were protoplasts.

Arthropod prey of Wilson's Warblers in the understory of Douglas-fir forests

Science.gov (United States)

Hagar, J.C.; Dugger, K.M.; Starkey, E.E.

2007-01-01

Availability of food resources is an important factor in avian habitat selection. Food resources for terrestrial birds often are closely related to vegetation structure and composition. Identification of plant species important in supporting food resources may facilitate vegetation management to achieve objectives for providing bird habitat. We used fecal analysis to describe the diet of adult Wilson's Warblers (Wilsonia pusilla) that foraged in the understory of Douglas-fir (Pseudotsuga menziesii) forests in western Oregon during the breeding season. We sampled arthropods at the same sites where diet data were collected, and compared abundance and biomass of prey among seven common shrub species. Wilson's Warblers ate more caterpillars (Lepidoptera larvae), flies (Diptera), beetles (Coleoptera), and Homoptera than expected based on availability. Deciduous shrubs supported higher abundances of arthropod taxa and size classes used as prey by Wilson's Warblers than did evergreen shrubs. The development and maintenance of deciduous understory vegetation in conifer forests of the Pacific Northwest may be fundamental for conservation of food webs that support breeding Wilson's Warblers and other shrub-associated, insectivorous songbirds.

Diet of Wilson's warblers and distribution of arthropod prey in the understory of Douglas-fir forests

Science.gov (United States)

Hagar, Joan C.; Dugger, Kate; Starkey, Edward E.

2007-01-01

Availability of food resources is an important factor in avian habitat selection. Food resources for terrestrial birds often are closely related to vegetation structure and composition. Identification of plant species important in supporting food resources may facilitate vegetation management to achieve objectives for providing bird habitat. We used fecal analysis to describe the diet of adult Wilson's Warblers (Wilsonia pusilla) that foraged in the understory of Douglas-fir (Pseudotsuga menziesii) forests in western Oregon during the breeding season. We sampled arthropods at the same sites where diet data were collected, and compared abundance and biomass of prey among seven common shrub species. Wilson's Warblers ate more caterpillars (Lepidoptera larvae), flies (Diptera), beetles (Coleoptera), and Homoptera than expected based on availability. Deciduous shrubs supported higher abundances of arthropod taxa and size classes used as prey by Wilson's Warblers than did evergreen shrubs. The development and maintenance of deciduous understory vegetation in conifer forests of the Pacific Northwest may be fundamental for conservation of food webs that support breeding Wilson's Warblers and other shrub-associated, insectivorous songbirds.

Entomofauna associated to horticultural crops under organic and conventional practices in Cordoba, Argentina

International Nuclear Information System (INIS)

Zalazar, Laura; Salvo, Adriana

2007-01-01

Farming practices and the addition of chemical synthetic substances in conventional agroecosystems are detrimental mainly to natural enemies of phytophagous insects, diminishing the natural regulation of pest insects. On the other hand, in organic agriculture, biological processes and care of the environment are favoured, hence an increase in insect biodiversity is predicted in this type of systems. In this work, abundance, richness of insects and proportion of functional groups were compared through a single quantitative sampling of insects in horticultural crop fields, three under organic and three under conventional management practices. Insect species richness, total and for guilds (phytophagous and entomophagous insects) were significantly higher in organic orchards, and also was the abundance of entomophagous insects. Richness and abundance of all insect orders (with exception of Homoptera abundance), were higher in orchards under organic management, being significant the differences for richness of Coleoptera and richness and abundance of Hymenoptera. Similar tendencies were observed in data obtained through sweep net in weeds. These results suggest that organic practices increase the diversity of species, particularly that of natural enemies. (author)

Entomofauna associated to horticultural crops under organic and conventional practices in Cordoba, Argentina; Entomofauna asociada a cultivos horticolas organicos y convencionales en Cordoba, Argentina

Energy Technology Data Exchange (ETDEWEB)

Zalazar, Laura; Salvo, Adriana [Universidade Nacional de Cordoba (Argentina). Facultad de Ciencias Exactas Fisicas y Naturales. Centro de Investigaciones Entomologicas de Cordoba (CIEC)

2007-09-15

Farming practices and the addition of chemical synthetic substances in conventional agroecosystems are detrimental mainly to natural enemies of phytophagous insects, diminishing the natural regulation of pest insects. On the other hand, in organic agriculture, biological processes and care of the environment are favoured, hence an increase in insect biodiversity is predicted in this type of systems. In this work, abundance, richness of insects and proportion of functional groups were compared through a single quantitative sampling of insects in horticultural crop fields, three under organic and three under conventional management practices. Insect species richness, total and for guilds (phytophagous and entomophagous insects) were significantly higher in organic orchards, and also was the abundance of entomophagous insects. Richness and abundance of all insect orders (with exception of Homoptera abundance), were higher in orchards under organic management, being significant the differences for richness of Coleoptera and richness and abundance of Hymenoptera. Similar tendencies were observed in data obtained through sweep net in weeds. These results suggest that organic practices increase the diversity of species, particularly that of natural enemies. (author)

Alimentação e fator de condição de peixes characidiíneos no sistema do Ribeirão Grande, Sudeste do Brasil - DOI: 10.4025/actascibiolsci.v27i3.1336 Feeding and condition factor of characidiin fish in Ribeirão Grande system, Southeastern Brazil - DOI: 10.4025/actascibiolsci.v27i3.1336

Directory of Open Access Journals (Sweden)

Francisco Manoel de Souza Braga

2005-03-01

Full Text Available Os peixes foram amostrados quatro vezes em cada local, de julho de 2001 a abril de 2002: inverno (julho de 2001, primavera (outubro de 2001, verão (fevereiro de 2002 e outono (abril de 2002. Foram amostrados segmentos de cinco riachos no sistema do Ribeirão Grande (22o 47’ 08’’ S, 45o 28’ 17’’W. Coletas quantitativas foram feitas com um aparelho de pesca-elétrica ligado a um gerador com capacidade máxima de 1.500 V e 8,7 A de 600 Hz de corrente alternada. Alimentação, mudanças na gordura visceral e fator de condição foram comparados em duas espécies de characidiíneos, Characidium lauroi e C. Alipioi do sistema do Ribeirão Grande, sudeste do Brasil. Nas dietas das duas espécies ninfas de Ephemeroptera, foram registradas larvas de Diptera (Chironomidae, Simuliidae, ninfas de Plecoptera, larvas de Trichoptera (Hydroptilidae, Psychoyiidae, insetos terrestres (Coleoptera, Isoptera, Hemiptera [Heteroptera, Homoptera], larvas de Megaloptera (Corydalidae, Arachnida, Ostracoda e restos vegetais. A gordura visceral decresceu em fevereiro, coincidindo com o declínio do fator de condição em ambas as espécies. O aumento da atividade alimentar durante o verão proporciona o acúmulo de gordura. Durante as estações seguintes, esses peixes devem utilizar as reservas de gordura visceral para manutenção e reproduçãoFeeding, seasonal changes in visceral fat and condition factor were compared in two species of characidiin fishes, Characidium lauroi and C. alipioi from Ribeirão Grande system, southeastern Brazil. Five streams of Ribeirão Grande system were sampled (22o 47’ 08’’ S, 45o 28’ 17’’W. The samples were taken four times per site, from July, 2001 to April, 2002: winter (July 2001, spring (October 2001, summer (February 2002 and autumn (April 2002. Quantitative collections were made with an electro-fishing device powered by a generator with maximum capacity of 1,500 V and 8.7 A of 60 Hz alternating current

Radiation sterilization of the greenhouse white fly (Trialeurodes vaporariorum Westw., Homoptera, Aleyrodidae). Part 2

International Nuclear Information System (INIS)

Genchev, N.

1987-01-01

Results are reported of studies of the sterilizing effect on puparia and imagoes of the greenhouse white fly (T. vaporariorum). The irradiation was made by gamma rays at the rate of 12+-5% rad/s. The parameters of radiation-induced sterility were sex determined. The sterilizing effect was expressed in emergence of dominant lethal mutations in spermatozoa accompanied by partial sperm inactivation and of partial aspermia. The absolute sterilizing doses for the two ontogenetic stage are 6 and 7 krad respectively. Radiation induced sterilization of the male parent resulted in forced arrhenotoky in F 1 and was regarded as a transformation of parthogenesis factor necessary for the normal propagation in the insect process into one that is lethal to the population factor. Radiation induced female sterility in females was expressed in the emergence of dominant lethals in oocytes. The absolute sterilizing doses for the puparium and the imago were 5 and 6 krad, respectively. Doses ≥4 krad caused partial infertility

Bioacoustic investigations and taxonomic considerations on the Cicadetta montana species complex (Homoptera: Cicadoidea: Tibicinidae

Directory of Open Access Journals (Sweden)

Matija Gogala

2004-06-01

Full Text Available Recent bioacoustic investigations have shown that Cicadetta montana Scopoli 1772 is a complex of morphologically similar sister species that are best characterized by their song patterns. At the type locality of C. montana, only mountain cicadas with simple, long lasting song phrases were heard, recorded and collected. Therefore, we have good reasons to suggest that this type of song is characteristic for C. montana s. str. Boulard described a song of C. montana from France with phrases composed of a long and a short echeme; this type of song is characteristic for cicadas morphologically corresponding to C. montana var. brevipennis Fieber 1876; we suggest to raise this taxon to species level. On the basis of specific song, Puissant and Boulard described C. cerdaniensis from Pyrénées. A similar case was the discovery and description of C. montana macedonica Schedl 1999 from Macedonia; since these Macedonian cicadas are sympatric with at least two other cryptic species in the C. montana group and molecular investigations showed substantial genetic differences between C. macedonica and C. montana or C. brevipennis, we conclude that this taxon should also be raised to species level. Songs of closely related C. podolica and Korean mountain cicada are presented as well.Pesquisas recentes de bioacústica mostraram que Cicadetta montana Scopoli 1772 é um complexo de espécie-irmãs morfologicamente semelhantes e melhor caracterizadas por seus padrões de canto. Na localidade-tipo de C. montana somente cigarras serranas de longas frases de canto foram ouvidas, gravadas e coletadas. Portanto, temos boas razões para propor este tipo de canto como característico de C. montana s. str. Boulard descreveu um canto de C. montana da França com frases compostas de uma estridulação longa e uma curta; este tipo de canto é característico das cigarras correspondendo morfologicamente a C. montana var. brevipennis Fieber 1876; sugerimos elevar este táxon ao nível de espécie. Baseando-se nos cantos específicos, Puissant e Boulard descreveram C. cerdaniensis dos Pirineus. Um caso similar foi a descoberta e descrição de C. montana macedonica Schedl 1999 da Macedônia; desde que essas cigarras macedônicas são simpátricas com pelo menos duas outras espécies crípticas dentro do grupo C. montana e as análises moleculares mostraram diferenças genéticas substanciais entre C. montana e C. brevipennis, concluímos que este táxon também deve ser elevado ao nível de espécie. Cantos de espécies próximas, C. podolica e a cigarra serrana da Korea, são também apresentados.

Ultralow oxygen treatment for postharvest control of Nasonovia ribisnigri (Homoptera: Aphididae) on iceberg lettuce.

Science.gov (United States)

Liu, Yong-Biao

2005-12-01

The aphid Nasonovia ribisnigri (Mosley) is a common pest of lettuce in the United States. It hinders export of U.S. lettuce to the overseas market such as Japan where it is a quarantined pest. Ultralow oxygen treatments were studied for control of the insect on iceberg lettuce. Small-scale ultralow oxygen treatments in plastic jars were conducted at 1, 5, and 10 degrees C for different durations to determine effective treatment against nymphs and alates of N. ribisnigri. At oxygen levels of 0.015-0.025%, N. ribisnigri can be controlled in 3 d at 1 degrees C, 2 d at 5 degrees C, and 1 d at 10 degrees C. Large-scale ultralow oxygen treatments were conducted in bulk container treatment chambers with commercial iceberg lettuce heads for 2 d at 6 degrees C with oxygen levels of 0.015 and 0.025% and for 3 d at 3 degrees C with oxygen level of 0.015%. All treatments achieved complete control of N. ribisnigri. No negative impact on lettuce quality was detected after 2 wk of posttreatment storage. Therefore, the selected treatments have potential to be commercially developed for postharvest control of N. ribisnigri on iceberg lettuce.

Biology and taxonomy of Tuthillia cognata (Homoptera : Psylloidea), a pest on Myrciaria dubia (Myrtaceae)

OpenAIRE

Burckhardt, D.; Couturier, Guy

1988-01-01

#Tuthillia cognata$ est découvert comme ravageur de #Myrciaria dubia$ (#Myrtaceae$) au Pérou et Brésil. Tenant compte de la morphologie de la larve, le genre est transféré des #Ciriacreminae$ dans les #Anomoneurinae$. (Résumé d'auteur)

Optimising mobile phase composition, its flow-rate and column temperature in HPLC using taboo search.

Science.gov (United States)

Guillaume, Y C; Peyrin, E

2000-03-06

A chemometric methodology is proposed to study the separation of seven p-hydroxybenzoic esters in reversed phase liquid chromatography (RPLC). Fifteen experiments were found to be necessary to find a mathematical model which linked a novel chromatographic response function (CRF) with the column temperature, the water fraction in the mobile phase and its flow rate. The CRF optimum was determined using a new algorithm based on Glover's taboo search (TS). A flow-rate of 0.9 ml min(-1) with a water fraction of 0.64 in the ACN-water mixture and a column temperature of 10 degrees C gave the most efficient separation conditions. The usefulness of TS was compared with the pure random search (PRS) and simplex search (SS). As demonstrated by calculations, the algorithm avoids entrapment in local minima and continues the search to give a near-optimal final solution. Unlike other methods of global optimisation, this procedure is generally applicable, easy to implement, derivative free, conceptually simple and could be used in the future for much more complex optimisation problems.

Interpersonal rivalries, gender and the intellectual and scientific making of psychoanalysis in 1940s Britain.

Science.gov (United States)

Shapira, Michal

2017-05-01

This article examines the 1940s debates regarding the status and professional orthodoxy of psychoanalysis following Sigmund Freud's death, by exploring the Anna Freud-Melanie Klein Controversial Discussions in the British Psychoanalytical Society. Focusing on the work of now-forgotten analysts Melitta Schmideberg and Edward Glover, and on their relationship with Klein and her supporters, the article reveals how these neglected, yet important, debates were complicated by interpersonal and professional ties, processes of the professionalization, and changing gender norms. Although historians of psychoanalysis have not ignored the jealousies, resentments, and complex relationships between psychoanalysts, these scholars often continue to view these as separate from the processes of creating science. Here, instead, I view the personal and the intellectual in tandem, thus challenging the divide between scientific reason and affect. Rather than imposing a separation between the scientific and the personal, I suggest that we should explore how historical actors negotiated the divide themselves. Indeed, I demonstrate that the study of interpersonal contexts is an invaluable tool for understanding the development of psychological disciplines. (PsycINFO Database Record (c) 2017 APA, all rights reserved).

Scoping Study: Networked Microgrids.

Energy Technology Data Exchange (ETDEWEB)

Trinklei, Eddy; Parker, Gordon; Weaver, Wayne; Robinett, Rush; Babe Gauchia, Lucia; Ten, Chee-Wooi; Bower, Ward; Glover, Steven F.; Bukowski, Steve

2014-10-01

This report presents a scoping study for networked microgrids which are defined as "Interoperable groups of multiple Advanced Microgrids that become an integral part of the electricity grid while providing enhanced resiliency through self-healing, aggregated ancillary services, and real-time communication." They result in optimal electrical system configurations and controls whether grid-connected or in islanded modes and enable high penetrations of distributed and renewable energy resources. The vision for the purpose of this document is: "Networked microgrids seamlessly integrate with the electricity grid or other Electric Power Sources (EPS) providing cost effective, high quality, reliable, resilient, self-healing power delivery systems." Scoping Study: Networked Microgrids September 4, 2014 Eddy Trinklein, Michigan Technological University Gordon Parker, Michigan Technological University Wayne Weaver, Michigan Technological University Rush Robinett, Michigan Technological University Lucia Gauchia Babe, Michigan Technological University Chee-Wooi Ten, Michigan Technological University Ward Bower, Ward Bower Innovations LLC Steve Glover, Sandia National Laboratories Steve Bukowski, Sandia National Laboratories Prepared by Michigan Technological University Houghton, Michigan 49931 Michigan Technological University

Anagrus breviphragma Soyka Short Distance Search Stimuli

Directory of Open Access Journals (Sweden)

Elisabetta Chiappini

2015-01-01

Full Text Available Anagrus breviphragma Soyka (Hymenoptera: Mymaridae successfully parasitises eggs of Cicadella viridis (L. (Homoptera: Cicadellidae, embedded in vegetal tissues, suggesting the idea of possible chemical and physical cues, revealing the eggs presence. In this research, three treatments were considered in order to establish which types of cue are involved: eggs extracted from leaf, used as a control, eggs extracted from leaf and cleaned in water and ethanol, used to evaluate the presence of chemicals soluble in polar solvents, and eggs extracted from leaf and covered with Parafilm (M, used to avoid physical stimuli due to the bump on the leaf surface. The results show that eggs covered with Parafilm present a higher number of parasitised eggs and a lower probing starting time with respect to eggs washed with polar solvents or eggs extracted and untreated, both when the treatments were singly tested or when offered in sequence, independently of the treatment position. These results suggest that the exploited stimuli are not physical due to the bump but chemicals that can spread in the Parafilm, circulating the signal on the whole surface, and that the stimuli that elicit probing and oviposition are not subjected to learning.

Food habits of the southwestern willow flycatcher during the nesting season

Science.gov (United States)

Drost, Charles A.; Paxton, Eben H.; Sogge, Mark K.; Whitfield, Mary J.

2003-01-01

The food habits and prey base of the endangered Southwestern Willow Flycatcher (Empidonax traillii extimus) are not well known. We analyzed prey remains in 59 fecal samples from an intensively-studied population of this flycatcher at the Kern River Preserve in southern California. These samples were collected during the nesting season in 1996 and 1997 from adults caught in mist nets, and from nestlings temporarily removed from the nest for banding. A total of 379 prey individuals were identified in the samples. Dominant prey taxa, both in total numbers and in percent occurrence, were true bugs (Hemiptera), flies (Diptera), and beetles (Coleoptera). Leafhoppers (Homoptera: Cicadellidae), spiders (Araneae), bees and wasps (Hymenoptera), and dragonflies and damselflies (Odonata) were also common items. Diet composition was significantly different between years, due to a large difference in the numbers of spiders between 1996 and 1997. There was also a significant difference between the diet of young and adults, with the diet of young birds having significantly higher numbers of odonates and beetles. There was a trend toward diet differences between males and females, but this was not significant at the P = 0.05 level.

Búsqueda y reconocimiento de los enemigos naturales y hospedantes alternos de las principales plagas. En flores bajo invernadero en la sabana de Bogotá

Directory of Open Access Journals (Sweden)

Martha E. Andrade

1989-01-01

Full Text Available Las plagas que atacan cultivos de llores bajo invernadero son cada vez más importantes por la gravedad de su daño y por la alta densidad con que suelen presentarse. Para su control se ha acudido principalmente a la utilización de productos químicos, lo cual conduce a un aumento en los costos de producción, a contaminar el medio ambiente, a afectar la salud humana y a crear resistencia de los insectos a los insecticidas. Debido a esto, es necesario incluír dentro de los programas de control a los reguladores naturales de las plagas: parasitoides, depredadores y microorganismos entornógenos. En el presente trabajo se registran los enemigos naturales más importantes de las principales plagas en llores bajo invernadero (crisantemo, rosa y clavel: Liriomyza huidobrensis Blanchard, L. trifolii Burgess (Diptera: Agrornyzídae; Myzuz persicae Sulzer (Homoptera: Aphididae; Tetranychus urticae Koch y T. cinnabarinus Boísduval (Acarina: Tetranychidae; también se señalan las plantas hospedantes alternas presentes en las localidades donde se realizó la investigación.

A survey of syrphid predators of Nasonovia ribisnigri in organic lettuce on the central coast of California.

Science.gov (United States)

Smith, Hugh A; Chaney, William E

2007-02-01

Organic lettuce, Lactuca sativa L., producers on California's Central Coast rely on endemic syrphid flies (Diptera: Syrphidae) to suppress populations of Nasonovia ribisnigri Mosley (Homoptera: Aphididae) and other aphids affecting lettuce. Growers are using various forms of habitat manipulation to enhance biological control. We surveyed syrphids collected from organic romaine in and around the Salinas Valley from March through September 2005 to gain a better understanding of the species responsible for aphid suppression and to examine possible implications for biocontrol. The primary species of syrphid fly reared were Toxomerus marginatus (Say) (39%), Platycheirus stegnus (Say) (27%), Sphaerophoria sulfuripes (Thomson) (13%), and Allograpta obliqua (Say) (10%). Syrphus opinator Osten Sacken (2%), Toxomerus occidentalis (Curran) (1.3%), and Eupeodes volucris Osten Sacken (1%) were less common. Sphaerophoria pyrrhina Bigot, Scaeva pyrastri (L.), Platycheirus obscurus Say, Allograpta exotica Wiedemann, and Eupeodes americanus Wiedemann each made up aphids. P. stegnus was observed to deposit in clusters of eggs, and was only reared in significant numbers from highly infested fields. Approximately 5% of syrphid larvae overall were parasitized by either Diplazon sp. (Hymenoptera: Ichneumonidae) or Pachyneuron sp. (Hymenoptera: Pteromalidae).

Annual Fire, Mowing and Fertilization Effects on Two Cicada Species (Homoptera: Cicadidae) in Tallgrass Prairie

Science.gov (United States)

Mac A. Callaham; Matt R. Whiles; John M. Blair

2002-01-01

In tallgrass prairie, cicadas emerge annually, are abundant and their emergence can be an important flux of energy and nutrients. However, factors influencing the distribution and abundance of these cicadas are virtually unknown. We examined cicada emergence in plots from a long-term (13 y) experimental manipulation involving common tallgrass prairie management...

The tribe Acutalini Fowler (Homoptera, Membracidae, Smiliinae: new genera, new species and some nomenclatural changes

Directory of Open Access Journals (Sweden)

Albino M Sakakibara

1997-09-01

Full Text Available The tribe Acutalini Fowler is redescribed as well as the genera Acutalis Fairmaire, Euritea Stål, and Thrasymedes Kirkaldy. The following new taxa and nomenclatural changes are presented: Thrasymedes mexicana sp.n. (from Mexico, Oaxaca; Bordonia gen.n., with B. venezuelana sp.n. (type-species (from Venezuela, Portachuelo, B. clypeata sp.n. (from Colombia, Cuesta Boba, B. majuscula sp.n. (from Venezuela, Portachuelo, and Cornutalis gen.n., with C. cauca sp.n. (type-species (from Colombia, Cauca, and C. validu sp.n. (from Ecuador, Sto. Domingo. Acutalis fusconervosa Fairmaire, 1846 = Horiola venosa Walker, 1858, syn.n.; Euritea munda (Walker, 1858 = Stictolobus nitidus Funkhouser, 1940, syn.n.; Bordonia nigricosta (Goding, 1926, comb.n.; Bordonia virescens (Funkhouser, 1940, comb.n.. One species is transferred to Smiliinae-Ceresini: Tapinolobus curvispina (Walker, 1858, comb.n. (formerly in Thrasymedes = Tapinolobus fasciatus Sakakibara, 1969, syn.n.; another one is transferred to Darninae-Cymbomorphini: Eumela darnioides (Walker, 1858, comb.n. (formerly in Euritea.

Distributional patterns and possible origins of the tribes and genera of Coelidiinae (Homoptera, Membracoidea, Cicadellidae

Directory of Open Access Journals (Sweden)

Mervin W Nielson

2000-12-01

Full Text Available Leafhoppers are well known biological indicators of zoogeographical regions owing, in part, to their phytodependency, high host plant specificity and relatively low vagility. In this connection, we discuss distributional patterns and possible zoogeographical origins of nine constituent tribes and their genera of the pantropical subfamily Coelidiinae. Among 118 known genera, only eight currently occupy more than one zoogeographical region, indicating an extremely high endemic profile which supports the proposed centers of origin and relatively low rate of intercontinental dispersal. The pantropical tribe Coelidiini is suggested as the basal group of the subfamily which is believed to have arisen prior to continental drift (late Jurassic-early Cretaceous because there appears to be no other evidence at the present time to explain its near cosmopolitan distribution. Possible origins of three Old World tribes, Hikangiini (Ethiopian, Thagriini (Oriental and Thanini (Australian and four New World -(Neotropical tribes, Teruliini, Tinobregmini, Gabritini and Sandersellini are elucidated. The tribe Youngolidiini occupies the Neotropical and Ethiopian realms but its origin is problematical. There appears to be ample evidence that origin/dispersal patterns are related to the geological history of the areas occupied by its faunal members.

Appearance of cicada fauna (Homoptera: Cicadoidea) by altitudes in Johor National Park, Mount Ledang, Johor

Science.gov (United States)

Tahir, Aliadi Mohd; Sulaiman, Azman

2015-09-01

A total of 31 cicada species in 15 genera under two families (Cicadidae, 27 species in 11 genera; Tibicinidae, four species in three genera) was recorded for Johor National Park, Mount Ledang, Johor. This was based on 666 individuals were obtained through six sampling occasions in November 2012 until October 2013, each time using light trap set in six sampling locations (L1, L2, L3, L4a, L4b, L4c) that were selected based on altitudes. The most common and abundant species in L1 is Pomponia sp1 and recognized as new species that need to be described as new to science. Orientopsaltria saudarapadda Duffles & Zaidi appeared as the most common and abundant species in L2, represented by 21 individuals which covers 34.43 % of the total cicadas specimen in that area. In the location of L3, Dundubia vaginata (Fabricius) appeared as the most abundant species represented by 37 individuals or 26.81% while Abroma maculicollis Guerin appeared as the most common species. Shannon's Species Diversity Index (H') in L3 was the highest (H'=2.28) followed by L4b (H'=2.21), L2 (H'=1.93) L4a (H'=1.92), L4c (H'=1.84) and L1 (H'=1.58), and the evenness index in L1 was the highest (E= 0.88), followed by L4b (E= 0.79), L3 (E= 0.77), L2 (E= 0.75), L4c (E= 0.74) and L4a (E= 0.79). Margalef Species Richness Index in L3 was the highest (R'=3.65), followed by oleh L4b (R'=3.01), L4a (R'=2.97), L2 (R'=2.92), L4c (R'=2.4), and L1 (R'=2.01). Generally shows that L3 at the altitude 350 m appear as the best sampling site for cicadas species in Mount Ledang Johor with the highest value of species diversity and richness index.

The Toxicity and Detoxifying Mechanism of Cycloxaprid and Buprofezin in Controlling Sogatella furcifera (Homoptera: Delphacidae).

Science.gov (United States)

Chang, Xiaoli; Yuan, Yongda; Zhang, Tianshu; Wang, Dongsheng; Du, Xingbin; Wu, Xiangwen; Chen, Haixia; Chen, Yaozhong; Jiao, Yuetong; Teng, Haiyuan

2015-01-01

The effects of cycloxaprid (a modified neonicotinoid insecticide) and buprofezin (a thiadiazine insecticide) on mortality of the white-backed planthopper (WBPH), Sogatella furcifera, were determined in laboratory assays. Cycloxaprid killed WBPH nymphs and adults but buprofezin killed only nymphs, and cycloxaprid acted faster than buprofezin. One day after infestation, mortality of third-instar nymphs was >65% with cycloxaprid at 125 mg liter(-1) but was buprofezin at 148 mg liter(-1). By the 4th day after infestation, however, control of nymphs by the two insecticides was similar, and cycloxaprid at 125 mg liter(-1) caused ≥ 80% mortality of adults but buprofezin at 148 mg liter(-1) (the highest rate tested) caused almost no adult mortality. LC50 values for cycloxaprid were lowest with nymphs, intermediate with adult males, and highest with adult females. Although buprofezin was slower acting than cycloxaprid, its LC50 for nymphs 5 d after infestation was 3.79-fold lower than that of cycloxaprid. Mean carboxylesterase (CarE) specific activity of nymphal WBPH treated with cycloxaprid and buprofezin was higher than that of control, but there was no significant difference between cycloxaprid and control (no insecticide), and it was significantly higher for buprofezin than those of cycloxaprid and control. For glutathione S-transferase and mixed function oxygenase, the specific activity of nymphal WBPH treated with buprofezin was significantly higher than those of cycloxaprid and control, too. © The Author 2015. Published by Oxford University Press on behalf of the Entomological Society of America.

The Toxicity and Detoxifying Mechanism of Cycloxaprid and Buprofezin in Controlling Sogatella furcifera (Homoptera: Delphacidae)

OpenAIRE

Chang, Xiaoli; Yuan, Yongda; Zhang, Tianshu; Wang, Dongsheng; Du, Xingbin; Wu, Xiangwen; Chen, Haixia; Chen, Yaozhong; Jiao, Yuetong; Teng, Haiyuan

2015-01-01

The effects of cycloxaprid (a modified neonicotinoid insecticide) and buprofezin (a thiadiazine insecticide) on mortality of the white-backed planthopper (WBPH), Sogatella furcifera, were determined in laboratory assays. Cycloxaprid killed WBPH nymphs and adults but buprofezin killed only nymphs, and cycloxaprid acted faster than buprofezin. One day after infestation, mortality of third-instar nymphs was >65% with cycloxaprid at 125?mg liter?1 but was

Microsatellite marker analysis of peach-potato aphids (Myzus persicae, Homoptera: Aphididae) from Scottish suction traps.

Science.gov (United States)

Malloch, G; Highet, F; Kasprowicz, L; Pickup, J; Neilson, R; Fenton, B

2006-12-01

The peach-potato aphid Myzus persicae (Sulzer) is an important vector of plant viruses. A network of suction traps collects aerial samples of this aphid in order to monitor and help predict its spatial distribution and likely impact on virus transmission in crops. A suction trap catch is thought to be a good representation of the total aphid pool. Sensitive molecular markers have been developed that determine the genetic composition of the M. persicae population. In Scotland, UK, these were applied to field collections revealing a limited number of clones. Molecular markers are less successful when applied to specimens that have been preserved in an ethanol-based trap fluid designed to preserve morphology. An assessment of different DNA extraction and PCR techniques is presented and the most efficient are used to analyse M. persicae specimens caught in the Dundee suction trap in 2001, a year when exceptionally high numbers were caught. The results reveal that the majority of the M. persicae caught belonged to two highly insecticide resistant clones. In addition, it was possible to compare the relative frequencies of genotypes caught in the trap with those collected at insecticide treated and untreated field sites in the vicinity. These results indicate that, in addition to suction trap data, the ability to sample field sites provides valuable early warning data which have implications for pest control and virus management strategies.

The authority and types for the hackberry gall psyllid genus Pachypsylla (Riley) (Hemiptera-Homoptera: Psyllidae)

Science.gov (United States)

The nomenclatural problems with the hackberry gall psyllid species names are rectified. The genus Pachypsylla Riley, 1883, type species, Psylla venusta Osten-Sacken, includes 14 nominal species. These are: Pachypsylla venusta (Osten-Sacken, 1861); P. celtidismamma Riley, 1875; P. celtidisgemma Ri...

Repellency and toxicity of three Impatients species (Balsaminaceae) extracts on Myzus persicae Sulzer (Homoptera: Aphididae)

Czech Academy of Sciences Publication Activity Database

Pavela, R.; Vrchotová, Naděžda; Šerá, Božena

2009-01-01

Roč. 2009, - (2009), s. 48-51 ISSN 0974-391X R&D Projects: GA MZe(CZ) QH72117 Institutional research plan: CEZ:AV0Z60870520 Keywords : Impatiens * repellency * toxicity Subject RIV: EH - Ecology, Behaviour

Aleyrodes proletella (Linnaeaus, 1758) (Homoptera: Aleyrodidae) puede desarrollarse en plantas de tomate en condiciones controladas

OpenAIRE

Alonso, D.; Gómez, Azahara A.; Nombela, Gloria; Muñiz, Mariano

2007-01-01

La mosca blanca de la col, Aleyrodes proletella L. causa importantes daños directos en cultivos del género Brassica en Europa, entre los que se incluyen la coliflor, brócoli, lombarda y romanesco. En España se ha observado un incremento de sus poblaciones, especialmente en Islas Canarias, Navarra y Murcia. La aplicación prolongada de plaguicidas de amplio espectro origina la aparición de poblaciones resistentes y efectos medioambientales adversos. Tras una infestación accidental de adult...

Identification of Russian wheat aphid (Homoptera : Aphididae) populations virulent to the Dn4 resistance gene

Czech Academy of Sciences Publication Activity Database

Smith, C. M.; Belay, T.; Stauffer, CH.; Starý, Petr; Kubečková, I.; Starkey, S.

2004-01-01

Roč. 97, č. 3 (2004), s. 1112-1117 ISSN 0022-0493 R&D Projects: GA AV ČR IBS5007102 Grant - others:Kansas Agricultural Experiment Station(US) 04-120-J Institutional research plan: CEZ:AV0Z5007907 Keywords : Diuraphis noxia * barley * virulence Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection Impact factor: 1.283, year: 2004

Isolation and characterization of polymorphic microsatellite loci in the green leafhopper Empoasca vitis Goethe (Homoptera).

Science.gov (United States)

Papura, D; Giresse, X; Chauvin, B; Caron, H; Delmotte, F; VAN Helden, M

2009-05-01

Eight dinucleotide microsatellite loci were isolated and characterized within the green leafhopper Empoasca vitis (Goethe) using an enrichment cloning procedure. Primers were tested on 171 individuals collected in the southwest of France from the vine plants. The identified loci were polymorphic, with allelic diversity ranging from two to 18 alleles per locus. Observed heterozygosities were from 0.021 to 0.760. These microsatellite markers should prove to be a useful tool for estimating the population genetic structure, host-plant specialization and migration capacity of this insect. © 2009 The Authors. Journal compilation © 2009 Blackwell Publishing Ltd.

Biología de Eretmocerus mundus (Hymenoptera: Aphelinidae, parasitoide del complejo Bemisia tabaci (Homoptera: Aleyrodidae, en condiciones de laboratorio Biology of Eretmocerus mundus (Hymenoptera: Aphelinidae, parasitoid of Bemisia tabaci complex (Homoptera: Aleyrodidae under laboratory conditions

Directory of Open Access Journals (Sweden)

Yerlin Chacón Castro

2010-06-01

Full Text Available La estimación de los atributos biológicos de un enemigo natural, previa a su empleo en el campo, constituye un aspecto de importancia en todo proyecto de control biológico. El objetivo de este trabajo fue evaluar los principales parámetros biológicos de Eretmocerus mundus Mercet, parasitoide de Bemisia tabaci (Gennadius, bajo condiciones de laboratorio.La emergencia del adulto, longevidad y fecundidad de la hembra, proporción sexual de la descendencia, tasa intrínseca de crecimiento poblacional (r m, tasa neta de reproducción (Ro y tiempo generacional (T; se estimaron mediante la técnica de tabla de vida y fecundidad, utilizando el pimiento (Capsicum annuum L. y el tomate (Solanum lycopersicum L. como plantas hospederas. Los resultados obtenidos en pimiento y tomate fueron respectivamente: supervivencia pupal: 86.86 ± 1.94 y 83,45 ± 2,13%; longevidad de la hembra: 18,19 ± 1,61 y 17,00 ± 0,92 días; proporción sexual: 0,34 ± 0,06 y 0,47 ± 0,05 hembras/(machos + hembras; l x50: 21 y 18 días; r m: 0,226 ± 0,061 y 0,228 ± 0,057 ninfas parasitadas/hembra/día; Ro: 189,71 ± 24,25 y 154,65 ± 17,58 ninfas parasitadas/hembra; T: 25,88 ± 0,42 y 24,03 ± 0,34 días. Los resultados obtenidos son una contribución al conocimiento de la población local del parasitoide y su posible papel como agente de control biológico de B. tabaci.The estimation of biological attributes of natural enemies prior to its use in the field is an important tool in a biological control program. The objective of the present paper was to evaluate the main biological parameters of Eretmocerus mundus Mercet, a parasitoid of Bemisia tabaci (Gennadius, under controlled laboratory conditions. Parasitoid survival, female longevity, fecundity, sex rate, intrinsic rate of natural increase (r m, net reproductive rate (Ro and generational time (T were studied using life tables, with pepper (Capsicum annuum L. and tomato (Solanum lycopersicum L. as host plants. Results obtained on pepper and tomato, respectively, were: pupal survival: 86.86 ± 1.94 and 83,45 ± 2,13%; female longevity: 18,19 ± 1,61 and 17,00 ± 0,92 days; sex rate: 0,34 ± 0,06 and 0,47 ± 0,05 female/(male + female; l x50: 21 and 18 days; r m: 0,226 ± 0,061 and 0,228 ± 0,057 parasitized nymphs/female/day; Ro: 189,71 ± 24,25 and 154,65 ± 17,58 parasitized nymphs/female; T: 25,88 ± 0,42 and 24,03 ± 0,34 days. Results lead to a better understanding of the local population of this parasitoid and its potential role as a biological control agent of B. tabaci.

Impacts of transgenic poplar-cotton agro-ecosystems upon target pests and non-target insects under field conditions.

Science.gov (United States)

Zhang, D J; Liu, J X; Lu, Z Y; Li, C L; Comada, E; Yang, M S

2015-07-27

Poplar-cotton agro-ecosystems are the main agricultural planting modes of cotton fields in China. With increasing acres devoted to transgenic insect-resistant poplar and transgenic insect-resistant cotton, studies examining the effects of transgenic plants on target and non-target insects become increasingly important. We systematically surveyed populations of both target pests and non-target insects for 4 different combinations of poplar-cotton eco-systems over 3 years. Transgenic Bt cotton strongly resisted the target insects Fall webworm moth [Hyphantria cunea (Drury)], Sylepta derogata Fabrieius, and American bollworm (Heliothis armigera), but no clear impact on non-target insect cotton aphids (Aphis gossypii). Importantly, intercrops containing transgenic Pb29 poplar significantly increased the inhibitory effects of Bt cotton on Fall webworm moth in ecosystem IV. Highly resistant Pb29 poplar reduced populations of the target pests Grnsonoma minutara Hubner and non-target insect poplar leaf aphid (Chaitophorus po-pulialbae), while Fall webworm moth populations were unaffected. We determined the effects of Bt toxin from transgenic poplar and cotton on target and non-target pests in different ecosystems of cotton-poplar intercrops and identified the synergistic effects of such combinations toward both target and non-target insects.

Spatio-Temporal Dynamics of Viruses are Differentially Affected by Parasitoids Depending on the Mode of Transmission

Directory of Open Access Journals (Sweden)

Elisa Viñuela

2012-11-01

Full Text Available Relationships between agents in multitrophic systems are complex and very specific. Insect-transmitted plant viruses are completely dependent on the behaviour and distribution patterns of their vectors. The presence of natural enemies may directly affect aphid behaviour and spread of plant viruses, as the escape response of aphids might cause a potential risk for virus dispersal. The spatio-temporal dynamics of Cucumber mosaic virus (CMV and Cucurbit aphid-borne yellows virus (CABYV, transmitted by Aphis gossypii in a non-persistent and persistent manner, respectively, were evaluated at short and long term in the presence and absence of the aphid parasitoid, Aphidius colemani. SADIE methodology was used to study the distribution patterns of both the virus and its vector, and their degree of association. Results suggested that parasitoids promoted aphid dispersion at short term, which enhanced CMV spread, though consequences of parasitism suggest potential benefits for disease control at long term. Furthermore, A. colemani significantly limited the spread and incidence of the persistent virus CABYV at long term. The impact of aphid parasitoids on the dispersal of plant viruses with different transmission modes is discussed.

Plasma's sweeping arc

International Nuclear Information System (INIS)

Pichon, Max

2010-01-01

there are no air discharges from the process, which is under negative pressure, and the syngas is clean burning. “We know that emissions from the produced syngas when used in a gas turbine are lower than emissions from natural gas and within US EPA standards,” he said. Zenergy's next step is a feasibility study prior to provide all the costing. However, it estimates the cost of producing 1MVV of electricity would be about US$2.5 million ($2.8 million). Part of the unknown is the composition of input wastes, and that's what gives WMAA knowledge manager Mark Glover cause for concern. “The proposition by some plasma companies that I have spoken to is that they want to up the ante and take MSW and start producing energy and other reusable materials,” Glover told WME. While he loves the technology, he reckons it's not right for the waste sector. He uses the old 'garbage in, garbage out' idea. “If you put low-grade material into plasma, you will get low-grade material out at the other end, and this and other AWT technologies tend to be very sensitive to variations. MSW is a very complex material and it is very hard to control,” he said. It's not dioxins he's worried about- the ultra-high temperatures would destroy all the organic molecules that create them - but the robustness of the process.There's another worry, this one strategic. Glover says it would fail WMAA's energy from waste guidelines, which say that the material to be converted to energy would not be accepted as the best alternative to converting the MSW. It says any recover able organic fraction of the waste should be separated and turned to compost, a higher order use than energy conversion. What's more, it remains largely untested at scale, meaning considerable technological and budgetary uncertainties remain. But that won't stop Prasad from pushing the technology into Australia and it that hasn't silenced the buzz offshore. PWR is full steam ahead with plans to build a US$20 million pilot plant in

Dependência tabágica, assertividade e alexitimia em doentes cardíacos

Directory of Open Access Journals (Sweden)

Vânia Rocha

2010-08-01

Full Text Available O tabagismo é uma das principais causas evitáveis de morte, aumentando acentuadamente o risco de infarto do miocárdio. Este último está associado a certas variáveis psicossociais relacionadas com o tabagismo, nomeadamente a alexitimia e a falta de assertividade. O objetivo do presente artigo foi caracterizar os dois tipos de dependência tabágica (fisiológica e comportamental, a assertividade e a alexitimia, e avaliar a relação das variáveis entre si, em 30 doentes homens internados com infarto. Foram aplicados o Teste de Fagerström, o Questionário de Glover-Nilsson, a Escala de "Rathus" e a TAS-20. Os resultados indicam que a alexitimia encontra-se relacionada com a dependência comportamental e com a assertividade, sugerindo que os sujeitos menos assertivos e com dificuldade em gerir afetos negativos e situações de estresse, podem recorrer ao tabagismo como mecanismo de enfrentamento. Nas intervenções voltadas à interrupção do hábito de fumar em doentes infartados deve-se enfatizar as competências sociais e de regulação emocional.

Ovary structure in a presocial insect, Elasmucha grisea (Heteroptera, Acanthosomatidae).

Science.gov (United States)

Ogorzałek, Antoni; Trochimczuk, Artur

2009-11-01

First generation egg clusters of Elasmucha grisea are more closely guarded than second generation clusters. The ovaries of this species are structured to enhance this behavior. The population of E. grisea from S-W Poland breeds in the spring (May-June) and late summer (July-August). The second generation clutches contain fewer eggs and are destroyed 3-4 days after oviposition by predators and parasitoids. The ovary structure in the studied species differs from that found in other Heteroptera. The average number of ovarioles per ovary is 24 while in the other investigated species the number of ovarioles per ovary is 6-7. Lateral oviducts are elongated and the ovarioles are arranged in a pennate pattern. Each ovariole contains only one growing ovarian follicle. Differentiation of the ovarioles and ovarian follicles is synchronised thus enabling simultaneous oviposition. A comparative analysis of the ovary structure during the life cycle, particularly the presence of atresive ovarian follicles in the ovarioles of egg- and nymph guarding females, as well as the shape and structure of the apical part of the tropharium all support the hypothesis of cooperation between females in E. grisea. A similar ovary structure has been observed in the Coccoidea (Hemiptera, Homoptera) which indicates presocial behavior.

Responses of prairie arthropod communities to fire and fertilizer: Balancing plant and arthropod conservation

Science.gov (United States)

Hartley, M.K.; Rogers, W.E.; Siemann, E.; Grace, J.

2007-01-01

Fire is an important tool for limiting woody plant invasions into prairies, but using fire management to maintain grassland plant communities may inadvertently reduce arthropod diversity. To test this, we established twenty-four 100 m2 plots in a tallgrass prairie in Galveston County, Texas, in spring 2000. Plots were assigned a fire (no burn, one time burn [2000], two time burn [2000, 2001]) and fertilization treatment (none, NPK addition) in a full factorial design. Fertilization treatments allowed us to examine the effects of fire at a different level of productivity. We measured plant cover by species and sampled arthropods with sweep nets during the 2001 growing season. Path analysis indicated that fertilization reduced while annual fires increased arthropod diversity via increases and decreases in woody plant abundance, respectively. There was no direct effect of fire on arthropod diversity or abundance. Diptera and Homoptera exhibited particularly strong positive responses to fires. Lepidoptera had a negative response to nutrient enrichment. Overall, the negative effects of fire on the arthropod community were minor in contrast to the strong positive indirect effects of small-scale burning on arthropod diversity if conservation of particular taxa is not a priority. The same fire regime that minimized woody plant invasion also maximized arthropod diversity.

With or without pheromone habituation: possible differences between insect orders?

Science.gov (United States)

Suckling, David Maxwell; Stringer, Lloyd D; Jiménez-Pérez, Alfredo; Walter, Gimme H; Sullivan, Nicola; El-Sayed, Ashraf M

2018-06-01

Habituation to sex pheromones is one of the key mechanisms in mating disruption, an insect control tactic. Male moths often show reduced sexual response after pre-exposure to female sex pheromone. Mating disruption is relatively rare in insect orders other than Lepidoptera. As a positive control we confirmed habituation in a moth (Epiphyas postvittana) using 24 h pre-exposure to sex pheromone to reduce subsequent activation behaviour. We then tested the impact of pre-exposure to sex or trail pheromone on subsequent behavioural response with insects from three other orders. Similar pre-exposure for 24 h to either sex pheromone [Pseudococcus calceolariae (Homoptera) and apple leaf curling midge Dasineura mali (Diptera), or trail pheromone of Argentine ants (Linepithema humile (Hymenoptera)], followed by behavioural assay in clean air provided no evidence of habituation after pre-exposure in these latter cases. The moths alone were affected by pre-exposure to pheromone. For pests without habituation, sustained attraction to a point source may make lure and kill more economical. Improved knowledge of behavioural processes should lead to better success in pest management and mechanisms should be investigated further to inform studies and practical efforts generally enhancing effectiveness of pheromone-based management. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

Relative degree of susceptibility and resistance of different brassica campestris l. genotypes against aphid myzus persicae- a field investigation

International Nuclear Information System (INIS)

Sarwar, M.

2013-01-01

Field evaluation of twenty three Brassica campestris L. genotypes was conducted for aphid (Homoptera: Aphididae) resistance during 2008 crop season. The parameters used to assess tolerance of germplasm lines included pest population during growth season and grain yield at crop maturity. Aphids showed obvious preferences for all of the germplasm investigated; however, the evaluation for resistance to pest identified several genotypes with variable potential for tolerance and sensitivity. Estimated grain yield also varied significantly due to variable pest intensity noted, and seemed to be more appropriately dependent on the pest population conditions at the experimental site. Among the germplasm, the estimation obtained regarding both the parameters sorted out MM-II/02-3 and MM-I285 genotypes as most tolerant due to less pest infestation and damage. Peak infestations by aphid caused severe crop fatalities on S-9-S-97-0.75+75/55 and S-9-1006/95 genotypes, affecting the seed weight and resulting an immense reduction in grain Brassica genotypes appeared to be governed by means of varietals characteristics of diverse germplasms. The result of resistance test conducted under field environment is an effective and consistent approach in the practical selection of crop lines resistant or partially resistant to pests for use in future breeding programs. (author)

Comparison of the ionizing radiation effects on cochineal, annatto and turmeric natural dyes

International Nuclear Information System (INIS)

Cosentino, Helio M.; Takinami, Patricia Y.I.; Mastro, Nelida L. del

2016-01-01

As studies on radiation stability of food dyes are scarce, commercially important natural food grade dyes were evaluated in terms of their sensitivity against gamma ionizing radiation. Cochineal, annatto and turmeric dyes with suitable concentrations were subjected to increasing doses up to 32 kGy and analyzed by spectrophotometry and capillary electrophoresis. The results showed different pattern of absorbance versus absorbed dose for the three systems. Carmine, the glucosidal coloring matter from the scale insect Coccus cacti L., Homoptera (cochineal) remained almost unaffected by radiation up to doses of about 32 kGy (absorbance at 494 nm). Meanwhile, at that dose, a plant-derived product annatto or urucum (Bixa orellana L.) tincture presented a nearly 58% reduction in color intensity. Tincture of curcumin (diferuloylmethane) the active ingredient in the eastern spice turmeric (Curcuma longa) showed to be highly sensitive to radiation when diluted. These data shall be taken in account whenever food products containing these food colors were going to undergo radiation processing. - Highlights: • Comparison of radiosensitivity of food colors was performed. • Carmine showed the highest resistance to radiation. • Annatto and turmeric behaved sensitive to radiation when diluted. • Turmeric was the most affected by ionizing radiation.

Mechanisms of Oryza sativa (Poaceae) resistance to Tagosodes orizicolus (Homoptera: Delphacidae) under greenhouse condition in Venezuela.

Science.gov (United States)

González, Alex; Labrín, Natalia; Alvarez, Rosa M; Jayaro, Yorman; Gamboa, Carlos; Reyes, Edicta; Barrientos, Venancio

2012-03-01

Tagosodes orizicolus is one of the main plagues of rice in tropical America causing two types of damages, the direct one, feeding and oviposition effect, and an indirect one, by the transmission of the "Rice hoja blanca virus". During 2006-2007 we carried out research under greenhouse conditions at Fundaci6n Danac, Venezuela, in order to determine the mechanisms of antixenosis, antibiosis and tolerance to T. orizicolus, which could be acting in commercial varieties and advanced lines of the rice genetic breeding programs of INIA and Fundaci6n Danac. The method of free feeding was used for the antixenosis evaluation, whereas the method of forced feeding was used for antibiosis evaluation (effect on survival and oviposition). Additionally, we used the indirect method based on biomass depression to estimate the tolerance. Some of the evaluated traits included: grade of damage, number of insects settling on rice plants, percentage of sogata mortality at the mature state, number of eggs in the leaf midrib and an index of tolerance. The results showed that rice genotypes possess different combinations of resistance mechanisms, as well as different grades of reactions. The susceptible control 'Bluebonnet 50' was consistently susceptible across experiments and the resistant control 'Makalioka' had high antixenosis and high antibiosis based on survival and oviposition. The rest of the genotypes presented lower or higher degrees of antixenosis and antibiosis for survival and oviposition. The genotype 'FD0241-M-17-6-1-1-1-1' was identified with possible tolerance to the direct damage of sogata.

Mechanisms of Oryza sativa (Poaceae resistance to Tagosodes orizicolus (Homoptera: Delphacidae under greenhouse condition in Venezuela

Directory of Open Access Journals (Sweden)

Alex González

2012-03-01

Full Text Available Tagosodes orizicolus is one of the main plagues of rice in tropical America causing two types of damages, the direct one, feeding and oviposition effect, and an indirect one, by the transmission of the “Rice hoja blanca virus”. During 2006-2007 we carried out research under greenhouse conditions at Fundación Danac, Venezuela, in order to determine the mechanisms of antixenosis, antibiosis and tolerance to T. orizicolus, which could be acting in commercial varieties and advanced lines of the rice genetic breeding programs of INIA and Fundación Danac. The method of free feeding was used for the antixenosis evaluation, whereas the method of forced feeding was used for antibiosis evaluation (effect on survival and oviposition. Additionally, we used the indirect method based on biomass depression to estimate the tolerance. Some of the evaluated traits included: grade of damage, number of insects settling on rice plants, percentage of sogata mortality at the mature state, number of eggs in the leaf midrib and an index of tolerance. The results showed that rice genotypes possess different combinations of resistance mechanisms, as well as different grades of reactions. The susceptible control ‘Bluebonnet 50’ was consistently susceptible across experiments and the resistant control ‘Makalioka’ had high antixenosis and high antibiosis based on survival and oviposition. The rest of the genotypes presented lower or higher degrees of antixenosis and antibiosis for survival and viposition. The genotype ‘FD0241-M-17-6-1-1-1-1’ was identified with possible tolerance to the direct damage of sogata.Tagosodes orizicolus es una de las principales plagas del cultivo del arroz en América tropical causando dos tipos de daños a la planta, el directo, por efecto de la alimentación y oviposición; el indirecto, por la transmisión del virus de la hoja blanca del arroz. Durante el período 2006-2007 se llevó a cabo una investigación bajo condiciones de umbráculo en la Fundación Danac, Venezuela, con el objeto de determinar los mecanismos de resistencia de antixenosis, antibiosis y tolerancia a T. orizicolus que pudieran estar actuando en líneas avanzadas y cultivares del programa de mejoramiento enético de arroz de las instituciones INIA y Fundación Danac. Para la evaluación de antixenosis se utilizó el método de libre elección, para antibiosis (efecto sobre sobrevivencia y oviposición de los insectos el de alimentación forzada, adicionalmente se usó un método indirecto para estimar la tolerancia. Dentro de los principales parámetros determinados se encontraban: grado de daño, número de insectos posados sobre plantas de arroz, porcentaje de mortalidad de sogata en estado adulto, número de huevos y se calculó un índice de tolerancia con base en la biomasa. Los resultados mostraron que los genotipos de arroz evaluados poseen diferentes combinaciones en cuanto a los mecanismos de resistencia, así como el grado de su efecto. El testigo ‘Bluebonnet 50’ se mantuvo consistentemente susceptible en las evaluaciones y el testigo resistente ‘Makalioka’ fue el único genotipo que presentó alta antixenosis y alta antibiosis para sobrevivencia y oviposición. El resto de los genotipos presentaron un menor o mayor grado de resistencia de tipo antixenosis y antibiosis para sobrevivencia y oviposición. Se identificó el genotipo ‘FD0241-M-17-6-1-1-1-1’ con posible tolerancia al daño directo de sogata.

First results in the use of sterile insect technique against Trialeurodes vaporariorum (Homoptera: Aleyroididae) in greenhouses

International Nuclear Information System (INIS)

Calvitti, M.; Remotti, P.C.; Pasquali, A.; Cirio, U.

1998-01-01

Trials for the evaluation of the effectiveness of the sterile insect technique for the suppression of greenhouse whitefly, Trialeurodes vaporariorum (Westwood), both in cage and in greenhouse conditions are described. The results show a significant reduction of the reproductive capacity of the untreated whitefly populations interacting with sterile insects. Untreated whiteflies, co-existing in a mixed population together with sterile insects, attained less than the half (44%) of their potential reproductive capacity. This trend was also evident in the cage test where the untreated whitefly population, crossed with the sterile whiteflies, increased without exceeding 2/3 of the density recorded in the control cages. These results may be based on 2 joint sterile insect technique effects: primarily a drastic reduction of the progeny of normal untreated females, when mating with sterile males, carriers of dominant lethal mutations, and secondarily a progressive reduction of the females in the population due to an increasing rate of unsuccessful matings resulting in a condition of forced arrhenotoky. No deleterious effects, on plant health and fruit quality, were observed on plants exposed to high sterile whitefly pressures

Controle alternativo da mancha de Ramularia do algodoeiro Alternative control of the Cotton ramularia spot

Directory of Open Access Journals (Sweden)

Leonardo Angelo de Aquino

2008-06-01

Full Text Available A mancha de Ramularia, causada pelo fungo Ramularia gossypii (Speg. Cif., é uma doença foliar de destaque na cotonicultura brasileira. Com a expansão da cotonicultura, existem poucos produtos avaliados para manejo da Ramularia, destacando-se os fungicidas dos grupos triazóis e estrobirulinas. Objetivou-se nesse trabalho avaliar o efeito da aplicação foliar do silicato de potássio, da calda Viçosa e de fungicidas protetores (mancozeb e clorotalonil para o controle químico da mancha de Ramularia. O silicato de potássio não foi eficiente para o controle da doença com severidade de 15,38%, enfolhamento relativo aos 166 dias após a emergência de 38,19%, produtividade de algodão em caroço de 136,11 @ ha-1 e área abaixo da curva de progresso da mancha de Ramularia de 644, 598 e 172 nos terços inferior, médio e superior, respectivamente, com valores semelhantes à testemunha sem fungicida. A calda viçosa proporcionou satisfatório controle da doença não diferindo em termos de produtividade dos tratamentos com piraclostrobin e ou tebuconazol, sendo o incremento de produtividade em relação à testemunha de 88%. Os fungicidas mancozeb e clorotalonil em mistura com calda Viçosa ou com tebuconazole foram eficientes no controle da mancha de Ramularia, destacando-se o fungicida mancozeb em mistura com tebuconazol.Areolate mildew, caused by the fungus Ramularia gossypii (Speg. Cif., is the most important foliar disease on cotton. There are a few products available to the growers to manage this disease among them the fungicides tryazol and strobilurine. This study aimed to evaluate the effect of foliar application of potassium silicate, 'calda Viçosa' e protector fungicides (Mancozeb and Clorothalonyl to control areolate mildew on cotton. The potassium silicate was not efficient to control the disease with severity of 15.38%, canopy quality at 166 days after plant emergence of 38.19%, yield of 2041.65 kg ha-1 and area under areolate

Insetos indutores de galhas da porção sul da Cadeia do Espinhaço, Minas Gerais, Brasil Gall inducing insects from southern portion of the Espinhaço Range, Minas Gerais, Brazil

Directory of Open Access Journals (Sweden)

Marco Antonio A. Carneiro

2009-12-01

Full Text Available A riqueza de insetos galhadores é maior nas latitudes intermediárias em hábitats quentes e com vegetação esclerófila sob estresse hídrico e de nutrientes. Em regiões tropicais, os campos rupestres são indicados como hábitats ricos em espécies de insetos galhadores. Neste trabalho, foram descritas as galhas induzidas por insetos e suas plantas hospedeiras na porção sul da Cadeia do Espinhaço, sudeste do Brasil. Foram selecionados 60 sítios em seis regiões ao longo na porção sul da Cadeia do Espinhaço no estado de Minas Gerais. Em cada sítio 100 plantas foram amostradas totalizando 6.000 plantas censuradas ao longo de um gradiente altitudinal de 668 a 1860m. Foram encontrados 241 morfotipos de galhas em 142 espécies de plantas distribuídas em 29 famílias e de um total de 384 espécies de plantas amostradas. As famílias mais ricas em espécies de insetos galhadores foram Asteraceae (42%, principalmente espécies do gênero Baccharis. A maior parte das galhas (85% foi induzida por insetos da família Cecidomyiidae seguidos por Lepidoptera (4% e Homoptera (3%. Os ramos foram os órgãos mais freqüentemente atacados (72% enquanto que os morfotipos mais comuns foram o elíptico (37% e o globóide (36%. A espécie de planta hospedeira que apresentou mais morfotipos de galhas foi Baccharis pseudomyriocephala com 10 galhas distintas. Este estudo sustenta a afirmativa que campos rupestres apresentam uma elevada riqueza em espécies de insetos galhadores.Galling species richness is higher at intermediate latitudes on warm habitats and sclerophyllous vegetation under water and nutrient stress. In the tropical region, galling species richness is higher in rupestrian fields. Here the gall-inducing insects and their host plants of the southern portion of the Espinhaço range, southeastern Brazil are described. 60 study sites from six distinct regions along the Espinhaço range, at Minas Gerais state were selected. In each study site 100

Performance of novel vs traditional insecticides for the control of amrascs biguttula biguttula (homoptera, cicadellidae) on cotton

International Nuclear Information System (INIS)

Karar, H.; Babar, T.K.; Shahzad, F.; Saleem, M.; Ali, A.; Akram, M.

2013-01-01

Amrasca biguttula biguttula (ishida) can reduce the yield of cotton approximately 25%. no potential predators have been recorded in the field for its control. to overcome this pest insecticides play significant role in the improvement of crop yields all over the world during the last four to five decades. to save the crop from this notorious pest, ten formulations of insecticides viz., acephate 75sp (acephate) at the rate 625g, imidacloprid 25wp (imidacloprid) at the rate188g, thiamethaxim 25wg (actara) at the rate 60g, imidacloprid 70wg (confidor) at the rate 43g, dimethoat e 40ec (sanitox) at the rate 1000 ml, nytonpyron 10sl (pyramid) at the rate 500ml, lambdacyhlothrin 2.5e (kango) at the rate 825 ml, thiachloprid 480sc (talent) at the rate 63 ml, imidacloprid 25sl (confidor) at the rate 500ml, and diafenthiuron 500sc (polo), at the rate 500ml, per hectare were sprayed in the field having maximum population of nymphs and adults of jassid at cotton research station, multan on cotton variety bt-886 in the month of july, 2011 and 2012. the maximum mortality of Jassid was observed in those treatments, where acephate was applied with 79, 72, 65 mortality, nytonpyron with 69, 63, 55 and imidacloprid 68, 63, 57 percent mortality after 24, 72 and 168 h of spray. minimum mortality of jassid was observed in the treatments where talent was applied having 25, 17 and 16 percent mortality 24, 72 and 168 h after spray. By the application of acephate, pyramid and confidor 25sl on cotton crop the yield can be increased. (author)

Pear transformed with a lytic peptide gene for disease control affects nontarget organism, pear psylla (Homoptera: Psyllidae).

Science.gov (United States)

Puterka, Gary J; Bocchetti, Chris; Dang, Phat; Bell, R L; Scorza, Ralph

2002-08-01

The biology and behavior of pear psylla, Cacopsylla pyricola Foerster, on a transgenic clone of 'Bartlett' pear, Pyrus communis L., containing a synthetic antimicrobial gene, D5C1, was compared with that of a nontransgenic parental clone to determine whether there were any nontarget effects. The gene construct also contained the marker gene nptII (aminoglycoside 3'-phosphotransferase II) that encodes for antibiotic resistance to identify transformed plants. The purpose of the original transformation was to enhance pear resistance to the bacterial disease fireblight caused by Erwinia amylovora (Burr.) Winslow et al. The biology and behavior of pear psylla on a transgenic clone were compared with a nontransgenic parental pear clone in short- (crops.

A new genus and new species of felt scales (Homoptera: Coccinea: Eriococcidae from Tierra del Fuego (Chile

Directory of Open Access Journals (Sweden)

Ilya A. Gavrilov-Zimin

2016-10-01

Full Text Available Telmatococcus igniumterrae gen. nov. et sp. nov. is described and illustrated based on the material collected from a sphagnum bog in the extreme southern part of South America (Tierra del Fuego. The new monotypic genus differs from all known genera of Eriococcidae in having short cylindrical truncated setae of the anal apparatus and pouches with numerous quinquelocular pores near the anal apparatus. The habitat of the new taxon is characterized.

Buprofezin susceptibility survey, resistance selection and preliminary determination of the resistance mechanism in Nilaparvata lugens (Homoptera: Delphacidae).

Science.gov (United States)

Wang, Yanhua; Gao, Congfen; Xu, Zhiping; Zhu, Yu Cheng; Zhang, Jiushuang; Li, Wenhong; Dai, Dejiang; Lin, Youwei; Zhou, Weijun; Shen, Jinliang

2008-10-01

Buprofezin has been used for many years to control Nilaparvata lugens (Stål). Assessment of susceptibility change in the insect is essential for maintaining control efficiency and resistance management. Eleven-year surveys showed that most field populations were susceptible before 2004. However, substantially higher levels of resistance (up to 28-fold) were found in most of the rice fields in China after 2004. A field population was collected and periodically selected for buprofezin resistance in the laboratory. After 65 generations (56 were selected), the colony successfully obtained 3599-fold resistance to buprofezin. Synergism tests showed that O,O-diethyl-O-phenyl phosphorothioate (SV1), piperonyl butoxide (PBO) and diethyl maleate (DEM) increased buprofezin toxicity in the resistant strain by only 1.5-1.6 fold, suggesting that esterases, P450-monooxygenases and glutathione S-transferases had no substantial effect on buprofezin resistance development. The results from this study indicate that N. lugens has the potential to develop high resistance to buprofezin. A resistance management program with rotation of buprofezin and other pesticides may efficiently delay or slow down resistance development in the insect. Further investigation is also necessary to understand the resistance mechanisms in N. lugens.

Bacterial symbionts, Buchnera, and starvation on wing dimorphism in English grain aphid, Sitobion avenae (F. (Homoptera: Aphididae

Directory of Open Access Journals (Sweden)

Fangmei eZhang

2015-05-01

Full Text Available Wing dimorphism in aphids can be affected by multiple cues, including both biotic (nutrition, crowding, interspecific interactions, the presence of natural enemies, maternal and transgenerational effects, and alarm pheromone and abiotic factors (temperature, humidity, and photoperiod. The majority of the phloem-feeding aphids carry Buchnera, an obligate symbiotic proteobacteria. Buchnera has a highly reduced genome size, but encode key enzymes in the tryptophan biosynthetic pathway and is crucial for nutritional balance, development and reproduction in aphids. In this study, we investigated the impact of two nutritional-based biotic factors, symbionts and starvation, on the wing dimorphism in the English grain aphid, Sitobion avenae, a devastating insect pest of cereal crops (e.g., wheat worldwide. Elimination of Buchnera using the antibiotic rifampicin significantly reduced the formation of winged morphs, body mass and fecundity in S. avenae. Furthermore, the absence of this primary endosymbiont may disrupt the nutrient acquisition in aphids and alter transgenerational phenotypic expression. Similarly, both survival rate and the formation of winged morphs were substantially reduced after neonatal (< 24h old offspring were starved for a period of time. The combined results shed light on the impact of two nutritional-based biotic factors on the phenotypic plasticity in aphids. A better understanding of the wing dimorphism in aphids will provide the theoretical basis for the prediction and integrated management of these phloem-feeding insect pests.

Varietals resistance and susceptibility in mustard (brassica campestris l.) genotypes against aphid myzus persicae (sulzer) (homoptera: aphididae)

International Nuclear Information System (INIS)

Sarwar, M.; Ahmad, N.; Khan, G.Z.; Tofique, M.

2009-01-01

The exploitation of resistant cultivars is an imperative, simple, practical and flexible way to cope with insect pests incidence. Thirty genotypes of mustard (Brassica campestris L.) were tested for their resistance and susceptibility to aphid Myzus persicae (Sulzer) exposed under natural field conditions. Data on pest tolerance of genotypes were judged by quantitative traits such as number of aphids on each infested plant and mean dry weight of seeds per genotype. Studies observed the discrepancy in overall rates of pest invasion and seed yield contained by trailed mustard genotypes. Agati sarson (P), S-9-S-97-100/45 and S-9-S-97-100/45 were the least damaged genotypes showing their moderate resistance. Amongst other genotypes, MM-I/01-5, MM-I285 and MM-I/01-6 were the most damaged showing oversensitive response. Although the majority of genotypes were found vulnerable to pest, Agati sarson (P) and S-9-S-97-100/45 due to their lowest hypersensitive response toward aphid contamination and increased pods yield could be used for the development of essential resistance in mustard plant. A marked mode of damage inflicted by aphid on the crop was noticed and the abiotic factors contributing variations in aphid infestation levels during both growing seasons were determined. Knowledge about the host plant resistance investigated can facilitate growers to choose the most appropriate cultivars as pest control strategy. (author)

Interplant movement and spatial distribution of alate and apterous morphs of Nasonovia ribisnigri (Homoptera: Aphididae) on lettuce.

Science.gov (United States)

Diaz, B M; Barrios, L; Fereres, A

2012-08-01

Knowledge on colonization modes and interplant movement of Nasonovia ribisnigri can contribute to the development of optimal control of this pest. The aim of this study was to determine the spatio-temporal distribution and the mode of spread between adult morphs of Nasonovia ribisnigri, comparing spring and autumn lettuce protected crops. The spatial and temporal pattern was analyzed using the spatial analysis by distance indices (SADIE) methodology and other related displacement indices. The population size of N. ribisnigri was greater in the autumn than in the spring growing seasons due to milder temperatures. The percentage of plants colonized by aphids was higher in spring than in autumn, showing the great dispersal potential of this aphid species independent of their population size. Differential propensity for initial displacement from the central plant was observed between adult morphs in spring, resulting in a greater ability of apterous than alate aphids to spread far away from the source plant. In autumn, both adult morphs showed an initial reduced displacement; however, the number of plants infested (≈20%) with at least one aphid at this initial time (seven days) was similar for both adult morphs and both growing seasons. Analysis of the spatial pattern of both adult morphs revealed a predominantly random distribution for both spring and autumn trials. This pattern was achieved by a prevalent random movement over the area (γ≈0.5). These results highlight the ability of the apterous N. ribisnigri to spread within greenhouse lettuce crops early in the spring, suggesting that detection of the pest by deep visual inspection is required after lettuce emergence.

Survey of aphid population in a yellow passion fruit crop and its relationship on the spread Cowpea aphid-borne mosaic virus in a subtropical region of Brazil.

Science.gov (United States)

Garcêz, Renata Maia; Chaves, Alexandre Levi Rodrigues; Eiras, Marcelo; Meletti, Laura Maria Molina; de Azevedo Filho, Joaquim Adelino; da Silva, Leonardo Assis; Colariccio, Addolorata

2015-01-01

Passion fruit woodiness may be caused by Cowpea aphid-borne mosaic virus (CABMV) and is currently the major passion fruit disease in Brazil. To assess the virus-vector-host interactions, a newly introduced golden passion fruit plantation located in eastern region of São Paulo State, Brazil, was monitored. Dissemination of CABMV was determined analyzing golden passion fruit plants monthly for 18 months by PTA-ELISA. Seasonality and aphid fauna diversity was determined by identification of the captured species using yellow sticky, yellow water-pan and green tile traps. Population composition of the aphid species was determined using the descriptive index of occurrence, dominance and general classification and overlap of species in the R program. Analyses of species grouping afforded to recognize 14 aphid species. The genus Aphis represented 55.42 % of the species captured. Aphid species formed two distinct clusters, one of which was characterized by the diversity of polyphagous species that presented high potential to spread CABMV. The low abundance and diversity of aphid species did not interfere negatively in the CABMV epidemiology. The genus Aphis, particularly Aphis fabae/solanella and A. gossypii, was crucial in the spread of CABMV in passion fruit orchards in the eastern State of São Paulo.

Studies on the biosynthesis of vitamin B2 and vitamin B12

International Nuclear Information System (INIS)

Chen, H.C.

1988-01-01

Feeding experiments with Ashbya gossypii followed by NMR analysis of the resulting riboflavin showed incorporation of deuterium from D-[2- 2 H]ribose at C-2' and from D-[1- 2 H]ribose in the pro-R position at C-1' of the ribityl side chain. The results rule out an Amadori rearrangement mechanism for the reduction of the ribosylamino to the ribitylamino linkage and point to formation of a Schiff base that is reduced stereospecifically opposite to the face from which the oxygen has departed. As prerequisite for the analysis, the 1 H NMR signals for the pro-R and pro-S hydrogens at C-1' of riboflavin and its tetraacetate were assigned with the aid of synthetic stereospecifically deuteriated samples. Feeding experiments with Propionibacterium shermianii followed by NMR analysis of the resulting vitamin B 12 showed: (1) 5-methylbenzimidazole (5MBI) incorporated and only one regioisomer (B6-demethylcyanocobalamin)formed. (2) 8-demethylriboflavin incorporated and the same regioisomer was obtained as 5MBI experiment. (3) [1'- 13 C, 5- 15 N]riboflavin incorporated and 13 C-NMR showed that 13 C at the B2 position of cyanocobalamin coupled to both adjacent nitrogen-15 atoms at about the same ratio

Prey Acceptability and Preference of Oenopia conglobata (Coleoptera: Coccinellidae, a Candidate for Biological Control in Urban Green Areas

Directory of Open Access Journals (Sweden)

Belén Lumbierres

2018-01-01

Full Text Available Oenopia conglobata is one of the most common ladybird species in urban green areas of the Mediterranean region. We have obtained data about its prey acceptability and prey preferences. In a laboratory experiment, we investigated the acceptability of seven aphid and one psyllid species as prey for this coccinellid: the aphids Chaitophorus populeti, Aphis gossypii, Aphis craccivora Monelliopsis caryae, Eucallipterus tiliae, Aphis nerii (on white poplar, pomegranate, false acacia, black walnut, lime, and oleander, respectively, and the psyllid Acizzia jamatonica on Persian silk tree. These species are abundant in urban green areas in the Mediterranean region. In addition, we tested the acceptability of Rhopalosiphum padi on barley, an aphid species easily reared in the laboratory. We also tested preferences of the predator in cafeteria experiments with three aphid species and one aphid and the psyllid. Adults and larvae of the coccinellid accepted all of the preys offered, except A. nerii, with a clear preference for M. caryae. The predator also showed preference for M. caryae when it was offered in a cafeteria experiment with other aphid species or with the psyllid. The aphid R. padi obtained a good acceptability and could be used for rearing O. conglobata in the laboratory.

Identification of a New Cotton Disease Caused by an Atypical Cotton Leafroll Dwarf Virus in Argentina.

Science.gov (United States)

Agrofoglio, Yamila C; Delfosse, Verónica C; Casse, María F; Hopp, Horacio E; Kresic, Iván Bonacic; Distéfano, Ana J

2017-03-01

An outbreak of a new disease occurred in cotton (Gossypium hirsutum) fields in northwest Argentina starting in the 2009-10 growing season and is still spreading steadily. The characteristic symptoms of the disease included slight leaf rolling and a bushy phenotype in the upper part of the plant. In this study, we determined the complete nucleotide sequences of two independent virus genomes isolated from cotton blue disease (CBD)-resistant and -susceptible cotton varieties. This virus genome comprised 5,866 nucleotides with an organization similar to that of the genus Polerovirus and was closely related to cotton leafroll dwarf virus, with protein identity ranging from 88 to 98%. The virus was subsequently transmitted to a CBD-resistant cotton variety using Aphis gossypii and symptoms were successfully reproduced. To study the persistence of the virus, we analyzed symptomatic plants from CBD-resistant varieties from different cotton-growing fields between 2013 and 2015 and showed the presence of the same virus strain. In addition, a constructed full-length infectious cDNA clone from the virus caused disease symptoms in systemic leaves of CBD-resistant cotton plants. Altogether, the new leafroll disease in CBD-resistant cotton plants is caused by an atypical cotton leafroll dwarf virus.

Efecto de la configuración de lotes de gramíneas invernales sobre poblaciones de Delphacidae (Insecta: Homoptera en dispersión The effect of the configuration of winter grass plots on dispersing populations of Delphacidae (Insecta: Homoptera

Directory of Open Access Journals (Sweden)

M.A. Bruno

2007-12-01

Full Text Available Las características del paisaje afectan la distribución y abundancia de los insectos dentro y entre los lotes de cultivos. El objetivo de este trabajo fue determinar el efecto de los elementos del paisaje agrícola sobre la abundancia de los individuos en dispersión de las especies de Delphacidae. Éstas son vectores de virus patogénicos que transmiten enfermedades de importancia económica para la producción agropecuaria. El estudio se realizó en el área central de la provincia de Córdoba, Argentina; los insectos fueron capturados con trampas pegajosas ubicadas dentro de parches de hospedadores. Las métricas del paisaje analizadas fueron: área del parche, índice de proximidad media y porcentaje del paisaje cubierto por parches de una clase de hospedador. La abundancia de Delphacodes kuscheli tuvo relación positiva con el área de los parches de pasturas de invierno. El índice de proximidad media tuvo relación positiva con las abundancias de D. kuscheli y D . balboae en los parches de pasturas de invierno y el porcentaje del paisaje cubierto con parches de pasturas de invierno se relacionó positivamente con las abundancias de D. kuscheli, D. balboae y D. haywardi. Las abundancias de Toya propincua no mostraron relación con ninguna de las métricas del paisaje analizadas.Landscape configuration can affect the distribution and abundance of insect species. The objective of this work was to determine the effect of landscape elements configuration on the abundance of dispersing individuals of Delphacidae species. Delphacid species are important vectors of pathogenic viruses causing diseases of economic importance on grain production. The study was performed in the central area of Córdoba Province, Argentina; the insects were collected with sticky traps placed in plant host patches. The landscape metrics estimated were: host patch area, Mean Proximity Index (MPI and the Percentage of Landscape occupied (PLAND by host patches of the same class. The abundance of Delphacodes kuscheli showed a positive relationship with patch area of the winter pastures. There was a positive relationship between Mean Proximity Index of winter pastures patches and D. kuscheli and D . balboae abundances. The Percentage of Landscape occupied by the winter pastures patches also showed a positive relationship with Delphacodes kuscheli, Delphacodes balboae and Delphacodes haywardi abundances. Finally we found no relationship between Toya propinqua abundance and any of the landscape metrics analyzed in this work. These results show that landscape configuration has a different effect on the dispersing population of the different species of Delphacidae.

For the Aphid fauna in the territory of Yenisei river basin. Communication 1. Aphids on coniferous plants

Directory of Open Access Journals (Sweden)

A. V. Gurov

2016-02-01

Full Text Available The paper reports on new and previously not well-known data on insufficiently studied fauna of aphids living on coniferous trees in Central Siberia of the basin of Yenisei river. This region is the extensive transect of latitudinal geographic zones from semi-desert in the South to the arctic deserts in the North. That is why this region is very peculiar. This is the reason for insufficient study of regional entomological fauna. Aphids (Homoptera: Aphidoideaare a very taxonomically and ecologically heterogeneous group of insects. The aphids living on conifer trees are notstudied completely on the territory of Yenisei basin. Due to this, the studying of not well-known and economicallyimportant aphids is actual. For example, the insufficient study of regional aphids is confirmed by the fact, that duringthree weeks only of the work for INTAS-94-0930 Project two new aphid species were found and described on thisterritory. Also, the new species of family Mindaridae, which was described in Mongolia in 1980, was found in Siberiafor the first time. These finds indicate the real possibility to describe an interesting conifer aphid complex in the absolutely unstudied forested territory between Angara and Lower Tunguska rivers. Geographical location, dates ofcollection and feeding preferences of different species are described. A general review of Yenisei basin Siberian aphidfauna is suggested for the first time ever.

Use of biorational for the vegetable pest control in the north of Sinaloa

Directory of Open Access Journals (Sweden)

María Berenice González Maldonado

2012-09-01

Full Text Available In Sinaloa the vegetable and cucurbits production are important agricultural activities, so each year a high volume of chemicalinsecticides are applied to pest control that attack these crops. This paper present the main pests insects in the region, as wellas an analysis about effects of biorational insecticides on these pests. Was found that for control of Bemisia argentifolii Bellows & Perring (Hemiptera: Aleyrodidae is used Neem oil 0.2%., for kill nymphs of Bactericera cockerelli Sulc. (Homoptera: Psyllidae soursop Annona muricata L. (Annonales: Annonaceae at doses of 2500-5000 mg/L., for Liriomyza trifolii Burgess (Diptera: Agromyzidae neem seeds 2%., to Myzus persicae Sulzer (Hemiptera: Aphididae rapeseed oil at doses 920 g/L (2% v/v., to Frankliniella occidentalis Pergande (Thysanoptera: Thripidae spinosad (Conserve® 48-60 mg/L., and for Phthorimaea operculella Zeller (Lepidoptera: Gelechiidae granular viruses (105 OBs/mL combined with neem (DalNeem TM emulsifiable oil and NeemAzal TM -T/S at doses of 8 mg/L, everyone. The use of these products and the dose depends on the type of pest and crop. In general these products cause insect mortality greater than 95%, besides having low toxicity on natural enemies, so that these can be used individually or in combination in integrated pest control schemes against vegetable pests, and also for disease vectors insects in the northern of Sinaloa.

ON THE PALEOFAUNA INVERTEBRATES (MOLLUSCA, ARTROPODA; INSECTA OF DIATOMITE DEPOSITS OF SHAMB–1 LOCALITY (SISIAN SUITE, EARLY PLEISTOCENE, ARMENIA

Directory of Open Access Journals (Sweden)

М. A. Маrjanyan

2016-01-01

Full Text Available Aim. The study of fossil insects from diatomaceous sediments of Shamb-1 locality of Sisian Suite (Early Pleistocene. The collection of fossils plants and animals of Institute of Botany of NAS RA and authors' findings served as material for study.Methods. The material is processed and prepared for study by conventional methods in paleontology for prints and fossils of insects from diatomaceous sediments. There are 654 samples studied: 2 samples were with mollusks’ imprints and 652 samples with imprints of insects, from which preserved marks on 291samples allowed to identify them up to order, family, genus and species.Results. The studied material refers to the Mollusca and Arthropoda (Insecta types. Insects are represented by species of orders Orthoptera (2 fam., Homoptera (1 fam., Heteroptera (2 fam., Coleoptera (15 fam., Hymenoptera (2 fam., Diptera (1 fam.. Coleopteras dominate among them and are presented with following species of the family – Carabidae, Dytiscidae, Hydrophilidae, Histeridae, Staphylinidae, Silphidae, Elateridae, Buprestidae, Lampyridae, Scarabaeidae, Chrysomelidae, Tenebrionidae, Coccinellidae, Cerambycidae, Curculionidae.Main conclusions. An analysis of the taxonomic composition of paleofauna was done, which corresponds to the recent fauna and with considering modern ecological characteristics of systematical groups and species. In the investigated location of Shamb-1 a version is suggested about the palaeolandscapes and palaeoclimate in the Early Pleistocene.

Hairy nightshade as a potential Potato leafroll virus (Luteoviridae: Polerovirus) inoculum source in Pacific Northwest potato ecosystems.

Science.gov (United States)

Srinivasan, R; Alvarez, J M

2008-09-01

Hairy nightshade, Solanum sarrachoides, is a solanaceous weed found abundantly in Pacific Northwest potato ecosystems. It serves as a reservoir for one of the important potato viruses, Potato leafroll virus (PLRV) (Luteoviridae: Polerovirus), and its most important vector, the green peach aphid, Myzus persicae (Homoptera: Aphididae). Laboratory research indicated an increased green peach aphid settling and performance on S. sarrachoides than on potato. It also revealed that green peach aphids transmitted PLRV more efficiently from S. sarrachoides to potato than from potato to potato. To test the efficiency of S. sarrachoides as an inoculum source in the field, a two season (2004 and 2005) trial was conducted at Kimberly, Idaho. Two inoculum sources, PLRV-infected potato and PLRV-infected S. sarrachoides, were compared in this trial. Green peach aphid density and temporal and spatial PLRV spread were monitored at weekly intervals. Higher densities of green peach aphids were observed on plots with S. sarrachoides and inoculum sources (PLRV-infected S. sarrachoides and potato) than on plots without S. sarrachoides and inoculum sources. PLRV infection in plots with PLRV-infected S. sarrachoides was similar to or slightly higher than in plots with PLRV-infected potato as an inoculum source. Temporal and spatial PLRV spread was similar in plots with either inoculum source. Thus, S. sarrachoides is as efficient as or a better PLRV inoculum source than potato.

Mechanical properties of simulated Mars materials: gypsum-rich sandstones and lapilli tuff

Science.gov (United States)

Morrow, Carolyn; Lockner, David; Okubo, Chris

2013-01-01

Observations by the Mars Exploration Rover (MER) Opportunity, and other recent studies on diagenesis in the extensive equatorial layered deposits on Mars, suggest that the likely lithologies of these deposits are gypsum-rich sandstones and tuffaceous sediments (for example, Murchie and others, 2009; Squyres and others, 2012; Zimbelman and Scheidt, 2012). Of particular interest is how the diagenesis history of these sediments (degree of cementation and composition) influences the strength and brittle behavior of the material. For instance, fractures are more common in lower porosity materials under strain, whereas deformation bands, characterized by distributed strain throughout a broader discontinuity in a material, are common in higher porosity sedimentary materials. Such discontinuities can either enhance or restrict fluid flow; hence, failure mode plays an important role in determining the mechanics of fluid migration through sediments (Antonellini and Aydin, 1994; 1995; Taylor and Pollard, 2000; Ogilvie and Glover, 2001). As part of a larger study to characterize processes of fault-controlled fluid flow in volcaniclastic and gypsum-rich sediments on Mars, we have completed a series of laboratory experiments to focus on how gypsum clast content and degree of authigenic cementation affects the strength behavior of simulated Mars rocks. Both axial deformation and hydrostatic pressure tests were done at room temperature under dry conditions.

Electromagnetic properties of thin film lead superconductors

International Nuclear Information System (INIS)

Moriyama, K.

1978-01-01

The dependence of critical film magnetic field H/sub cf/ on temperature, thickness, and surface texture of lead superconducting films was investigated, as well as the relationship between the applied magnetic field and the applied current at the critical field. Temperature and thickness dependence data were consistent with the predictions of London, of Ginzburg, and of Bardeen, Cooper, and Schreiffer. The values of H/sub cf/ of lead films deposited on a rough surface were consistently lower than for those on a smooth surface and so were not in agreement with any currently accepted theory. The degree of lowering of H/sub cf/ by a rough surface was greater in thin films than in thick films. The expected dependence of penetration depth lambda on thickness d was not observed, and the range of lambda was somewhat greater than expected. The range of coherence length was greater than predicted. The prediction for temperature dependence of critical current by Glover and Coffey was found to involve some oversimplification, and a suggested correction is supported by the data. For applied magnetic fields perpendicular to the applied current and parallel to the film surface, the relationship between the critical values of the magnetic field and the current was as predicted for lead films by Alphonse and Bergstein

Patronage in the dispute over child analysis between Melanie Klein and Anna Freud--1927-1932.

Science.gov (United States)

Aguayo, J

2000-08-01

The author investigates the role of patrons and advocates for Melanie Klein's clinical ideas at the British Psycho-Analytical Society against the backdrop of her theoretical and technical differences with Anna Freud from 1927 to 1932. He also outlines the development of Klein and Anna Freud's theories and techniques within the nascent discipline of child psychoanalysis. The London and Viennese patrons/advocates contributed to polarising what initially were clinical differences about how to analyse pre-latency and latency-age children and which technical processes might best facilitate successful treatment. While the author speculates that a diversity of motivations and agendas may have driven the London group's support for Klein--personal and politicised enthusiasm (Jones), genuine conviction (Riviere) and attempts at theoretical rapprochement between the London and Vienna schools (Glover)--he also argues that Freud's diagnosis with cancer in 1923 and suspicion of patricidal son-successors necessitated the choice of a female successor with unquestioning loyalty to his doctrines. From 1932, when Klein's clinical authority was established, her first group of English supporters began to splinter, as she went on to become a training analyst, mentor and patron in her own right to a succeeding generation of adherents who defended her views during the Controversial Discussions.

Solar Flare Prediction Science-to-Operations: the ESA/SSA SWE A-EFFort Service

Science.gov (United States)

Georgoulis, Manolis K.; Tziotziou, Konstantinos; Themelis, Konstantinos; Magiati, Margarita; Angelopoulou, Georgia

2016-07-01

We attempt a synoptical overview of the scientific origins of the Athens Effective Solar Flare Forecasting (A-EFFort) utility and the actions taken toward transitioning it into a pre-operational service of ESA's Space Situational Awareness (SSA) Programme. The preferred method for solar flare prediction, as well as key efforts to make it function in a fully automated environment by coupling calculations with near-realtime data-downloading protocols (from the Solar Dynamics Observatory [SDO] mission), pattern recognition (solar active-region identification) and optimization (magnetic connectivity by simulated annealing) will be highlighted. In addition, the entire validation process of the service will be described, with its results presented. We will conclude by stressing the need for across-the-board efforts and synergistic work in order to bring science of potentially limited/restricted interest into realizing a much broader impact and serving the best public interests. The above presentation was partially supported by the ESA/SSA SWE A-EFFort project, ESA Contract No. 4000111994/14/D/MRP. Special thanks go to the ESA Project Officers R. Keil, A. Glover, and J.-P. Luntama (ESOC), M. Bobra and C. Balmer of the SDO/HMI team at Stanford University, and M. Zoulias at the RCAAM of the Academy of Athens for valuable technical help.

Evaluación de barreras vegetales en el manejo integrado de la mancha anular del papayo (PRSV-P en Michoacán, México Evaluation of plant barriers in an integrated management of papayo ringspot in Michoacan, Mexico

Directory of Open Access Journals (Sweden)

Patricia Rivas-Valencia

2008-12-01

Full Text Available El efecto de barreras vegetales como componente de un programa de manejo integrado (MI, se validó y adaptó en 1999 en Michoacán, México, para controlar la Mancha Anular del Papayo, enfermedad causada por el Papaya ringspot potyvirus type-P (PRSV-P. Se estableció un experimento en parcelas divididas con dos factores experimentales: barreras vegetales (Hibiscus sabdariffa, y componentes de MI: MI sin aspersión de citrolina (1.5% (MI-A, MI sin eliminación de plantas con síntomas iniciales de virosis antes de floración (MI-D y MI. Las barreras vegetales sembradas 20 días antes del trasplante del papayo y el desplante retrasaron en 19 días el inicio del progreso de epidemias en el MI lo que resultó en una mayor producción (14.2% que el resto de tratamientos, aunque fue superado por MI-A en vigor (4% en diámetro de tallo. La citrolina fue fitotóxica, disminuyó el vigor de plantas (5.3% y no limitó significativamente el desarrollo de la enfermedad ya que la intensidad de las epidemias (X0 = 47días, Yf = 84% y ABCPE = 3220% días fue similar al testigo. El uso de barreras vegetales por si sola aparentemente no es suficiente para la reducción de la incidencia y dispersión de la enfermedad. Los áfidos más abundantes, con reconocida capacidad transmisora del PRSV-P, fueron Aphis gossypii, A. nerii, A. spiraecola y Macrosiphum euphorbiae, los cuales representaron aproximadamente el 13% del total de áfidos capturados.The effect of plant barriers as a component of an integrated management program (IM was validated and adapted in 1999, in Michoacan, Mexico, to control papaya ringspot, caused by papaya ringspot potyvirus type-P (PRSV-P. A split-plot design was established with two experimental factors: plant barriers and components of IM: IM without oil sprinkling (IM-O, IM without plant rouging (IM-R, and complete IM. Plant barriers (Hibiscus sabdariffa, sowed 20 days before papaya transplanting, and plant rouging delayed the epidemics

Membracidos de Colombia - I. Revisión parcial de las especies del género Alchisme Kirkaldy (Homoptera: Membracidae: Hoplophorioninae Membracidos de Colombia - I. Revisión parcial de las especies del género Alchisme Kirkaldy (Homoptera: Membracidae: Hoplophorioninae

Directory of Open Access Journals (Sweden)

Restrepo Mejía Ruben

1980-09-01

Full Text Available Se revisó el género Alchisme Kirkaldy. De las diecinueve especies anotadas por Metcalf (1965 no se obtuvieron especímenes de A. apicalis (Walker, A. costaricensis Goding, A. elevata Goding, A. laticornis Funkhouser, A. pinguicornisFunkhouser, A. recurva (Stäl, A. spinosa Funkhouser y A. truncaticornis (Germar. Se incluyen las descripciones originales de estas especies y tentativamente se localizan en la clave presentada. Se redescriben: A. bos (Fairmaire, A. fastidiosa (Fairmaire, A. grossa (Fairmaire, A. inermis (Fairmaire, A. nigrocarinata (Fairmaire, A. rubrocostata (Spinola, A. turrita (Germar, A. ustulata (Fairmaire, A. virescens (Fairmaire y A. nigrocarinata var. tridentata (Fairmaire, para la cual se usa su combinación original A. tridentata (Fairmaire. Se sinonimizóa A. projecta Funkhouser en favor de A. bos (Fairmaire.Se ilustran las principales características del pronoto y de los genitales de los machos; se observaron y se obtuvieron fotografías de los edeagos en un microscopio electrónico "rastreador" (Scanning Electro Microscope, las cualesse incluyen como parte de las ilustraciones. Se analizó la distribución geográfica del género y se ilustró por medio de mapas.The genus Alchisme Kirkaldy was revised. From nineteen species listed by Metcalf (1965 not specimens were obtained of eight of them. Original descriptions of these species are included and tentatively are localized in the key.  A redescription is given for the species A. bos (Fairmaire, A. fastidiosa (Fairmaire, A. grossa (Fairmaire, A. inermis (Fairmaire, A. nigrocarinata (Fairmaire, A. rubrocostata (Spinola, A. turrita (Germar, A. ustulata (Fairmaire, A. virescens (Fairmaire y A. nigrocarinata var. tridentata (Fairmaire, for which was used the original combination A. tridentata (Fairmaire. A. projecta Funkhouser was synonymized in A. bos (Fairmaire. The main pronotum characters and male genitalia are illustred; Scanning Electro Microscope pictures of the aedeagus of the insects were observed and obtained and are included as part of the illustrations. Geographic distributionsof the genus was analized and maps were prepared.

Inheritance Mode and Realized Heritability of Resistance to Imidacloprid in the Brown Planthopper, Nilaparvata lugens (Stal) (Homoptera: Delphacidae)

Science.gov (United States)

BACKGROUND: The brown planthopper, Nilaparvata lugens (Stål) is a serious pest which causes enormous losses to the rice crop in Asia. The genetic basis of imidacloprid resistance was investigated in N. lugens. RESULTS: The resistant strain, selected for imidacloprid resistance from a laboratory pop...

Insecticide susceptibility of the green plant bug, Apolygus lucorum Meyer-Dür (Homoptera: Miridae and two predatory arthropods

Directory of Open Access Journals (Sweden)

Zhang Zhengqun

2015-12-01

Full Text Available The green plant bug (Apolygus lucorum Meyer-Dür is a key pest of Bt cotton in China. Along with biological control, chemical control is one of the most important strategies in A. lucorum Integrated Pest Management (IPM. The goal of this study was to evaluate the toxicity of eight conventional insecticides to A. lucorum and to assess the susceptibility of two generalist predators Chrysopa sinica (Jieder and Propylaea japonica (Thunbery to insecticides that are commonly used in A. lucorum management. Via glass-vial and leaf-dip bioassay, toxicity tests with selected insecticides at two different life-stages of A. lucorum indicated significant differences between the LD50 or LC50 values for these compounds within different insecticidal classes. Phenylpyrazole fipronil had the highest toxicity to 4th-instar nymphs and adults of A. lucorum, whereas neonicotinoid imidacloprid had the lowest toxicity among the insecticides. Females were more tolerant to insecticides than were males, as shown by the higher LD50 values for females. Furthermore, laboratory tests showed that endosulfan had the highest selectivity to C. sinica and P. japonica: the selective toxicity ratios (STRs were superior to other tested insecticides, particularly imidacloprid, and were 5.396 and 4.749-fold higher than baseline STRs, respectively. From this study, we conclude that fipronil can potentially be used to efficiently control A. lucorum. An alternative control agent worth consideration is endosulfan, owing to its relative safety to non-targeted natural enemies.

Detection of resistance, cross-resistance, and stability of resistance to new chemistry insecticides in Bemisia tabaci (Homoptera: Aleyrodidae).

Science.gov (United States)

Basit, Muhammad; Saeed, Shafqat; Saleem, Mushtaq Ahmad; Denholm, Ian; Shah, Maqbool

2013-06-01

Resistance levels in whitefly, Bemisia tabaci (Gennadius) collections from cotton and sunflower (up to four districts) for five neonicotinoids and two insect growth regulators (IGRs) were investigated for two consecutive years. Based on the LC50(s), all collections showed slight to moderate levels of resistance for the tested insecticides compared with the laboratory susceptible population. The data also indicated that cotton and sunflower collections had similar resistance levels. In comparison (four collections), Vehari collections showed higher resistance for acetamiprid, thiacloprid, and nitenpyram compared with those of others. Average resistance ratios for acetamiprid, thiacloprid, and nitenpyram ranged from 5- to 13-, 4- to 8-, and 9- to 13-fold, respectively. Multan and Vehari collections also exhibited moderate levels (9- to 16-fold) of resistance to buprofezin. Furthermore, toxicity of neonicotinoids against immature stages was equal to that of insect growth regulators. The data also suggested that resistance in the field populations was stable. After selection for four generations with bifenthrin (G1 to G4), resistance to bifenthrin increased to 14-fold compared with the laboratory susceptible population. Selection also increased resistance to fenpropathrin, lambdacyhalothrin, imidacloprid, acetamiprid, and diafenthuron. Cross-resistance and stability of resistance in the field populations is of some concern. Rotation of insecticides having no cross-resistance and targeting the control against immature stages may control the resistant insects, simultaneously reducing the selection pressure imposed.

Characterization of three novel SINE families with unusual features in Helicoverpa armigera.

Directory of Open Access Journals (Sweden)

Jianjun Wang

Full Text Available Although more than 120 families of short interspersed nuclear elements (SINEs have been isolated from the eukaryotic genomes, little is known about SINEs in insects. Here, we characterize three novel SINEs from the cotton bollworm, Helicoverpa armigera. Two of them, HaSE1 and HaSE2, share similar 5' -structure including a tRNA-related region immediately followed by conserved central domain. The 3' -tail of HaSE1 is significantly similar to that of one LINE retrotransposon element, HaRTE1.1, in H. armigera genome. The 3' -region of HaSE2 showed high identity with one mariner-like element in H. armigera. The third family, termed HaSE3, is a 5S rRNA-derived SINE and shares both body part and 3'-tail with HaSE1, thus may represent the first example of a chimera generated by recombination between 5S rRNA and tRNA-derived SINE in insect species. Further database searches revealed the presence of these SINEs in several other related insect species, but not in the silkworm, Bombyx mori, indicating a relatively narrow distribution of these SINEs in Lepidopterans. Apart from above, we found a copy of HaSE2 in the GenBank EST entry for the cotton aphid, Aphis gossypii, suggesting the occurrence of horizontal transfer.

Characterization of Three Novel SINE Families with Unusual Features in Helicoverpa armigera

Science.gov (United States)

Wang, Jianjun; Wang, Aina; Han, Zhaojun; Zhang, Zan; Li, Fei; Li, Xianchun

2012-01-01

Although more than 120 families of short interspersed nuclear elements (SINEs) have been isolated from the eukaryotic genomes, little is known about SINEs in insects. Here, we characterize three novel SINEs from the cotton bollworm, Helicoverpa armigera. Two of them, HaSE1 and HaSE2, share similar 5′ -structure including a tRNA-related region immediately followed by conserved central domain. The 3′ -tail of HaSE1 is significantly similar to that of one LINE retrotransposon element, HaRTE1.1, in H. armigera genome. The 3′ -region of HaSE2 showed high identity with one mariner-like element in H. armigera. The third family, termed HaSE3, is a 5S rRNA-derived SINE and shares both body part and 3′-tail with HaSE1, thus may represent the first example of a chimera generated by recombination between 5S rRNA and tRNA-derived SINE in insect species. Further database searches revealed the presence of these SINEs in several other related insect species, but not in the silkworm, Bombyx mori, indicating a relatively narrow distribution of these SINEs in Lepidopterans. Apart from above, we found a copy of HaSE2 in the GenBank EST entry for the cotton aphid, Aphis gossypii, suggesting the occurrence of horizontal transfer. PMID:22319625

Genetic diversity and potential vectors and reservoirs of Cucurbit aphid-borne yellows virus in southeastern Spain.

Science.gov (United States)

Kassem, Mona A; Juarez, Miguel; Gómez, Pedro; Mengual, Carmen M; Sempere, Raquel N; Plaza, María; Elena, Santiago F; Moreno, Aranzazu; Fereres, Alberto; Aranda, Miguel A

2013-11-01

The genetic variability of a Cucurbit aphid-borne yellows virus (CABYV) (genus Polerovirus, family Luteoviridae) population was evaluated by determining the nucleotide sequences of two genomic regions of CABYV isolates collected in open-field melon and squash crops during three consecutive years in Murcia (southeastern Spain). A phylogenetic analysis showed the existence of two major clades. The sequences did not cluster according to host, year, or locality of collection, and nucleotide similarities among isolates were 97 to 100 and 94 to 97% within and between clades, respectively. The ratio of nonsynonymous to synonymous nucleotide substitutions reflected that all open reading frames have been under purifying selection. Estimates of the population's genetic diversity were of the same magnitude as those previously reported for other plant virus populations sampled at larger spatial and temporal scales, suggesting either the presence of CABYV in the surveyed area long before it was first described, multiple introductions, or a particularly rapid diversification. We also determined the full-length sequences of three isolates, identifying the occurrence and location of recombination events along the CABYV genome. Furthermore, our field surveys indicated that Aphis gossypii was the major vector species of CABYV and the most abundant aphid species colonizing melon fields in the Murcia (Spain) region. Our surveys also suggested the importance of the weed species Ecballium elaterium as an alternative host and potential virus reservoir.

The Effects of Dispersal and Predator Density on Prey Survival in an Insect-Red Clover Metacommunity.

Science.gov (United States)

Stasek, David J; Radl, James N; Crist, Thomas O

2018-01-01

Trophic interactions are often studied within habitat patches, but among-patch dispersal of individuals may influence local patch dynamics. Metacommunity concepts incorporate the effects of dispersal on local and community dynamics. There are few experimental tests of metacommunity theory using insects compared to those conducted in microbial microcosms. Using connected experimental mesocosms, we varied the density of the leafhopper Agallia constricta Van Duzee (Homoptera: Cicadellidae) and a generalist insect predator, the damsel bug (Nabis spp., Heteroptera: Nabidae), to determine the effects of conspecific and predator density and varying the time available to dispersal among mesocosms on predation rates, dispersal rates, and leafhopper survival. Conspecific and damsel bug density did not affect dispersal rates in leafhoppers, but this may be due to leafhoppers' aversion to leaving the host plants or the connecting tubes between mesocosms hindering leafhopper movement. Leafhopper dispersal was higher in high-dispersal treatments. Survival rates of A. constricta were also lowest in treatments where dispersal was not limited. This is one of the first experimental studies to vary predator density and the time available to dispersal. Our results indicate that dispersal is the key to understanding short-term processes such as prey survival in predator-prey metacommunities. Further work is needed to determine how dispersal rates influence persistence of communities in multigenerational studies. © The Author(s) 2017. Published by Oxford University Press on behalf of Entomological Society of America.

Mutualisme pucerons – fourmis : étude des bénéfices retirés par les colonies d'Aphis fabae en milieu extérieur

Directory of Open Access Journals (Sweden)

Verheggen F.

2009-01-01

Full Text Available Aphid – ant mutualism: an outdoor study of the benefits for Aphis fabae. Aphid – ant relationships are common examples of mutualism. Aphids are indeed submitted to predation and therefore require protection, while ants are continuously looking for new sugar sources. The present work aimed to study the benefits that a mutualistic relationship with Lasius niger (Hymenoptera, Formicidae could bring to the black bean aphid Aphis fabae (Homoptera, Aphididae. Several parameters were observed in the field, on broad bean plants infested with an initial amount of 100 A. fabae and in presence or not of a L. niger colony. More aphids were observed on plants being visited by ants as well as a higher proportion of winged individuals. One explanation is that fewer predators were observed on plants being visited by ants, demonstrating their protective role. However, the number of parasitized aphids was not reduced in presence of L. niger. On the other hand, fewer different aphid species were present on plants foraged by ants, what suggests that they could exert a predation on unattended aphids. Our observations do not allow to conclude on any impact of L. niger on the fitness of the aphid host plant, although fewer exuvia and honeydew spots were observed when they were present. All these results confirm that L. niger increase the fitness of A. fabae colonies mainly by decreasing the number of predators and by reducing competition from aphid species unattended by ants.

Original Article. An evaluation of some eco-friendly biopesticides against Bemisia tabaci on two greenhouse tomato varieties in Egypt

Directory of Open Access Journals (Sweden)

Abdel-Razek Atef S.

2016-08-01

Full Text Available This study has two main approaches. First, it exploits the susceptibility of tomato cultivars as a prophylactic measure to detect auto resistance characters of the tested tomato varieties against Bemisia tabaci (Gennadius (Homoptera: Aleyrodidae. Secondly, it evaluates the efficacy of different bio-rational insecticides against B. tabaci under greenhouse conditions. The results exhibited a special significance in B. tabaci infestation suitability between the two tomato varieties with a high infestation significance found in the Shifa F1 hybrid tomato variety compared to the Savera F1 hybrid tomato variety in the first plantation period. Subsequently, in the second plantation period, there was a significant difference between the two tomato varieties. Bemisia tabaci showed a preference for the Shifa F1 hybrid over the Savera F1 hybrid tomato variety. These differences occurred during the 1st, 2nd, 4th, 6th, 7th, 8th, and 10th weeks. In the experimental trial for the efficacy of eco-friendly biorational insecticides, spinosad, azadirachtin, Beauveria bassiana and Metarhizium anisopliae, there were significant differences between the treated and untreated plants during the two plantation periods. A high efficacy of spinosad on the B. tabaci population was found. Bemisia tabaci infestation under all the applications was reduced from 50 to 94.61% for the two plantation periods. This obvious decrease in B. tabaci population increase attention to benefits of the different bio-rational insecticides.

Development of a lateral flow test to detect metabolic resistance in Bemisia tabaci mediated by CYP6CM1, a cytochrome P450 with broad spectrum catalytic efficiency.

Science.gov (United States)

Nauen, Ralf; Wölfel, Katharina; Lueke, Bettina; Myridakis, Antonis; Tsakireli, Dimitra; Roditakis, Emmanouil; Tsagkarakou, Anastasia; Stephanou, Euripides; Vontas, John

2015-06-01

Cotton whitefly, Bemisia tabaci (Genn.) (Homoptera: Aleyrodidae) is a major sucking pest in many agricultural and horticultural cropping systems globally. The frequent use of insecticides of different mode of action classes resulted in populations resisting treatments used to keep numbers under economic damage thresholds. Recently it was shown that resistance to neonicotinoids such as imidacloprid is linked to the over-expression of CYP6CM1, a cytochrome P450 monooxygenase detoxifying imidacloprid and other neonicotinoid insecticides when recombinantly expressed in insect cells. However over-expression of CYP6CM1 is also known to confer cross-resistance to pymetrozine, an insecticide not belonging to the chemical class of neonicotinoids. In addition we were able to demonstrate by LC-MS/MS analysis the metabolisation of pyriproxyfen by recombinantly expressed CYP6CM1. Based on our results CYP6CM1 is one of the most versatile detoxification enzymes yet identified in a pest of agricultural importance, as it detoxifies a diverse range of chemical classes used to control whiteflies. Therefore we developed a field-diagnostic antibody-based lateral flow assay which detects CYP6CM1 protein at levels providing resistance to neonicotinoids and other insecticides. The ELISA based test kit can be used as a diagnostic tool to support resistance management strategies based on the alternation of different modes of action of insecticides. Copyright © 2014 Elsevier Inc. All rights reserved.

Analysis of the feeding habits of the swallow-tailed hummingbird, Eupetomena macroura (Gmelin, 1788, in an urban park in southeastern Brazil

Directory of Open Access Journals (Sweden)

MCB. Toledo

Full Text Available The aim of this work was to observe and describe the feeding habits and available food resources of the swallow-tailed hummingbird, Eupetomena macroura. The study was carried out in a municipal park located in the city of Taubaté, in the state of São Paulo. The observations took place between December 2003 and October 2004, recording the following variables: 1 the plant species visited for feeding and territorial defense; 2 the kinds of food resources; and 3 the kinds of flight to procure and obtain food. E. macroura visited 12 plant species. For territorial defense, Mangifera indica was the most visited, whereas Malvaviscus arboreus was most visited for feeding. The foliage was the plant part that received the most frequent visits. In order to obtain nectar, the only species visited was M. arboreus; to obtain arthropods, the species most visited were Mangifera indica and Hymenaea stilbocarpa. In the dry season, the hummingbirds visited flowers, whereas in the rainy season they visited leaves to acquire food. The arthropod groups most frequently found on leafy branches were Homoptera and Psocoptera. Finally, the results of the type of flight analysis showed that flight used to capture food was more often observed than were flights to search for food. In conclusion, these observations suggest that E. macroura shows plasticity in feeding behavior, which can help it to persist in urban areas.

Children's discrimination of expressions of emotions: relationship with indices of social anxiety and shyness.

Science.gov (United States)

Battaglia, Marco; Ogliari, Anna; Zanoni, Annalisa; Villa, Federica; Citterio, Alessandra; Binaghi, Flora; Fossati, Andrea; Maffei, Cesare

2004-03-01

To conduct an exploratory investigation of possible relationships between individual levels of social anxiety and the ability to classify emotional expressions in a group of schoolchildren observing pictures of children of similar age. One hundred forty-nine second- and third-grade schoolchildren underwent a facial expression discrimination trial. Children were characterized on the basis of the number of spontaneous comments they made during a pause in the trial, and on their scores on the Liebowitz Social Anxiety Scale, the Stevenson-Hinde and Glover Shyness-to-the-Unfamiliar Scale, and the Cloninger Harm Avoidance scale. The scales were filled in by appropriately trained teachers. The overall rate of correct identification was 72%, without gender-associated differences. Regression analyses showed that higher rates of misidentifications were significantly associated with higher scores on the Liebowitz scale and fewer spontaneous comments. Misidentifications of the "anger" expressions (most often misclassified as "disgust") were associated with higher ratings on the Liebowitz scale when children were exposed to a boy's picture and by fewer spontaneous comments when children were exposed to a girl's picture. Misidentification of a neutral expression of a girl's picture (most often misclassified as "sadness") was significantly associated with fewer spontaneous comments. These pilot results suggest that a child's ability to correctly identify other children's basic emotions is partially associated with his or her level of observed social shyness.

Vermelhão do algodoeiro Cotton "vermelhão" or anthocyanosis

Directory of Open Access Journals (Sweden)

A. S. Costa

1954-01-01

Full Text Available Uma moléstia do algodoeiro associada à infestação pelo pulgão Aphis gossypii, é descrita. É proposto que o nome vermelhão fique restrito a essa moléstia e que quando esta designação for usada em associação com outras moléstias, seja qualificada em seu emprêgo. São apontadas algumas diferenças que permitem distinguir o vermelhão do afídio de outras condições em que a coloração das fôlhas do algodoeiro é mais ou menos semelhante. Foi verificado que, quando afídios coletados de plantas com vermelhão eram alimentados em algodoeiros novos por 48 horas apenas, os sintomas da moléstia se manifestavam dentro de 12 a 30 dias. Infestações com um afídio por planta foram suficientes para reproduzir a moléstia em alguns casos ; com cinco afídios por planta conseguiu-se reproduzir a moléstia com maior freqüência ; com 25 afídios, em praticamente todos os casos. Insetos da mesma espécie, coletados de plantas de pepino, não produziram o vermelhão quando colocados sobre algodoeiros. Reprodução de vermelhão foi obtida por enxertia, passando os sintomas a se manifestar nos cavalos ; houve também perpetuação dos sintomas por enxertia em terceira reprodução vegetativa. A evidência obtida nos ensaios de reprodução da moléstia é discutida, sendo apontado que tudo indica ser um vírus a causa primária da moléstia e não toxina do inseto ou deficiência de elementos. Outras hipóteses alternativas são mencionadas.A disease associated with the infestation of cotton plants by the cotton or melon aphid, Aphis gossypii Glov. is described under the name of "vermelhão" or anthocyanosis. Symptoms of the disease resemble those resulting from magnesium deficiency. Aphids collected from diseased plants reproduced the disease when fed on cotton seedlings for 48 hours. Symptoms usually appeared from 12 to 30 days after inoculation, as chlorotic areas or spots that later turned reddish or purplish under strong light conditions

Scale insects and mealy bugs (Homoptera: Coccoidea) attacking deciduous fruit trees in the western north coast of Alexandria, Egypt.

Science.gov (United States)

Mourad, A K; Moursi Khadiga, S; Mesbah, H A; Abdel-Razak Soad, I

2008-01-01

This investigation covered a survey of scale insects and mealy bugs infesting ten growing species of deciduous fruit trees in three localities in Alexandria govemorate. These localities were Merghem, Burg El-Arab, and El-Nahda about 50 Km. West of Alexandria under both rain-fed and irrigation system conditions. The common inspected fruit trees were fig, white mulberry, pomegranate, apple, pear, apricot, European plum, peach, almond, and persimmon. It was shown that a group of twenty scale insects and meaty bug species pertaining to fifteen genera belonging to six families of the super family: Coccoidea were collected and identified during the elapsing period from January to December, 2004. Among these species, Diaspidiotus perniciosus (Comstock) was recorded for the first time in Egypt. In the present study, many insect and non-insect parasitoids and predators were also found associated with these scale insects and mealy bugs on deciduous fruit trees in the three concerned localities throughout this investigation. These natural enemies were identified and recorded.

Life table analysis of the performance of aphid Sitobion avenae (Homoptera: Aphididae nymphs exposed to a static magnetic field

Directory of Open Access Journals (Sweden)

He Juan

2013-01-01

Full Text Available Using the age-stage two-sex life table, this work was undertaken in order to determine the effect of static magnetic fields (SMFs at two flux densities (0.176T and 0.065T applied at increasing times of duration (0.25, 0.5, 1 and 2 h on the development, fecundity and reproduction of the aphid, Sitobion avenae. Exposed nymphs had a statistically significant shortened first instar period and adult longevity and prolonged fourth instar periods compared to controls. There were significant differences in the population parameters for two exposure combinations, 0.176T for 0.5 h and 0.065T for 1 h. The intrinsic rate of increase (r, net reproductive rate (R0 and mean generation time (T were 0.1165, 3.5 and 11.7 days, respectively, 0.176 T for 0.5 h and -0.0198, 0.7 and 11.8 days, respectively, 0.065T for 1 h. We therefore recommend using the age-stage, two-sex life table to study the effect of the static magnetic field on development and growth of the aphid, Sitobion avenae.

Phenology, natural enemies, and efficacy of horticultural oil for control of Chionaspis heterophyllae (Homoptera: Diaspididae) on Christmas tree plantations.

Science.gov (United States)

Fondren, Kirsten M; McCullough, Deborah G

2005-10-01

Pine needle scale, Chionaspis pinifoliae (Fitch), and Chionaspis heterophyllae Cooley are important pests of Scots pine, Pinus sylvestris L., and other conifers in much of North America. On Christmas tree plantations, these insects are typically controlled by spraying broad-spectrum insecticides when the vulnerable immature stages are present. However, effective control of bivoltine populations can be difficult to achieve due to asynchronous hatch and development of the second generation. Our objectives were to 1) determine the phenology of the second generation of C. heterophyllae in Michigan; 2) characterize the natural enemy complex; and 3) assess the effectiveness of horticultural oil for control of C. heterophyllae on P. sylvestris Christmas tree plantations. We monitored scale populations in three counties in lower Michigan for 3 yr. Scale phenology was consistently associated with cumulative degree-days base 10 degrees C (DD(10 degrees C)). Second-generation egg hatch began at approximately 1230-1300 DD(10 degrees C), and continued for approximately 3 wk. The peak of the second instar coincided with 1500-1600 DD(10 degrees C). Common predators included the coccinellids Chilocorus stigma (Say) and Microweisia misella (LeConte). On average, 70% of the C. heterophyllae population in unsprayed fields was killed by predators in 1999. Two endoparasitic wasps, Encarsia bella Gahan and Marietta mexicana Howard (Hymenoptera: Aphelinidae), also were recovered. In 2000 and 2001, we applied a highly refined horticultural spray oil with a backpack mist blower at 1500-1600 DD(10 degrees). Scale mortality on trees treated with oil ranged from 66 to 80% and was similar to control achieved using conventional insecticides in both years.

Susceptibility to neonicotinoids and risk of resistance development in the brown planthopper, Nilaparvata lugens (Stål) (Homoptera: Delphacidae).

Science.gov (United States)

Wang, Yanhua; Chen, Jin; Zhu, Yu Cheng; Ma, Chongyong; Huang, Yue; Shen, Jinliang

2008-12-01

In recent years, outbreaks of the brown planthopper, Nilaparvata lugens (Stål), have occurred more frequently in China. The objective of this study was to determine the susceptibility of N. lugens to neonicotinoids and other insecticides in major rice production areas in China. Results indicated that substantial variations in the susceptibility to different insecticides existed in N. lugens. Field populations had developed variable resistance levels to neonicotinoids, with a high resistance level to imidacloprid (RR: 135.3-301.3-fold), a medium resistance level to imidaclothiz (RR: 35-41.2-fold), a low resistance level to thiamethoxam (up to 9.9-fold) and no resistance to dinotefuran, nitenpyram and thiacloprid (RR buprofezin. In addition, N. lugens had been able to develop 1424-fold resistance to imidacloprid in the laboratory after the insect was selected with imidacloprid for 26 generations. Long-term use of imidacloprid in a wide range of rice-growing areas might be associated with high levels of resistance in N. lugens. Therefore, insecticide resistance management strategies must be developed to prevent further increase in resistance.

RESULTS OF THE THREE-YEAR MONITORING (2001.-2003. OF TOBACCO WHITEFLY Bemisia tabaci (Gennadius, 1889, (HOMOPTERA: ALEYRODIDAE IN CROATIA

Directory of Open Access Journals (Sweden)

Tatjana Masten

2004-06-01

Full Text Available The quarantine pest tobacco whitefly Bemisia tabaci (Gennadius, 1889 was for the first time found in Croatia in 2000 on some culture and weed plants in greenhouses and in the open field in the area from Trogir to Omiš. Monitoring of tobacco whitefly was organized in all counties (21. Eventual presence of tobacco whitefly adults on the plants in glasshouses was established by the hanging of yellow sticky traps. In the course of monitoring the undersides of leaves on host plants were inspected for the purpose of discovering pest nymphal and pupal stages. The plants of poinsettia (Euphorbia pulcherrima produced as pest free plants have been used as catch plants in the conditions of lower infestation of host plants by tobacco whitefly adults. In three-year monitoring it was found out that poinsettia is the most atractive host plant for this pest between 38 host plants being registered during this monitoring. The fact that tobacco whitefly during the summer was found on the vegetables, ornamentals and weeds in the open fields in Dalmatia indicate that tobacco whitefly became domesticated and it can successfully overwinter in mediteranean climate conditions. During the monitoring tobacco whitefly was detected in 13 counties in our country, indicating shows that tobacco whitefly has been spreading progresivly since it was found in Croatia for the first time.

Effect of different humidity levels on the biology of longtailed mealy bug pseudococcus longispinus (targioni and tozzetti) (homoptera: pseudococidae)

International Nuclear Information System (INIS)

Gillani, W.A.

2009-01-01

On determining the effects of different humidity levels on the biology of mealy bug Pseudococcus longispinus (Targioni and Tozzetti), it was found that the relative humidity (RH) at 35%, 55% and 75% had no effect on pre-adult development, adult longevity, life span and fecundity of P. longispinus. The survival of pre-adult stages was minimal at 35% RH. Sex ratio was male-biased at 35% RH and female-biased at 75% RH. (author)

Antifeedant activity of botanical crude extracts and their fractions on Bemisia tabaci (Homoptera: Aleyrodidae adults: I. Gliricidia sepium (Fabaceae

Directory of Open Access Journals (Sweden)

Guillermo Flores

2008-12-01

Full Text Available Bemisia tabaci is an important virus vector on a number of crops worldwide. Therefore, a preventive approach to deal with viral epidemics may be the deployment of repellents or phagodeterrents at earlier stages of plant development (critical period. Thus, the crude extract and four fractions thereof (water, water:methanol, methanol, and diethyl ether of mother-of-cocoa (Gliricidia sepium, Fabaceae were tested for phagodeterrence to B. tabaci adults under greenhouse conditions, on tomato plants, in Costa Rica. Both restricted-choice and unrestricted-choice experiments showed that the crude extract and some fractions exerted such effect on the insect. In the former (in sleeve cages, three fractions caused deterrence at doses as low as 0.1% (methanol, 0.5% (water:methanol and 1.5% (diethyl ether. However, in the latter (plants exposed in a greenhouse no one of the fractions performed well, suggesting that the deterrent principles somehow decomposed under the experimental conditions. Rev. Biol. Trop. 56 (4: 2099-2113. Epub 2008 December 12.Mundialmente, Bemisia tabaci es un importante vector de virus en numerosos cultivos. Por tanto, un enfoque preventivo para enfrentar las epidemias virales podría ser el empleo de sustancias repelentes o fagodisuasivas en las etapas tempranas del desarrollo de las plantas (período crítico. Así, tanto el extracto crudo como cuatro fracciones (agua, agua:metanol, metanol y éter dietílico del madero negro (Gliricidia sepium, Fabaceae fueron evaluadas en cuanto a su actividad fagodisuasiva sobre los adultos de B. tabaci en condiciones de invernadero, utilizando plantas de tomate, en Turrialba, Costa Rica. Tanto los experimentos de escogencia restringida como los de escogencia irrestricta revelaron que el extracto crudo y algunas fracciones mostraron dicha actividad. En los primeros experimentos (en jaulas de manga, tres fracciones causaron fagodisuasión a dosis tan bajas como 0.1% (metanol, 0.5% (agua:metanol y 1.5% (éter dietílico. Sin embargo, en los segundos (plantas expuestas dentro de un invernadero ninguna de las fracciones lo hizo, lo cual sugiere que los principios fagodisuasivos perdieron su actividad en esas condiciones experimentales.

Antifeedant activity of botanical crude extracts and their fractions on Bemisia tabaci (Homoptera: Aleyrodidae adults: II. Sechium pittieri (Cucurbitaceae

Directory of Open Access Journals (Sweden)

Guillermo Flores

2008-12-01

Full Text Available Bemisia tabaci is a key pest of vegetables and other crops worldwide, but it is a particularly serious problem in the tropics, due to its ability to transmit several types of viruses, especially begomoviruses (Geminiviridae. Therefore, a preventive approach to deal with viral epidemics may be the deployment of repellents or phagodeterrents at earlier stages of plant development (critical period. Thus, the crude extract and four fractions thereof (water, water: methanol, methanol, and diethyl ether of wild "tacaco" (Sechium pittieri, Cucurbitaceae, were tested for phagodeterrence to B. tabaci adults under greenhouse conditions, on tomato plants, in Costa Rica. Both restricted-choice and unrestricted-choice experiments showed that the crude extract as well as some fractions exert such effect on the insect. In the former (in sleeve cages, fractions caused deterrence at doses as low as 0.1% (ether and 0.5% (water and water: methanol, with the methanol fraction showing no activity. However, in the latter (plants exposed in a greenhouse no one of the fractions performed well, suggesting that the deterrent principles somehow decomposed under the experimental conditions. Rev. Biol. Trop. 56 (4: 2115-2129. Epub 2008 December 12.Bemisia tabaci es una plaga clave de hortalizas y otros cultivos, mundialmente, y representa un problema particularmente serio en los trópicos, debido a su habilidad para transmitir varios tipos de virus, especialmente begomovirus (Geminiviridae. Por tanto, un enfoque preventivo para enfrentar las epidemias virales podría consistir en la utilización de sustancias repelentes o disuasivas en las eta-pas tempranas del desarrollo de la planta (período crítico. Así, el extracto crudo y cuatro fracciones (agua, agua: metanol, metanol, y éter dietílico de tacaco cimarrón (Sechium pittieri, Cucurbitaceae, fueron evaluadas por su posible actividad fagodisuasiva sobre B. tabaci en un invernadero, utilizando plantas de tomate, en Turrialba, Costa Rica. Tanto los experimentos de escogencia restringida como los de escogencia irrestricta mostraron dicha actividad en el extracto crudo y en algunas de sus fracciones. En el primer tipo de experimento (en jaulas de manga, las fracciones causaron fagodisuasión a dosis tan bajas como 0.1% (éter dietílico y 0.5% (agua y agua: metanol, mientras que la fracción metanólica no la causó. Sin embargo, en los otros experimentos (plantas expuestas a B. tabaci dentro de un invernadero ninguna de las fracciones funcionó bien, lo cual sugiere que los principios disuasivos se disiparon bajo esas condiciones experimentales.

Biología de Eretmocerus mundus (Hymenoptera: Aphelinidae, parasitoide del complejo Bemisia tabaci (Homoptera: Aleyrodidae, en condiciones de laboratorio

Directory of Open Access Journals (Sweden)

Yerlin CHACÓN CASTRO

2010-01-01

Full Text Available La estimación de los atributos biológicos de un enemigo natural, previa a su empleo en el campo, constituye un aspecto de importancia en todo proyecto de control biológico. El objetivo de este trabajo fue evaluar los principales parámetros biológicos de Eretmocerus mundus Mercet, parasitoide de Bemisia tabaci (Gennadius, bajo condiciones de laboratorio. La emergencia del adulto, longevidad y fecundidad de la hembra, proporción sexual de la descendencia, tasa intrínseca de crecimiento poblacional (r m , tasa neta de reproducción (R o y tiempo generacional (T; se estimaron mediante la técnica de tabla de vida y fecundidad, utilizando el pimiento ( Capsicum annuum L. y el tomate ( Solanum lycopersicum L. como plantas hospederas. Los resultados obtenidos en pimiento y tomate fueron respectivamente: supervivencia pupal: 86.86 ± 1.94 y 83,45 ± 2,13%; longevidad de la hembra: 18,19 ± 1,61 y 17,00 ± 0,92 días; proporción sexual: 0,34 ± 0,06 y 0,47 ± 0,05 hembras/(machos + hembras; l x50 : 21 y 18 días; r m : 0,226 ± 0,061 y 0,228 ± 0,057 ninfas parasitadas/hembra/día; Ro: 189,71 ± 24,25 y 154,65 ± 17,58 ninfas parasitadas/hembra; T: 25,88 ± 0,42 y 24,03 ± 0,34 días. Los resultados obtenidos son una contribución al conocimiento de la población local del parasitoide y su posible papel como agente de control biológico de B. tabaci.

Richness and composition of gall-inducing arthropods at Coiba National Park, Panama

Directory of Open Access Journals (Sweden)

José Luis Nieves-Aldrey

2008-09-01

Full Text Available Interest in studying galls and their arthropods inducers has been growing rapidly in the last two decades. However, the Neotropical region is probably the least studied region for gall-inducing arthropods. A study of the richness and composition of gall-inducing arthropods was carried out at Coiba National Park in the Republic of Panama. Field data come from samples obtained between August 1997 and September 1999, with three (two-week long more intensive samplings. Seventeen sites, representing the main land habitats of Coiba National Park were surveyed. 4942 galls of 50 insect and 9 mite species inducing galls on 50 vascular plants from 30 botanical families were colleted. 62.7% of the galls were induced by gall midges (Diptera, Cecidomyiidae, 15.3% by mites, Eriophyidae, 8.5% by Homoptera, Psyllidae, 6.8% by Coccidae and 5.1% by Phlaeothripidae (Tysanoptera. The host plant families with the most galls were Myrtaceae with seven, Bignoniaceae with five and Euphorbiaceae, Fabaceae and Melastomataceae with four. Leaf galls accounted for about 93% of collected galls. Most leaf galls were pit/blister galls followed by covering and pouch galls. Gall richness per collecting site was between 1 and 19 species. Coiba’s gall diversity is discussed in relation to data available from other tropical sites from continental Panama and the Neotropical region. Our results support the idea that it may be premature to conclude that species richness of gall inducers declines near the equator. Rev. Biol. Trop. 56 (3: 1269-1286. Epub 2008 September 30.El interés por el estudio de las agallas y los artrópodos que las inducen ha crecido en todo el mundo en los últimos veinte años. Sin embargo, los artrópodos que inducen agallas en la región Neotropical son probablemente los menos estudiados. Un estudio de la riqueza y composición de artrópodos que inducen agallas fue desarrollado en el Parque Nacional Coiba en la Republica de Panamá. Los datos provienen de

Surtos populacionais de Bemisia tabaci no estado de São Paulo Outbreaks of Bemisia tabaci in the São Paulo State, Brazil

Directory of Open Access Journals (Sweden)

André Luiz Lourenção

1994-01-01

Full Text Available A partir de 1991, tem sido observada a presença da mosca-branca Bemisia tabaci (Genn. (Homoptera: Aleyrodidae em altas populações em hortaliças e orna-mentais nos municípios paulistas de Paulínia, Holambra, Jaguariúna e Artur Nogueira. Foram constatadas infestações severas em tomateiro, brócolos, berinjela e aboboreira; nesta última, o sintoma observado em plantas infestadas pela mosca-branca é o prateamento da face superior das folhas, em conjunto com queda drástica da produção. Uma lavoura de tomate severamente infestada por B. tabaci apresentava o sintoma referido colo amadurecimento irregular dos frutos do tomateiro; plantas invasoras presentes nessa área também foram intensamente colonizadas, principalmente Sida rhombifolia L., Sonchus oleraceus L., Solanum viarum Dun. e Ipomoea acuminata Roem. & Schult. Em Holambra, verificaram-se ataques intensos em plantas ornamentais, principalmente crisântemo (Chrysantemum morifolium Ramat. e bico-de-papagaio (Euphorbia pulcherrima Willd.; roseiras foral pouco colonizadas. Nessas hortaliças e nas ornamentais, a aplicação quase diária de inseticidas não reduziu a infestação do inseto. Além dessas plantas, campos de algodão, em Holambra, e de feijão, em Paulínia, também foram infestados por B. tabaci. Nos E.U.A., a capacidade de certas populações de B. tabaci de induzir o prateamento da folha em aboboreira e de colonizar intensamente E. pulcherrima, entre outros fatores, têm levado à distinção do biótipo "B" ou "poinsétia", nome vulgar dessa euforbiácea; todavia, estudos recentes na Califórnia (E.U.A. mostram a possibilidade de se tratar de duas espécies distintas. Dada a similaridade entre as infestações associadas a B. tabaci que vêm ocorrendo naquele país e, mais recentemente, no Brasil, é provável que o biótipo B ou essa nova espécie tenha sido aqui introduzido.Since 1991, an increase in the populations of the whitefly Bemisia tabaci (Genn. (Homoptera

Luta biológica clássica com Hyperaspis pantherina Fürsch (Coleoptera: Coccinellidae no combate à Orthezia insignis Browne (Homoptera: Ortheziidae em jacarandá Biological control with Hyperaspis pantherina Fürsch (Coleoptera: Coccinellidae to control Orthezia insignis Browne (Homoptera: Ortheziidae on blue jacaranda

Directory of Open Access Journals (Sweden)

Ana Paula Félix

2008-12-01

Full Text Available Os jacarandás e várias plantas ornamentais que ornamentam passeios e áreas ajardinadas da cidade do Funchal encontram-se infestados pela cochonilha Orthezia insignis Browne. Para combater esta praga foi importada do Quénia, uma joaninha, Hyperaspis pantherina Fürsch. Este predador é específico de O. insignis e tem sido utilizado, com sucesso em programas de luta biológica, em vários países de África, no Peru, Hawai e na Ilha de Santa Helena. Na Ilha da Madeira, desde Julho de 2002, H. pantherina está a ser criado em laboratório e largado em jacarandás infestados com o objectivo de combater a cochonilha-dojacarandá através da luta biológica clássica. Referem-se as largadas de H. pantherina e o sistema de monitorização adoptado para verificar a aclimatação do predador.The Jacaranda trees and other ornamental plants used in sidewalks and gardenlike areas of sidewalks and other gardened areas of the downton Capital city of Madeira Island (Funchal, are infested by the Jacaranda or Lantana Bug, Orthezia insignis Browne. A ladybird, Hyperaspis pantherina Fürsch, was imported from Kenya to control this pest. This ladybird is a specific predator of O. insignis and it has been used, successfully in biological control programs, in several countries of Africa, in Peru, Hawaii and in Santa Helena Island. In Madeira Island, H. pantherina is being reared in laboratory and released into infested jacarandas since July 2002, in a classical biological control way. The releasing of H. pantherina is described in detail as well as the adopted monitoring system to verify its acclimation.

Microbial Production of Food Grade Pigments

Directory of Open Access Journals (Sweden)

Laurent Dufossé

2006-01-01

Full Text Available The controversial topic of synthetic dyes in food has been discussed for many years. The scrutiny and negative assessment of synthetic food dyes by the modern consumer have raised a strong interest in natural colouring alternatives. Nature is rich in colours (minerals, plants, microalgae, etc., and pigment-producing microorganisms (fungi, yeasts, bacteria are quite common. Among the molecules produced by microorganisms are carotenoids, melanins, flavins, quinones, and more specifically monascins, violacein or indigo. The success of any pigment produced by fermentation depends upon its acceptability on the market, regulatory approval, and the size of the capital investment required to bring the product to market. A few years ago, some expressed doubts about the successful commercialization of fermentation-derived food grade pigments because of the high capital investment requirements for fermentation facilities and the extensive and lengthy toxicity studies required by regulatory agencies. Public perception of biotechnology-derived products also had to be taken into account. Nowadays some fermentative food grade pigments are on the market: Monascus pigments, astaxanthin from Xanthophyllomyces dendrorhous, Arpink Red from Penicillium oxalicum, riboflavin from Ashbya gossypii, b-carotene from Blakeslea trispora. The successful marketing of pigments derived from algae or extracted from plants, both as a food colour and a nutritional supplement, reflects the presence and importance of niche markets in which consumers are willing to pay a premium for »all natural ingredients«.

Mucilaginibacter vulcanisilvae sp. nov., isolated from a volcanic forest.

Science.gov (United States)

Baek, Kyunghwa; Ok Jeon, Che

2015-07-01

A Gram-stain-negative, strictly aerobic, pale-pink-pigmented bacterium, designated strain G27(T), was isolated from a volcanic forest of Jeju Island, South Korea. Cells were catalase- and oxidase-positive, non-motile rods producing exopolysaccharide and flexirubin-type and pale pink pigments. Growth of strain G27(T) was observed at 4-30 °C (optimum, 25 °C) and pH 5.0-8.0 (optimum, pH 7.0). Phylogenetic analyses based on 16S rRNA gene sequences showed that strain G27(T) formed a phyletic lineage within the genus Mucilaginibacter of the family Sphingobacteriaceae. Strain G27(T) was related most closely to Mucilaginibacter gossypii Gh-67(T) at 96.5% 16S rRNA gene sequence similarity. Strain G27(T) contained menaquinone 7 (MK-7) as the sole isoprenoid quinone and summed feature 3 (comprising C16:1ω7c/C16:1ω6c), iso-C15:0, C16:0, C16:1ω5c and C16:1ω5c as the major cellular fatty acids. Phosphatidylethanolamine was identified as the major polar lipid. The G+C content of the genomic DNA was 46.5 mol%. On the basis of phenotypic, chemotaxonomic and molecular properties, strain G27(T) represents a novel species of the genus Mucilaginibacter, for which the name Mucilaginibacter vulcanisilvae sp. nov. is proposed. The type strain is G27(T) ( = KACC 18231(T) = JCM 30363(T)).

Resistance to Cucurbit aphid-borne yellows virus in Melon Accession TGR-1551.

Science.gov (United States)

Kassem, Mona A; Gosalvez, Blanca; Garzo, Elisa; Fereres, Alberto; Gómez-Guillamón, Maria Luisa; Aranda, Miguel A

2015-10-01

The genetic control of resistance to Cucurbit aphid-borne yellows virus (CABYV; genus Polerovirus, family Luteoviridae) in the TGR-1551 melon accession was studied through agroinoculation of a genetic family obtained from the cross between this accession and the susceptible Spanish cultivar 'Bola de Oro'. Segregation analyses were consistent with the hypothesis that one dominant gene and at least two more modifier genes confer resistance; one of these additional genes is likely present in the susceptible parent 'Bola de Oro'. Local and systemic accumulation of the virus was analyzed in a time course experiment, showing that TGR-1551 resistance was expressed systemically as a significant reduction of virus accumulation compared with susceptible controls, but not locally in agroinoculated cotyledons. In aphid transmission experiments, CABYV inoculation by aphids was significantly reduced in TGR-1551 plants, although the virus was acquired at a similar rate from TGR-1551 as from susceptible plants. Results of feeding behavior studies using the DC electrical penetration graph technique suggested that viruliferous aphids can salivate and feed from the phloem of TGR-1551 plants and that the observed reduction in virus transmission efficiency is not related to reduced salivation by Aphis gossypii in phloem sieve elements. Since the virus is able to accumulate to normal levels in agroinoculated tissues, our results suggest that resistance of TGR-1551 plants to CABYV is related to impairment of virus movement or translocation after it reaches the phloem sieve elements.

Temporal and spatial changes in the diet of Hyla pulchella (Anura, Hylidae in southern Uruguay

Directory of Open Access Journals (Sweden)

Inés da Rosa

2004-12-01

Full Text Available In this article we report the diet of a population of the hylid frogHyla pulchella from southeastern Uruguay. We collected the specimens in ponds, where we identified microenvironments defined by the invertebrate assemblage, during one year divided into two seasons (warm and cold. We taxonomically determined 10365 invertebrates belonging to 21 categories in the digestive tracts of frogs. Weestimated the diversity of the diet and alimentary preference according to microenvironments and seasons. We estimated the expected richness of both diet and prey availability using a null model based on the hypergeometric distribution. We performed Discriminant Analyses and Kruskal-Wallis tests to detect changes in prey availability among microenvironments and between seasons. The overall diet in terms of frequencies was composed primarily of arthropods (mainly Araneae, Diptera, Hymenoptera, and Coleoptera and in terms of volume, by larvae. The most relevantitems to study the microenvironmental and seasonal variation in the available preys were Araneae, Collembola, Homoptera, Hymenoptera, Diptera, Dictioptera, Lepidoptera, Coleoptera, and larvae. Based on the null model curves and preference indexes we inferred positive selection by larvae, Isopoda, Dictioptera, Lepidoptera, and Diptera, and negative selection by Collembola and Hymenoptera. The diversityof diet and the null model curves indicated that the diet changes among microenvironments and seasons. This frog may be considered as a middle generalist predator, with some selective behavior and a combined search strategy (active and sit-and-wait. We conclude that the knowledge about the availability of preys is a relevant tool for trophic studies.

Seleksi Resistansi Wereng Batang Padi Coklat terhadap Insektisida Fipronil

Directory of Open Access Journals (Sweden)

Melhanah Melhanah

2002-12-01

Full Text Available The rice brown planthoper, Nilaparvata lugens Stal (Homoptera: Delphacidae, is one of  key pests on rice. The use of insecticides unwisely has caused N. lugens to develop resistance. The objective of this research was to determine the potency of N. lugens to develop resistance through laboratory, selections to fipronil, a relatively new insecticide.  A population of N. lugens was collected from rice field in Muntilan, Central Java during the outbreak in 2001. Selections were carried out every generation for four generations against third instars. Selection was started by dipping Cisadane rice seedlings in a solution of fipronil (50 ppm. The concentration was increased every generation, and the concentration used for the last selection (the fourth generation was 250 ppm. To determine the rate of resistance development, biassays were carried out to estimate LC50 of fipronil against selected and non-selected populations of N. lugens, and their LC50 values were compared to that of the laboratory population. The laboratory population has been in the laboratory for 15 years without any insecticides exposure. The founding population was as susceptible as the laboratory population to fipronil because their LC50 values were similar. Even though the concentration for selections was increased from generation to generation, the survival rate of N. lugens increased steadily. After four generations of selection, the resistance of selected population was 27.3 times than the non-selected population. These findings indicate that N. lugens population has the potency to develop resistance to fipronil in a continuous selection pressure is applied.

Introduced and invasive insect species in the Czech Republic and their economic and ecological impact (Insecta

Directory of Open Access Journals (Sweden)

Hana Šefrová

2005-01-01

Full Text Available A total of 383 alien insect species were registered in the Czech Republic, which represents 1.4% of local fauna. The most numerous taxonomic groups are Homoptera (116 species, 30.3%, Coleoptera (110; 28.7% and Lepidoptera (37; 9.7%. The occurrence of 200 species (52.2% are limited to closed heated spaces, casual aliens (28; 7.3% infiltrate the outdoor environment for a short term only, 36 (9.4% naturalized non-invasive species do not spread from the location of introduction, 50 (13.1% species are post-invasive and 69 (18.0% invasive. From the species registered, 61 (15.9% are stored product pests (especially Coleoptera 36 species, Psocoptera 11, and Lepidoptera 9, 50 (13.1% are plant pests indoors (especially Coccinea 33 species, Aphidinea 7, and Thysanoptera 6, 25 (i.e. 6.5% of aliens are pests in agriculture, forestry, and in ornamental cultures, 15 species (3.9% are important animal parasites, and 5 species (1.3% can affect biodiversity. Of the remaining 227 species (59.3%, no economic or ecological effects were found. The origin of most of the species living eusynanthropically is in the tropics and subtropics; of the 155 naturalized (non-invasive, post-invasive, and invasive species, 42 (27.1% originate from the Mediterranean, 36 (23.2% from North America, 28 (18.1% from Central to Southwest Asia, 14 (9.0% from East Asia, 13 (8.4% from South and Southeast Asia, with the remaining 22 species (14.2% coming from other areas.

Composition of arthropod species assemblages in Bt-expressing and near isogenic eggplants in experimental fields.

Science.gov (United States)

Arpaia, Salvatore; Di Leo, Grazia M; Fiore, Maria C; Schmidt, Jörg E U; Scardi, Michele

2007-02-01

The environmental impact of genetically modified (GM) plants in experimental fields has been examined in several ways, in particular with respect to the dynamics of specific nontarget organisms. The approach of sampling for biodiversity in agroecosystems to compare complex patterns could also be useful in studying potential disruptions caused by GM crops. In this study, we set up replicated field plots of Bt-expressing eggplants and near isogenic untransformed eggplants as a control. We monitored the presence and abundance of herbivore and predator arthropods in weekly visual samplings of the plant canopy for three growing seasons (2001-2003). Insect species were pooled in organismal taxonomic units (OTUs); three multivariate methods were used to compare species assemblage as an estimate of insect biodiversity. This multistep statistical approach proved to be efficient in recognizing association patterns, as evidenced by the data for the target species Leptinotarsa decemlineata Say (Coleoptera: Chrysomelidae) clearly showing a significant association with the control plots. All the analyses indicate a comparable species assemblage between transgenic and near isogenic eggplant areas. Our results suggest that some taxa may warrant more specific study. For example, Alticinae beetles (Coleoptera: Chrysomelidae) were alternatively more abundant in either of the two treatments, and their overall abundance was significantly higher on transgenic eggplants. In light of these results and because of their taxonomic proximity to the target species, these herbivores may represent an important nontarget group to be further studied. Moreover, some sap feeders (e.g., Homoptera: Cicadellidae) were more abundant on Bt-expressing plants in some samples in all 3 yr.

Aphid wing induction and ecological costs of alarm pheromone emission under field conditions.

Directory of Open Access Journals (Sweden)

Eduardo Hatano

2010-06-01

Full Text Available The pea aphid, Acyrthosiphon pisum Harris, (Homoptera: Aphididae releases the volatile sesquiterpene (E-beta-farnesene (EBF when attacked by a predator, triggering escape responses in the aphid colony. Recently, it was shown that this alarm pheromone also mediates the production of the winged dispersal morph under laboratory conditions. The present work tested the wing-inducing effect of EBF under field conditions. Aphid colonies were exposed to two treatments (control and EBF and tested in two different environmental conditions (field and laboratory. As in previous experiments aphids produced higher proportion of winged morphs among their offspring when exposed to EBF in the laboratory but even under field conditions the proportion of winged offspring was higher after EBF application (6.84+/-0.98% compared to the hexane control (1.54+/-0.25%. In the field, the proportion of adult aphids found on the plant at the end of the experiment was lower in the EBF treatment (58.1+/-5.5% than in the control (66.9+/-4.6%, in contrast to the climate chamber test where the numbers of adult aphids found on the plant at the end of the experiment were, in both treatments, similar to the numbers put on the plant initially. Our results show that the role of EBF in aphid wing induction is also apparent under field conditions and they may indicate a potential cost of EBF emission. They also emphasize the importance of investigating the ecological role of induced defences under field conditions.

Dietary analysis of Homonota darwini (Squamata: Gekkoni-dae in Northern Patagonia

Directory of Open Access Journals (Sweden)

Marcelo E. KUN, Carla PIANTONI, John D. KRENZ, Nora R. IBARGÜENGOYTÍA

2010-08-01

Full Text Available Our study investigated the diet of the southernmost gecko in the world, Homonota darwini. Fifty-three specimens were captured during spring and summer in four locations in Patagonia, Argentina. The stomach contents of the specimens were identified, and we found that prey consisted of six main groups: Coleoptera, Hymenoptera, Homoptera and Araneae, and the adults and larvae of moth Lepidoptera. Lepidoptera was the major dietary component. The presence of ants and moths as common prey suggests an ambush feeding strategy. In spring, females consumed more ants than males although no other dietary differences between males and females were evident. We found nine geckos with empty stomachs and six parasitized by nematodes. Presence of empty stomachs corroborates previous observations of other nocturnal geckos and non-gecko lizards. Reduced foraging success of nocturnal lizards could be due to difficulty in prey detection due to dim light, reduced or erratic activity of insect prey at night, or shorter activity times of geckos relative to diurnal success. Sex and season were not associated with the incidence of empty stomachs. Principal component analysis showed that four food alternatives correlated with season. The constraint of nocturnality, coupled with low night-time temperatures restricting feeding to only a few hours after sunset, appear to have caused a generality of diet which may limit energy acquisition. We conclude that H. darwini is an arthropod generalist and likely an ambush forager, as are many other nocturnal gekkonids [Current Zoology 56 (4: 406–410, 2010].

Evaluation of airborne methyl salicylate for improved conservation biological control of two-spotted spider mite and hop aphid in Oregon hop yards.

Science.gov (United States)

Woods, J L; James, D G; Lee, J C; Gent, D H

2011-12-01

The use of synthetic herbivore-induced plant volatiles (HIPV) to attract natural enemies has received interest as a tool to enhance conservation biological control (CBC). Methyl salicylate (MeSA) is a HIPV that is attractive to several key predators of two-spotted spider mite, Tetranychus urticae Koch (Acari: Tetranychidae), and hop aphid, Phorodon humuli (Schrank) (Homoptera: Aphididae). A 2-year study was conducted to evaluate the recommended commercial use of MeSA in hop yards in Oregon. Slow-release MeSA dispensers were stapled to supporting poles in 0.5 ha plots and these plots were compared to a paired non-treated plot on each of three farms in 2008 and 2009. Across both years, there was a trend for reduced (range 40-91%) mean seasonal numbers of T. urticae in five of the six MeSA-baited plots. Stethorus spp., key spider mite predators, tended to be more numerous in MeSA-baited plots compared to control plots on a given farm. Mean seasonal densities of hop aphid and other natural enemies (e.g., Orius spp. and Anystis spp.) were similar between MeSA-treated and control plots. Variability among farms in suppression of two-spotted spider mites and attraction of Stethorus spp. suggests that the use of MeSA to enhance CBC of spider mites in commercial hop yards may be influenced by site-specific factors related to the agroecology of individual farms or seasonal effects that require further investigation. The current study also suggests that CBC of hop aphid with MeSA in this environment may be unsatisfactory.

A reassessment of the early archaeological record at Leang Burung 2, a Late Pleistocene rock-shelter site on the Indonesian island of Sulawesi

Science.gov (United States)

Hakim, Budianto; Ramli, Muhammad; Aubert, Maxime; van den Bergh, Gerrit D.; Li, Bo; Burhan, Basran; Saiful, Andi Muhammad; Siagian, Linda; Sardi, Ratno; Jusdi, Andi; Abdullah; Mubarak, Andi Pampang; Moore, Mark W.; Roberts, Richard G.; Zhao, Jian-xin; McGahan, David; Jones, Brian G.; Perston, Yinika; Szabó, Katherine; Mahmud, M. Irfan; Westaway, Kira; Jatmiko; Saptomo, E. Wahyu; van der Kaars, Sander; Grün, Rainer; Wood, Rachel; Dodson, John

2018-01-01

This paper presents a reassessment of the archaeological record at Leang Burung 2, a key early human occupation site in the Late Pleistocene of Southeast Asia. Excavated originally by Ian Glover in 1975, this limestone rock-shelter in the Maros karsts of Sulawesi, Indonesia, has long held significance in our understanding of early human dispersals into ‘Wallacea’, the vast zone of oceanic islands between continental Asia and Australia. We present new stratigraphic information and dating evidence from Leang Burung 2 collected during the course of our excavations at this site in 2007 and 2011–13. Our findings suggest that the classic Late Pleistocene modern human occupation sequence identified previously at Leang Burung 2, and proposed to span around 31,000 to 19,000 conventional 14C years BP (~35–24 ka cal BP), may actually represent an amalgam of reworked archaeological materials. Sources for cultural materials of mixed ages comprise breccias from the rear wall of the rock-shelter–remnants of older, eroded deposits dated to 35–23 ka cal BP–and cultural remains of early Holocene antiquity. Below the upper levels affected by the mass loss of Late Pleistocene deposits, our deep-trench excavations uncovered evidence for an earlier hominin presence at the site. These findings include fossils of now-extinct proboscideans and other ‘megafauna’ in stratified context, as well as a cobble-based stone artifact technology comparable to that produced by late Middle Pleistocene hominins elsewhere on Sulawesi. PMID:29641524

MODELING THE ATOMIC-TO-MOLECULAR TRANSITION AND CHEMICAL DISTRIBUTIONS OF TURBULENT STAR-FORMING CLOUDS

Energy Technology Data Exchange (ETDEWEB)

Offner, Stella S. R. [Department of Astronomy, Yale University, New Haven, CT 06511 (United States); Bisbas, Thomas G.; Viti, Serena [Department of Physics and Astronomy, University College London, Gower Street, London WC1E 6B (United Kingdom); Bell, Tom A., E-mail: stella.offner@yale.edu [Centro de Astrobiologia (CSIC-INTA), Carretera de Ajalvir, km 4, E-28850 Madrid (Spain)

2013-06-10

We use 3D-PDR, a three-dimensional astrochemistry code for modeling photodissociation regions (PDRs), to post-process hydrodynamic simulations of turbulent, star-forming clouds. We focus on the transition from atomic to molecular gas, with specific attention to the formation and distribution of H, C{sup +}, C, H{sub 2}, and CO. First, we demonstrate that the details of the cloud chemistry and our conclusions are insensitive to the simulation spatial resolution, to the resolution at the cloud edge, and to the ray angular resolution. We then investigate the effect of geometry and simulation parameters on chemical abundances and find weak dependence on cloud morphology as dictated by gravity and turbulent Mach number. For a uniform external radiation field, we find similar distributions to those derived using a one-dimensional PDR code. However, we demonstrate that a three-dimensional treatment is necessary for a spatially varying external field, and we caution against using one-dimensional treatments for non-symmetric problems. We compare our results with the work of Glover et al., who self-consistently followed the time evolution of molecule formation in hydrodynamic simulations using a reduced chemical network. In general, we find good agreement with this in situ approach for C and CO abundances. However, the temperature and H{sub 2} abundances are discrepant in the boundary regions (A{sub v} {<=} 5), which is due to the different number of rays used by the two approaches.

Evaluación de extractos cetónicos de paraíso, eucalipto y ricino sobre Myzus persicae (Homoptera: Aphididae)

OpenAIRE

Carrizo, Paola; Pelicano, Alicia; Caffarini, Patricia

2004-01-01

En el cultivo de pimiento, Myzus persicae es una plaga cuyo manejo se basa en el uso de agroquímicos de síntesis. Una alternativa de menor impacto ambiental para su control es la aplicación de extractos naturales. El objetivo del trabajo fue evaluar el efecto de extractos provenientes de Melia azedarach, Eucalyptus globulus y Ricinus communis sobre este pulgón. Se escogió la técnica del film residual en papel de filtro, manteniendo los individuos sobre hojas de pimiento ornamental. Se uti...

The impact of some physiomorphic characters of sugarcane genotypes on their resistance against sugarcane pyrilla, pyrilla perpusilla wlk. (lophopidae: homoptera)

International Nuclear Information System (INIS)

Rasul, A.; Hassan, M.; Suhail, A.; Sahi, S.T.

2010-01-01

Field trials were conducted in the Research Area, Directorate of Sugarcane, Ayub Agricultural Research Institute, Faisalabad to study he physio-morphic characters of sugarcane resistance to the sucking pest Pyrilla perpusilla. Twenty genotypes of sugarcane were tested for their resistance susceptibility against P. perpusilla, as a preliminary screening experiment, during 2006. Based on the population-density count, 3 genotypes, viz., HSF- 240, CPF-243 and S-2002-US-114 showing resistance responses, 3 genotypes viz. CPHS-35, S-2003-US-394 and S-2003-US-623 showing susceptible trends and 3 genotypes viz. S-2003-US-809, S-2002-US-140 and S- 2002-US-104 exerting intermediate trends against the pest under test were selected for the final screening trials during 2007.The genotype S-2003-US-623, was found to be comparatively susceptible; whereas, HSF-240, showed resistance responses. The leaf-width and cane length showed a positive and significant correlation whereas the leaf-spine density had a significant negative effect with pest-population. The Leaf-length and Cane-Diameter did not show a significant correlation with the pest population. (author)

Reproducción de cochinilla silvestre Dactylopius opuntiae (Homóptera: Dactylopiidae Reproduction of wild cochineal Dactylopius opuntiae (Homoptera: Dactylopiidae

Directory of Open Access Journals (Sweden)

Arnoldo Flores-Hernández

2006-06-01

Full Text Available Por sus características, la cochinilla silvestre ofrece perspectivas de aprovechamiento como fuente de carmín y para el mejoramiento genético de la grana fina. Por lo anterior, se estableció una multiplicación y crianza de cochinilla silvestre, proveniente de la zona árida del norte de México para caracterizarla, utilizando como hospedero a Opuntia megacantha Salm Dyck. Los resultados indican que la especie silvestre pertenece al género-especie Dactylopius opuntia. Se determinó la presencia de partenogénesis en hembras. La duración de los estadios biológicos depende del sexo del insecto; el adulto hembra permaneció durante 38.4 días y 4.2 días para machos, los primeros estadios ninfales fueron similares en duración (18.1-19.8 días. El ciclo biológico de las hembras fue de 77 días mientras que el de los machos fue de 43 días. Para las hembras se estimó un periodo de preoviposición de 18.8 días, manteniéndose en oviposición durante 21 días con un promedio de 131 insectos por hembra. La proporción sexual hembras: machos fue 1:1. El tipo de reproducción fue predominantemente sexual, aunque hubo hembras partenogénicas. Este es el primer reporte de Dactylopius opuntiae como cochinilla silvestre asociada a la zona árida del noreste de México, específicamente en el Bolsón de Mapimí, Durango, México.Wild cochineal has characteristics that offer advantage as a source of carmine and for fine cochineal improvement. To characterize wild cochineal, we initiated a breeding effort raising wild cochineal from the arid zone of the north oh Mexico, using as a host organism Opuntia megacantha Salm dick. The results indicate that the wild specie is Dactylopius opuntiae. The presence of parthenogenesis in females was determined. The duration of ontogenetic stages depends on the sex of the insect. The adult female lasted 38.4 days and 4.2 days for males, the first stage nymphs were similar in duration (18-19.8 days. The complete biological cycle of the females was 77 days, and in the males 43 days. A period of preoviposition of 18.8 days for the females was found, laying eggs during 21 days with an average of 131 insects per female. The sex ratio female: male was 1:1. The reproduction generally was sexual although there were parthenogenetic females. This is the first report of Dactylopius opuntiae as a source of wild cochineal in the arid zone of North, Central and Norwest of Mexico specifically in the Bolson of Mapimí, Durango, Mexico.

The environmental plasticity of diverse body color caused by extremely long photoperiods and high temperature in Saccharosydne procerus (Homoptera: Delphacidae

Directory of Open Access Journals (Sweden)

Haichen Yin

2016-09-01

Full Text Available Melanization reflects not only body color variation but also environmental plasticity. It is a strategy that helps insects adapt to environmental change. Different color morphs may have distinct life history traits, e.g., development time, growth rate, and body weight. The green slender planthopper Saccharosydne procerus (Matsumura is the main pest of water bamboo (Zizania latifolia. This insect has two color morphs. The present study explored the influence of photoperiod and its interaction with temperature in nymph stage on adult melanism. Additionally, the longevity, fecundity, mating rate, and hatching rate of S. procerus were examined to determine whether the fitness of the insect was influenced by melanism under different temperature and photoperiod. The results showed that a greater number of melanic morphs occurred if the photoperiod was extremely long. A two-factor ANOVA showed that temperature and photoperiod both have a significant influence on melanism. The percentages of variation explained by these factors were 45.53% and 48.71%, respectively. Moreover, melanic morphs had greater advantages than non-melanic morphs under an environmental regime of high temperatures and a long photoperiod, whereas non-melanic morphs were better adapted to cold temperatures and a short photoperiod. These results cannot be explained by the thermal melanism hypothesis. Thus, it may be unavailable to seek to explain melanism in terms of only one hypothesis.

Comparison of AC electronic monitoring and field data for estimating tolerance to Empoasca kraemeri (Homoptera: Cicadellidae) in common bean genotypes.

Science.gov (United States)

Serrano, M S; Backus, E A; Cardona, C

2000-12-01

Two methods for estimating the tolerance of common bean genotypes to Empoasca kraemeri Ross & Moore were compared, using a yield trial carried out at Centro Internacional de Agricultura Tropical (CIAT), Cali, Colombia, versus stylet penetration tactics measured by AC electronic feeding monitors. A stylet penetration index was devised based on principal component scores of three penetration tactics identified (pulsing laceration, cell rupturing, and lancing sap ingestion), combined with knowledge of the hopperburn symptoms caused by each tactic. Tolerant genotypes, as classified by the CIAT yield index, showed significantly more unprotected yield and lower hopperburn scores than the susceptible control. They also induced performance of less pulsing laceration (the tactic considered most damaging to the plant), and more of the other two, mitigating tactics, especially cell rupturing. When index values were calculated for each genotype, stylet penetration index values matched those of the yield index for three out of five genotypes: two EMP-coded tolerant lines ('EMP 385' and 'EMP 392') and the susceptible control 'BAT 41'. Thus, for these three genotypes, all subsequent hoppereburn symptoms are predictable by the type of feeding behavior performed on them. 'Porrillo Sintético' and 'EMP 84', considered borderline genotypes by the yield index, were overestimated and underestimated respectively, by the stylet penetration index. We postulate that, for these two genotypes, plant physiological responses to feeding (either compensatory or heightened sensitivity, respectively) synergize with type of feeding performed to generate the overall hopperburn condition. This multivariate analysis of electronic monitoring data was successfully used to devise an index of resistance. The implications of using the stylet penetration index and the advantages of using electronic monitoring in a bean-breeding program are discussed.

Inter-regional differences in baseline toxicity of Bemisia argentifolii (Homoptera: Aleyrodidae) to the two insect growth regulators, buprofezin and pyriproxyfen.

Science.gov (United States)

Toscano, N C; Prabhaker, N; Castle, S J; Henneberry, T J

2001-12-01

A survey of 53 Bemisia argentifolii Bellows & Perring populations from different agricultural regions in California and Arizona was conducted from 1997 to 1999 to establish baseline toxicological responses to buprofezin and pyriproxyfen. Although both compounds proved to be highly toxic even in minute quantities to specific stages, geographical and temporal differences in responses were detected using a leaf spray bioassay technique. Monitoring for three years revealed that six to seven populations had higher LC50 values but not greater survival when exposed to these two insecticides. A significant difference in relative susceptibility to buprofezin was first observed in late season 1997 in San Joaquin Valley populations with LC50s ranging from 16 to 22 microg (AI)/liter(-1) compared with IC50s of 1 to 3 mg (AI)/liter(-1) in Imperial, Palo Verde Valley and Yuma populations. Whiteflies collected in subsequent years from these and other locations showed an increase in susceptibility to buprofezin. Regional differences in susceptibilities to pyriproxyfen were minimal within the same years. Three years of sampling revealed consistently higher LC50s to pyriproxyfen in populations from Palo Verde Valley, CA, compared with whiteflies from Imperial, San Joaquin Valley or Yuma. As was the case with buprofezin, a decline in LC50s to pyriproxyfen was observed in whiteflies from all locations sampled in 1999. However, no correlation was observed between buprofezin and pyriproxyfen toxicity in any of the strains. The variable toxicities observed to both compounds over a period of 3 yr may be due principally to inherent differences among geographical populations or due to past chemical use which may confer positive or negative cross-resistance to buprofezin or pyriproxyfen.

Action threshold for applying insect growth regulators to tomato for management of irregular ripening caused by Bemisia argentifolii (Homoptera: Aleyrodidae).

Science.gov (United States)

Schuster, D J

2002-04-01

The whitefly Bemisia argentifolii Bellows & Perring is a major pest of tomatoes, causing an irregular ripening disorder characterized externally by incomplete or inhibited reddening of fruit, especially in longitudinal sections, and internally by an increase in the amount of white tissue. Experiments were undertaken during the spring and fall of 1997 and 1998 and the spring of 1999 to develop an action threshold for applying the insect growth regulators (IGRs) buprofezin and pyriproxyfen to manage B. argentifolii and irregular ripening. The IGRs were applied when predetermined thresholds were reached and were compared with a high rate of the systemic insecticide imidacloprid, which was applied at transplanting and provided season-long whitefly control. Only plots treated when the numbers of sessile nymphs (second through fourth instars) reached five per 10 leaflets consistently had both external and internal irregular ripening severity ratings similar to the imidacloprid standard. Results were similar for buprofezin and pyriproxyfen even though the modes of action differ. The five nymphs per 10 leaflets threshold lends itself to field scouting because nymphal counts completed in the field using the unaided eye supplemented with a 10x hand lens were linearly and significantly related to counts completed in the laboratory with a dissecting microscope.

Inheritance mode and realized heritability of resistance to imidacloprid in the brown planthopper, Nilaparvata lugens (Stål) (Homoptera: Delphacidae).

Science.gov (United States)

Wang, Yan Hua; Liu, Xu Gan; Zhu, Yu Cheng; Wu, Sheng Gan; Li, Shu Yong; Chen, Wen Ming; Shen, Jin Liang

2009-06-01

The brown planthopper, Nilaparvata lugens (Stål), is a serious pest that causes enormous losses to the rice crop in Asia. The genetic basis of imidacloprid resistance was investigated in N. lugens. The resistant strain, selected for imidacloprid resistance from a field population of N. lugens collected from Nanjing, Jiangsu Province, China, showed a 964-fold resistance compared with the laboratory strain. Progenies of reciprocal crosses (F(1) and F(1)') showed similar dose-mortality responses (LC(50)) to imidacloprid, and also exhibited a similar degree of dominance (D), 0.58 for F(1) and 0.63 for F(1)'. Chi-square analyses of self-bred and backcross progenies (F(2), F(2)' and BC respectively) rejected the hypothesis for a single gene control of the resistance. The estimated realized heritability (h(2)) of imidacloprid resistance was 0.1141 in the resistant strain of N. lugens. The results showed that imidacloprid resistance in N. lugens was autosomal and was expressed as an incompletely dominant trait, probably controlled by multiple genes.

Aphis (Hemiptera: Aphididae) species groups found in the Midwestern United States and their contribution to the phylogenetic knowledge of the genus.

Science.gov (United States)

Lagos, Doris M; Voegtlin, David J; Coeur d'acier, Armelle; Giordano, Rosanna

2014-06-01

A phylogeny of the genus Aphis Linnaeus, 1 758 was built primarily from specimens collected in the Midwest of the United States. A data matrix was constructed with 68 species and 41 morphological characters with respective character states of alate and apterous viviparous females. Dendrogram topologies of analyses performed using UPGMA (Unweighted Pair Group Method with Arithmetic Mean), Maximum Parsimony and Bayesian analysis of Cytochrome Oxidase I, Elongation Factor 1-α and primary endosymbiont Buchnera aphidicola 16S sequences were not congruent. Bayesian analysis strongly supported most terminal nodes of the phylogenetic trees. The phylogeny was strongly supported by EF1-α, and analysis of COI and EF1-α molecular data combined with morphological characters. It was not supported by single analysis of COI or Buchnera aphidicola 16S. Results from the Bayesian phylogeny show 4 main species groups: asclepiadis, fabae, gossypii, and middletonii. Results place Aphis and species of the genera Protaphis Börner, 1952, Toxoptera Koch, and Xerobion Nevsky, 1928 in a monophyletic clade. Morphological characters support this monophyly as well. The phylogeny shows that the monophyletic clade of the North American middletonii species group belong to the genus Protaphis: P. debilicornis (Gillette & Palmer, 1929), comb. nov., P. echinaceae (Lagos and Voegtlin, 2009), comb. nov., and P. middletonii (Thomas, 1879). The genus Toxoptera should be considered a subgenus of Aphis (stat. nov.). The analysis also indicates that the current genus Iowana Frison, 1954 should be considered a subgenus of Aphis (stat. nov.). © 2013 Institute of Zoology, Chinese Academy of Sciences.

Female-induced increase of host-plant volatiles enhance specific attraction of aphid male Dysaphis plantaginea (Homoptera: Aphididae) to the sex pheromone

NARCIS (Netherlands)

Tol, van R.W.H.M.; Helsen, H.H.M.; Griepink, F.C.; Kogel, de W.J.

2009-01-01

All aphid species studied so far share the same sex pheromone components, nepetalactol and nepetalactone. Variation by different enantiomers and blends of the two components released by different aphid species are limited and can only partially explain species-specific attraction of males to

Resistance and susceptibility of alfalfa (Medicago sativa L.) cultivars to the aphid Therioaphis maculata (Homoptera:Aphididae): insect biology and cultivar evaluation

Institute of Scientific and Technical Information of China (English)

ALEXANDRE DE ALMEIDA E SILVA; ELENICE MOURO VARANDA; JOS(E) RICARDO BAROSELA

2006-01-01

Biology of the aphid Therioaphis maculata was studied on alfalfa (Medicago sativa L.), including four resistant (Mesa-Sirsa, CUF101, Baker and Lahontan) and two susceptible (ARC and Caliverde) alfalfa cultivars, and one of the most cropped Brazilian cultivars, Crioula. Under controlled conditions, antibiosis (i.e., reduced longevity, fecundity and increased mortality of the aphid) was observed mainly on the resistant alfalfa cultivars,except on Lahontan. Crioula seemed to be tolerant to aphids. Present data support geographic limitation usage of cultivars, and we suggest Baker and Mesa-Sirsa as sources of antibiosis,and provide biological information of a tropical T. maculata biotype on alfalfa.

Cosmopsaltria halmaherae n. sp. endemic to Halmahera, Maluku, Indonesia (Homoptera, Cicadidae). The relationship of cicadas of Maluku Utara and Maluku Selatan

NARCIS (Netherlands)

Duffels, J.P.

1988-01-01

Cosmopsaltria halmaherae n. sp. is described from Halmahera, Maluku and placed in the C. doryca group. The characters of this group are reconsidered and the relationships of its members are discussed. The C. doryca group and two other monophyletic groups of cicadas demonstrate a vicariant

New species of the family Triozidae (Homoptera: Psylloidea) from China, and the first record of Psylloidea as host of Braconidae (Hymenoptera)

NARCIS (Netherlands)

Li, F.; Achterberg, van C.; He, J.

2000-01-01

Two new species of Triozidae (Psylloidea) from China producing sphere-shaped leaf galls on Ficus hainanensis Merr. & Shun., are illustrated and described. For the first time Psylloidea are reported as host of a species of Braconidae. The parasitoid belonging to the genus Bracon Fabricius, 1804, is

A reliable bioassay procedure to evaluate per os toxicity of Bacillus thuringiensis strains against the rice delphacid, Tagosodes orizicolus (Homoptera: Delphacidae

Directory of Open Access Journals (Sweden)

Rebeca Mora

2007-06-01

Full Text Available A reliable bioassay procedure was developed to test ingested Bacillus thuringiensis (Bt toxins on the rice delphacid Tagosodes orizicolus. Initially, several colonies were established under greenhouse conditions, using rice plants to nurture the insect. For the bioassay, an in vitro feeding system was developed for third to fourth instar nymphs. Insects were fed through Parafilm membranes on sugar (10 % sucrose and honey bee (1:48 vol/vol solutions, observing a natural mortality of 10-15 % and 0-5 %, respectively. Results were reproducible under controlled conditions during the assay (18±0.1 °C at night and 28±0.1 °C during the day, 80 % RH and a 12:12 day:light photoperiod. In addition, natural mortality was quantified on insect colonies, collected from three different geographic areas of Costa Rica, with no significant differences between colonies under controlled conditions. Finally, bioassays were performed to evaluate the toxicity of a Bt collection on T. orizicolus. A preliminary sample of twenty-seven Bt strains was evaluated on coarse bioassays using three loops of sporulated colonies in 9 ml of liquid diet, the strains that exhibited higher percentages of T. orizicolus mortality were further analyzed in bioassays using lyophilized spores and crystals (1 mg/ml. As a result, strains 26-O-to, 40-X-m, 43S-d and 23-O-to isolated from homopteran insects showed mortalities of 74, 96, 44 and 82 % respectively while HD-137, HD-1 and Bti showed 19, 83 and 95 % mortalities. Controls showed mortalities between 0 and 10 % in all bioassays. This is the first report of a reliable bioassay procedure to evaluate per os toxicity for a homopteran species using Bacillus thuringiensis strains. Rev. Biol. Trop. 55 (2: 373-383. Epub 2007 June, 29.Se desarrolló una metodología de bioensayo para evaluar toxinas de Bacillus thuringiensis (Bt ingeridas por Tagosodes orizicolus, plaga del arroz y vector del virus de la hoja blanca. Se establecieron colonias del insecto en condiciones de invernadero usando plantas de arroz como alimento. Para el bioensayo, se desarrolló un sistema de alimentación in vitro para ninfas de tercer y cuarto estadío. Los insectos se alimentaron de soluciones de miel de abeja (1:48 vol/vol y sacarosa (10 % a través de membranas de Parafilm. Se observaron mortalidades del 10-15 % y 0-5 %, respectivamente, en ambas dietas. Los resultados fueron reproducibles en condiciones controladas de humedad y temperatura (18±0.1 °C de noche y 28±0.1 °C de día, 80 % H.R y a 12:12 fotoperíodo día:noche. Asimismo, se analizó la mortalidad natural de los insectos según su procedencia, sin embargo, no se observaron diferencias significativas en condiciones controladas. Finalmente, se elaboraron bioensayos para evaluar la toxicidad de una colección de cepas de Bt contra T. orizicolus. Se evaluó preliminarmente, una submuestra de 27 cepas de Bt en bioensayos burdos usando tres asadas como inóculo para 9 ml de dieta líquida. Posteriormente, las cepas que mostraron los mayores porcentajes de mortalidad se evaluaron en bioensayos usando esporas y cristales liofilizados (1 mg/ml. Como resultado, las cepas aisladas a partir de homópteros 26-O-to, 40-X-m, 43-S-d y 23-O-to mostraron mortalidades de 74, 96, 44 y 82 % respectivamente, mientras que las HD-137, HD-1 y Bti mostraron 19, 83 y 95 % de mortalidad. Los controles presentaron mortalidades de 0 y 10 % en los bioensayos. Este es el primer informe de un bioensayo para evaluar la toxicidad de cepas de Bt utilizando la especie T. orizicolus.

[Phagodeterrent activity of the plants Tithonia diversifolia and Montanoa hibiscifolia (Asteraceae) on adults of the pest insect Bemisia tabaci (Homoptera: Aleyrodidae)].

Science.gov (United States)

Bagnarello, Gina; Hilje, Luko; Bagnarello, Vanessa; Cartín, Victor; Calvo, Marco

2009-12-01

Bemisia tabaci (Gennadius) is a polyphagous, cosmopolitan and worldwide relevant pest, mainly acting as a virus vector on many crops. A sound preventive approach to deal with it would be the application of repellent or deterrent substances hopefully present in tropical plants, which in turn may contribute to take advantage of the remarkable rich Mesoamerican biodiversity. Therefore, extracts of two wild plants belonging to family Asteraceae, titonia (Tithonia diversifolia) and "tora" (Montanoa hibiscifolia), were tested for phagodeterrence to B. tabaci adults. The crude leaf extract of each one, as well as four fractions thereof (hexane, dichlorometane, ethyl acetate, and methanol) were tested under greenhouse conditions; in addition, the extracts were submitted to a phytochemical screening to determine possible metabolites causing phagodeterrence. Both restricted-choice and unrestricted-choice experiments were conducted. In the former ones, each fraction was tested at four doses (0.1, 0.5, 1.0 and 1.5% v/v), which were compared with four control treatments: distilled water, endosulfan, an agricultural oil (Aceite Agricola 81 SC), and the emulsifier Citowett. Tomato plants were sprayed and placed inside sleeve cages, where 50 B. tabaci adults were released. The criterion to appraise phagodeterrence was the number of landed adults on plants at 48h. For the unrestricted-choice experiments, only the two highest doses (1.0 and 1.5%) of the crude extracts of each species were tested, and compared to distilled water and the agricultural oil. The titonia and "tora" crude extracts caused phagodeterrence, and for both plant species the methanol fraction stood out. Results suggest that metabolites causing phagodeterrence are several sesquiterpenic lactones, polyphenolic compounds (flavonoids and tannins) and saponins.

Temporal Dynamics of Arthropods on Six Tree Species in Dry Woodlands on the Caribbean Island of Puerto Rico

Science.gov (United States)

Beltrán, William; Wunderle, Joseph M.

2014-01-01

Abstract The seasonal dynamics of foliage arthropod populations are poorly studied in tropical dry forests despite the importance of these studies for understanding arthropod population responses to environmental change. We monitored the abundance, temporal distributions, and body size of arthropods in five naturalized alien and one native tree species to characterize arthropod seasonality in dry novel Prosopis–Leucaena woodlands in Puerto Rico. A branch clipping method was used monthly to sample foliage arthropod abundance over 39 mo. Seasonal patterns of rainfall and abundance within various arthropod taxa were highly variable from year to year. Abundance for most taxa did not show significant seasonality over the 3 yr, although most taxa had abundance peaks each year. However, Homoptera displayed high seasonality with significant temporal aggregations in each year. Formicidae, Orthoptera, and Coleoptera showed high variation in abundance between wet and dry periods, whereas Hemiptera were consistently more abundant in the wet period. Seasonal differences in mean abundance were found only in a few taxa on Tamarindus indica L. , Bucida buceras L. , Pithecellobium dulce , and (Roxburgh) Benth. Mean arthropod abundance varied among tree species, with highest numbers on Prosopis juliflora , (Swartz) De Candolle, Pi. dulce , Leucaena leucocephala , and (Lamarck) de Wit. Abundance of Araneae, Orthoptera, Coleoptera, Lepidoptera larvae, and all arthropods showed weak relationships with one or more climatic variables (rainfall, maximum temperature, or relative humidity). Body size of arthropods was usually largest during the dry periods. Overall, total foliage arthropod abundance showed no consistent seasonality among years, which may become a more common trend in dry forests and woodlands in the Caribbean if seasonality of rainfall becomes less predictable. PMID:25502036

Insect emergence in relation to floods in wet meadows and swamps in the River Dalälven floodplain.

Science.gov (United States)

Vinnersten, T Z Persson; Östman, Ö; Schäfer, M L; Lundström, J O

2014-08-01

Annual variation in flood frequency and hydroperiod during the vegetation season has ecological impacts on the floodplain biota. Although many insect groups may have a lower emergence during a flood event, it is poorly known how annual emergence of insects in temporary wetlands is related to the variation in hydrology. Between May and September, we studied the weekly emergence of 18 insect taxa over six consecutive years, 2002-2007, in six temporary flooded wetlands (four wet meadows and two forest swamps) in the River Dalälven floodplains, Central Sweden. We used emergence traps to collect emerging insects from terrestrial and aquatic parts of wet meadows and swamp forests. In all wetlands, the insect fauna was numerically dominated by the orders Diptera, Hymenoptera, Coleoptera and Homoptera. On a weekly basis, 9 out of the 18 insect taxa had lower emergence in weeks with flood than in weeks with no flood, whereas no taxon had a higher emergence in weeks with flood. Over the seasons, we related insect emergence to seasonal flood frequency and length of hydroperiod. The emergence of most studied taxa decreased with increasing hydroperiod, which suggests that emergence after floods do not compensate for the reduced emergence during floods. Only Culicidae and the aquatic Chironomidae sub-families Tanypodinae and Chironominae showed an increase in emergence with increasing hydroperiod, whereas Staphylinidae peaked at intermediate hydroperiod. We conclude that a hydroperiod covering up to 40% of the vegetation season has a significant negative effect on the emergence of most taxa and that only a few taxa occurring in the temporary wetlands are actually favoured by a flood regime with recurrent and unpredictable floods.

Retrospective Correction of Physiological Noise: Impact on Sensitivity, Specificity, and Reproducibility of Resting-State Functional Connectivity in a Reading Network Model.

Science.gov (United States)

Krishnamurthy, Venkatagiri; Krishnamurthy, Lisa C; Schwam, Dina M; Ealey, Ashley; Shin, Jaemin; Greenberg, Daphne; Morris, Robin D

2018-03-01

It is well accepted that physiological noise (PN) obscures the detection of neural fluctuations in resting-state functional connectivity (rsFC) magnetic resonance imaging. However, a clear consensus for an optimal PN correction (PNC) methodology and how it can impact the rsFC signal characteristics is still lacking. In this study, we probe the impact of three PNC methods: RETROICOR: (Glover et al., 2000 ), ANATICOR: (Jo et al., 2010 ), and RVTMBPM: (Bianciardi et al., 2009 ). Using a reading network model, we systematically explore the effects of PNC optimization on sensitivity, specificity, and reproducibility of rsFC signals. In terms of specificity, ANATICOR was found to be effective in removing local white matter (WM) fluctuations and also resulted in aggressive removal of expected cortical-to-subcortical functional connections. The ability of RETROICOR to remove PN was equivalent to removal of simulated random PN such that it artificially inflated the connection strength, thereby decreasing sensitivity. RVTMBPM maintained specificity and sensitivity by balanced removal of vasodilatory PN and local WM nuisance edges. Another aspect of this work was exploring the effects of PNC on identifying reading group differences. Most PNC methods accounted for between-subject PN variability resulting in reduced intersession reproducibility. This effect facilitated the detection of the most consistent group differences. RVTMBPM was most effective in detecting significant group differences due to its inherent sensitivity to removing spatially structured and temporally repeating PN arising from dense vasculature. Finally, results suggest that combining all three PNC resulted in "overcorrection" by removing signal along with noise.

Development of a Short Form of the Five-Factor Narcissism Inventory: the FFNI-SF.

Science.gov (United States)

Sherman, Emily D; Miller, Joshua D; Few, Lauren R; Campbell, W Keith; Widiger, Thomas A; Crego, Cristina; Lynam, Donald R

2015-09-01

The Five-Factor Narcissism Inventory (FFNI; Glover, Miller, Lynam, Crego, & Widiger, 2012) is a 148-item self-report inventory of 15 traits designed to assess the basic elements of narcissism from the perspective of a 5-factor model. The FFNI assesses both vulnerable (i.e., cynicism/distrust, need for admiration, reactive anger, and shame) and grandiose (i.e., acclaim seeking, arrogance, authoritativeness, entitlement, exhibitionism, exploitativeness, grandiose fantasies, indifference, lack of empathy, manipulativeness, and thrill seeking) variants of narcissism. The present study reports the development of a short-form version of the FFNI in 4 diverse samples (i.e., 2 undergraduate samples, a sample recruited from MTurk, and a clinical community sample) using item response theory. The validity of the resultant 60-item short form was compared against the validity of the full scale in the 4 samples at both the subscale level and the level of the grandiose and vulnerable composites. Results indicated that the 15 subscales remain relatively reliable, possess a factor structure identical to the structure of the long-form scales, and manifest correlational profiles highly similar to those of the long-form scales in relation to a variety of criterion measures, including basic personality dimensions, other measures of grandiose and vulnerable narcissism, and indicators of externalizing and internalizing psychopathology. Grandiose and vulnerable composites also behave almost identically across the short- and long-form versions. It is concluded that the FFNI-Short Form (FFNI-SF) offers a well-articulated assessment of the basic traits comprising grandiose and vulnerable narcissism, particularly when assessment time is limited. (c) 2015 APA, all rights reserved.

Ginzburg-Landau theory and the superconducting transition in thin, amorphous bismuth films

International Nuclear Information System (INIS)

Van Vechten, D.

1979-01-01

The Aslamasov-Larkin (AL) theory can be derived from a classical treatment of the conductivity due to short-lived statistical fluctuations into the superconducting state if one truncates the Ginzburg-Landau free energy density expression to read F[psi] = α 0 vertical barpsi vertical bar 2 + c 0 vertical bar del psi vertical bar 2 , where psi is the superconducting order parameter. The next largest term in the GL free energy is (b/2) (vertical bar psi vertical bar 2 ) 2 and is conventionally interpreted as representing the energy associated with interactions between the fluctuations. My dissertation consists of the calculation of the effect of this term on the fluctuation conductivity in three different approximations and the comparison of my predictions to the data of R.E. Glover III and M.K. Chien on thin amorphous bismuth films. The first approximation calculates the contribution to the fluctuations' self energy of the ''tadpole'' diagrams. This approximation yields a 4 parameter equation. Its fits were particularly outstanding for the films deposited on quartz or roughened glass substrates and only for two smooth glass substrates were there non-isolated data points that were not fit at the lowest temperatures measured. (The equation runs into trouble for these films at approximately R(T)/R/sub o/ =.08.) The values of the theoretical equation's fitting parameters were determined by a least squares method and turns out to depend on film thickness in the manner predicted by the theory. The next calculation improves the self energy approximation by including all the ''ring'' diagrams

The parsec-scale relationship between ICO and AV in local molecular clouds

Science.gov (United States)

Lee, Cheoljong; Leroy, Adam K.; Bolatto, Alberto D.; Glover, Simon C. O.; Indebetouw, Remy; Sandstrom, Karin; Schruba, Andreas

2018-03-01

We measure the parsec-scale relationship between integrated CO intensity (ICO) and visual extinction (AV) in 24 local molecular clouds using maps of CO emission and dust optical depth from Planck. This relationship informs our understanding of CO emission across environments, but clean Milky Way measurements remain scarce. We find uniform ICO for a given AV, with the results bracketed by previous studies of the Pipe and Perseus clouds. Our measured ICO-AV relation broadly agrees with the standard Galactic CO-to-H2 conversion factor, the relation found for the Magellanic clouds at coarser resolution, and numerical simulations by Glover & Clark (2016). This supports the idea that CO emission primarily depends on shielding, which protects molecules from dissociating radiation. Evidence for CO saturation at high AV and a threshold for CO emission at low AV varies remains uncertain due to insufficient resolution and ambiguities in background subtraction. Resolution of order 0.1 pc may be required to measure these features. We use this ICO-AV relation to predict how the CO-to-H2 conversion factor (XCO) would change if the Solar Neighbourhood clouds had different dust-to-gas ratio (metallicity). The calculations highlight the need for improved observations of the CO emission threshold and H I shielding layer depth. They are also sensitive to the shape of the column density distribution. Because local clouds collectively show a self-similar distribution, we predict a shallow metallicity dependence for XCO down to a few tenths of solar metallicity. However, our calculations also imply dramatic variations in cloud-to-cloud XCO at subsolar metallicity.

Herencia de la resistencia al daño mecánico causado por Tagosodes orizicolus (Muir (Homoptera-Delphacidae en arroz Oryza sativa

Directory of Open Access Journals (Sweden)

Cuevas P. Federico

1996-12-01

Full Text Available

In Colombia all rice varieties developed are reported as resistant to Tagosodes orizicolus. Given the narrow genetic base of the resistant sources, this study was undertaken to identify the resistant parents or donors more oftenly used in Latin America. The materials were characterized as resistant (Mudgo, Amistad 82, IRAT 120, IRAT 124, Makalioka or susceptible based on the free chosen test and non chosen test and on the survival and oviposition of the insect (Chianan 8, Colombia 1, Bluebonnet 50, IR 8 (lCA, IR 8 (IRRI, Tetep and Cica 8. The damage was associated with insect survival, oviposition and eggs eclotion. To determine heritability two parents (Makalioka and Mudgo, were crossed with IR 8 F₁ and F₃ populations were also evaluated based on the free chosen test.

En Colombia las variedades de arroz desarrolladas se consideran como resistentes a Tagosodes orizicolus. Dada la estrechez genética de las fuentes de resistencia, se inició este estudio para identificar los progenitores donantes de resistencia usados con mayor frecuencia en América Latina. Los materiales se caracterizaron como resistentes (Mudgo, Amistad 82, IRAT, 120, IRAT 124 Y Makalioka o susceptibles (Chianan 8, Colombia 1, Bluebonnet 50, IR 8 (lCA, IR (IRRI, Tetep y Cica 8, con base en las pruebas de libre escogencia, no escogencia, sobre vivencia y oviposición. El daño estuvo asociado con la supervivencia, oviposición y eclosión de huevos del insecto. Para la determinación de la herencia se cruzaron los progenitores Makalioka y Mudgo con IR8. En la Progenie F₁ del cruzamiento resistente x resistente el 111% de las plantas fueron susceptibles; Mudgo y Makalioka segregaron 23 y 41% de plantas susceptibles.

Comparative field evaluation of some newer versus conventional insecticides for the control of aphids (homoptera: aphididae) on oilseed rape (brassica napus l.)

International Nuclear Information System (INIS)

Sarwar, M.; Ahmad, N.; Bux, M.; Nasrullah, A.; Tofique, M.

2011-01-01

This study was designed to evaluate the effects of new insecticides like, Imidacloprid (Confidor 200 EC), Thiomethoxam (Actara 25 WG) and Acetamiprid (Megamos 20 SL) belonging to Nitroguanidine group along with conventional insecticides such as, Chlorpyrifos (Lorsban 40 EC) and Dimethoate (Systoate 40 EC) belonging to Organophosphate group against aphids' population on oilseed rape (Brassica napus L.). A perusal of data, based on the overall performance of the test compounds, reflected that newer insecticides were superior in reducing the population of aphids and yield enhancement as compared to conventional insecticides. The best results were achieved with the application of Imidacloprid by recording the lowest number of aphids (2.2 per plant) than obtained with Thiomethoxam and Acetamiprid (3.22 and 4.66, respectively). Other insecticides, viz., Chlorpyrifos and Dimethoate were also found to be effective in maintaining the aphids' population at lower levels per plant (16.2 and 17.5, respectively) over untreated control (227.7). Imidacloprid was responsible for increasing the grain yield to 3722.85 Kg per Hectare, approached by Thiomethoxam, Acetamiprid, Chlorpyrifos and Dimethoate as against unsprayed control (2980.0, 2542.85, 1542.85, 540.0 and 604.85 Kg per Hectare, respectively). Study indicated that selective use of newer insecticides would seem a reasonable strategy in aphids controlling and integration of such chemicals in insects' management package could help to reduce pest densities. (author)

Source Areas for the Early Immigration of Sogatella furcifera (Homoptera: Delphacidae) at Xiushan in the Middle Reach of Yangtze River of China.

Science.gov (United States)

Jiang, C X; Chen, X L; Bi, J C; Li, J J; Xiao, X H; Li, Q; Wang, H J; Yang, Q F

2015-12-01

The spatiotemporal distribution of source areas for the early immigration of the white-backed planthopper, Sogatella furcifera (Horvάth), at Xiushan in the middle reach of Yangtze River of China, was analyzed with HYSPLIT (Hybrid Single-Particle Lagrangian Integrated Trajectory) and ArcGIS 10.0. The analysis was based on light trap data collected during April-July in 2000-2012. The synoptic meteorology backgrounds during the immigration periods were analyzed by GrADS (Grid Analysis and Display System). The light trap catches of S. furcifera varied monthly and annually. S. furcifera started immigration in Xiushan in early April to early May, whereas the main immigration period was in July. The distribution of the source areas varied monthly, and the core was moved from the south to the north gradually. The main source areas of S. furcifera in May were in southwestern Guangxi and northern Vietnam. The source areas of S. furcifera in June were located in southwestern Guangxi and western Hunan. Additionally, some of the pests were from southeastern Yunnan. The source areas in July were in northwestern Guangxi, southwestern Guizhou, eastern Yunnan, and the transitional parts of Guangxi, Guizhou, and Yunnan. The sum frequencies of southwest and south winds on the 850 hPa isobaric surface of Xiushan of May-July in heavy occurrence years were more than the light occurrence years. The key meteorological factors were suggested to be vertical perturbation, precipitation, and wind shear during S. furcifera immigration periods. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

The eye-catching cicada Hamza ciliaris (Linnaeus, 1758) comb. n. in Indonesia and the Pacific: taxonomie status, synonymy, and distribution (Homoptera, Cicadoidea)

NARCIS (Netherlands)

Duffels, J.P.

1991-01-01

The new combination Hamza ciliaris (Linnaeus) is proposed for a cicada species widely distributed in Maluku ( = Moluccas), Timor, Banda, Kei and Banggai Islands, the Philippines, and the Palau group of the Caroline Islands. The synonymy of five species, treated in the literature as junior synonyms

Host Plant-Herbivore-Predator Interactions in Chrysoperla carnea (Neuroptera: Chrysopidae) and Myzus persicae (Homoptera: Aphididae) on Four Plant Species Under Laboratory Conditions.

Science.gov (United States)

Farrokhi, Milad; Gharekhani, Gholamhossein; Iranipour, Shahzad; Hassanpour, Mahdi

2017-12-05

The common green lacewing, Chrysoperla carnea (Stephens) (Neuroptera: Chrysopidae), is a well-known biocontrol agent. The current study examined host plant-herbivore-predator interactions with C. carnea and Myzus persicae on four host plants (peach, almond, pepper, and potato). The experiments were carried out at 25 ± 1°C and 65 ± 5% RH at a photoperiod of 16:8 (L:D) h). Duration of the preadult growth period, adult longevity, fecundity, and population growth parameters were analyzed based on the age-stage, two-sex life table theory. The shortest and longest preadult developmental times of the predator were observed on the peach and potato, respectively. The highest and lowest predation rate, oviposition period, and male and female longevity of predator were also observed on the peach and potato, respectively. The lowest intrinsic rate of increase (r) and finite rate of increase (λ) were observed on the potato (0.1087 and 1.11 d-1, respectively) and the highest on the peach (0.1460 and 1.15 d-1, respectively). The maximum and minimum mean generation times (T) were 41.84 and 35.59 d in the potato and peach, respectively. Overall, peach was found to be a more appropriate host than the other host plants for development and predation fitness of C. carnea. These findings reveal that information on tritrophic interactions and subsequent life table evaluation of natural enemies improves integrated pest management programs. Published by Oxford University Press on behalf of Entomological Society of America 2017. This work is written by (a) US Government employee(s) and is in the public domain in the US.

Establishment of Lipolexis oregmae (Hymenoptera: Aphidiidae) in a classical biological control program directed against the brown citrus aphid (Homoptera: Aphididae) in Florida

International Nuclear Information System (INIS)

Persad, A.B.; Hoy, M.A.; Ru Nguyen

2007-01-01

The parasitoid Lipolexis oregmae Gahan (introduced as L. scutellaris Mackauer) was imported from Guam, evaluated in quarantine, mass reared, and released into citrus groves in Florida in a classical biological control program directed against the brown citrus aphid, Toxoptera citricida Kirkaldy. Releases of 20,200, 12,100, and 1,260 adults of L. oregmae were made throughout Florida during 2000, 2001, and 2002, respectively. To determine if L. oregmae had successfully established, surveys were conducted throughout the state beginning in the summer of 2001 and continuing through the summer of 2003. Parasitism during 2001 and 2002 was evaluated by holding brown citrus aphids in the laboratory until parasitoid adults emerged. Lipolexis oregmae was found in 10 sites in 7 counties and 4 sites in 3 counties with parasitism rates ranging from 0.7 to 3.3% in 2001 and 2002, respectively. Laboratory tests indicated that high rates of mortality occurred if field-collected parasitized aphids were held in plastic bags, so a molecular assay was used that allowed immature L. oregmae to be detected within aphid hosts immediately after collection. The molecular assay was used in 2003 with the brown citrus aphids and with other aphid species collected from citrus, weeds, and vegetables near former release sites; immatures of L. oregmae were detected in black citrus aphids, cowpea aphids, spirea aphids, and melon aphids, as well as in the brown citrus aphid, in 4 of 8 counties sampled, with parasitism ranging from 2.0 to 12.9%, indicating that L. oregmae is established and widely distributed. Samples taken in Polk County during Oct 2005 indicated that L. oregmae has persisted. The ability of L. oregmae to parasitize other aphid species on citrus, and aphids on other host plants, enhances the ability of L. oregmae to persist when brown citrus aphid populations are low. (author) [es

Dispersal of Dactylopius opuntiae Cockerell (Homoptera: Dactylopiidae, a biological control agent of Opuntia stricta (Haworth. Haworth. (Cactaceae in the Kruger National Park

Directory of Open Access Journals (Sweden)

L.C. Foxcroft

2000-07-01

Full Text Available Chemical control efforts, the introduction of Cactoblastis cactorum and attempted releases of Dactylopius opuntiae Cockerell into the expanding infestation of Opuntia stricta in the Skukuza region of the Kruger National Park (KNP have had limited suc- cess in preventing the spread and densification of 0. stricta. To boost the biological control component, a new strain of D. opuntiae was introduced into KNP during 1997. The new strain established readily and has destroyed large clumps of plants in the vicin- ity of the release site. A large-scale redistribution programme with D. opuntiae is now needed to exploit this biological control agent to the full. In order to match the frequency of manual releases with the natural rates of spread of the insects, surveys were conducted under field conditions to determine the dispersal abilities ofD. opuntiae, with regard to rate and direction of movement. Dispersal of D. opuntiae was found to be slow and restricted and that the insects need to be redistributed by placing them onto plants at approximately 10 m intervals to ensure that they become quickly and evenly distributed on the weed. This information will be crucial in the revision of the integrated management plan for 0. stricta in the KNP, in integrating the cochineal and other control mechanisms.

Les cochenilles des Myrtaceae en Amazonie péruvienne : 1. Description de deux nouveaux ravageurs de Myrciaria dubia (Homoptera, Coccidae et Kerriidae)

OpenAIRE

Matile-Ferrero, D.; Couturier, Guy

1993-01-01

#Ceroplastes flosculoides$ Matile-Ferrero n.sp. (Coccidae) et #Austrotachardiella sexcordata$ Matile-Ferrero n.sp. (Kerriidae), sont décrits et illustrés. Les deux espèces sont des ravageurs d'une Myrtacée cultivée, #Myrciaria dubia$, en Amazonie péruvienne. #Austrotachardiella trilobata$ (Mendes) n.comb. est transférée de #Tachardiella$ Cockerell. (Résumé d'auteur)

Genetic Control of Biosynthesis and Transport of Riboflavin and Flavin Nucleotides and Construction of Robust Biotechnological Producers†

Science.gov (United States)

Abbas, Charles A.; Sibirny, Andriy A.

2011-01-01

Summary: Riboflavin [7,8-dimethyl-10-(1′-d-ribityl)isoalloxazine, vitamin B2] is an obligatory component of human and animal diets, as it serves as the precursor of flavin coenzymes, flavin mononucleotide, and flavin adenine dinucleotide, which are involved in oxidative metabolism and other processes. Commercially produced riboflavin is used in agriculture, medicine, and the food industry. Riboflavin synthesis starts from GTP and ribulose-5-phosphate and proceeds through pyrimidine and pteridine intermediates. Flavin nucleotides are synthesized in two consecutive reactions from riboflavin. Some microorganisms and all animal cells are capable of riboflavin uptake, whereas many microorganisms have distinct systems for riboflavin excretion to the medium. Regulation of riboflavin synthesis in bacteria occurs by repression at the transcriptional level by flavin mononucleotide, which binds to nascent noncoding mRNA and blocks further transcription (named the riboswitch). In flavinogenic molds, riboflavin overproduction starts at the stationary phase and is accompanied by derepression of enzymes involved in riboflavin synthesis, sporulation, and mycelial lysis. In flavinogenic yeasts, transcriptional repression of riboflavin synthesis is exerted by iron ions and not by flavins. The putative transcription factor encoded by SEF1 is somehow involved in this regulation. Most commercial riboflavin is currently produced or was produced earlier by microbial synthesis using special selected strains of Bacillus subtilis, Ashbya gossypii, and Candida famata. Whereas earlier RF overproducers were isolated by classical selection, current producers of riboflavin and flavin nucleotides have been developed using modern approaches of metabolic engineering that involve overexpression of structural and regulatory genes of the RF biosynthetic pathway as well as genes involved in the overproduction of the purine precursor of riboflavin, GTP. PMID:21646432

Genetic control of biosynthesis and transport of riboflavin and flavin nucleotides and construction of robust biotechnological producers.

Science.gov (United States)

Abbas, Charles A; Sibirny, Andriy A

2011-06-01

Riboflavin [7,8-dimethyl-10-(1'-d-ribityl)isoalloxazine, vitamin B₂] is an obligatory component of human and animal diets, as it serves as the precursor of flavin coenzymes, flavin mononucleotide, and flavin adenine dinucleotide, which are involved in oxidative metabolism and other processes. Commercially produced riboflavin is used in agriculture, medicine, and the food industry. Riboflavin synthesis starts from GTP and ribulose-5-phosphate and proceeds through pyrimidine and pteridine intermediates. Flavin nucleotides are synthesized in two consecutive reactions from riboflavin. Some microorganisms and all animal cells are capable of riboflavin uptake, whereas many microorganisms have distinct systems for riboflavin excretion to the medium. Regulation of riboflavin synthesis in bacteria occurs by repression at the transcriptional level by flavin mononucleotide, which binds to nascent noncoding mRNA and blocks further transcription (named the riboswitch). In flavinogenic molds, riboflavin overproduction starts at the stationary phase and is accompanied by derepression of enzymes involved in riboflavin synthesis, sporulation, and mycelial lysis. In flavinogenic yeasts, transcriptional repression of riboflavin synthesis is exerted by iron ions and not by flavins. The putative transcription factor encoded by SEF1 is somehow involved in this regulation. Most commercial riboflavin is currently produced or was produced earlier by microbial synthesis using special selected strains of Bacillus subtilis, Ashbya gossypii, and Candida famata. Whereas earlier RF overproducers were isolated by classical selection, current producers of riboflavin and flavin nucleotides have been developed using modern approaches of metabolic engineering that involve overexpression of structural and regulatory genes of the RF biosynthetic pathway as well as genes involved in the overproduction of the purine precursor of riboflavin, GTP.

Formation of Stylet Sheaths in āere (in air from eight species of phytophagous hemipterans from six families (Suborders: Auchenorrhyncha and Sternorrhyncha.

Directory of Open Access Journals (Sweden)

J Kent Morgan

Full Text Available Stylet sheath formation is a common feature among phytophagous hemipterans. These sheaths are considered essential to promote a successful feeding event. Stylet sheath compositions are largely unknown and their mode of solidification remains to be elucidated. This report demonstrates the formation and solidification of in āere (in air produced stylet sheaths by six hemipteran families: Diaphorina citri (Psyllidae, Asian citrus psyllid, Aphis nerii (Aphididae, oleander/milkweed aphid, Toxoptera citricida (Aphididae, brown citrus aphid, Aphis gossypii (Aphididae, cotton melon aphid, Bemisia tabaci biotype B (Aleyrodidae, whitefly, Homalodisca vitripennis (Cicadellidae, glassy-winged sharpshooter, Ferrisia virgata (Pseudococcidae, striped mealybug, and Protopulvinaria pyriformis (Coccidae, pyriform scale. Examination of in āere produced stylet sheaths by confocal and scanning electron microscopy shows a common morphology of an initial flange laid down on the surface of the membrane followed by continuous hollow core structures with sequentially stacked hardened bulbous droplets. Single and multi-branched sheaths were common, whereas mealybug and scale insects typically produced multi-branched sheaths. Micrographs of the in āere formed flanges indicate flange sealing upon stylet bundle extraction in D. citri and the aphids, while the B. tabaci whitefly and H. vitripennis glassy-winged sharpshooter flanges remain unsealed. Structural similarity of in āere sheaths are apparent in stylet sheaths formed in planta, in artificial diets, or in water. The use of 'Solvy', a dissolvable membrane, for intact stylet sheath isolation is reported. These observations illustrate for the first time this mode of stylet sheath synthesis adding to the understanding of stylet sheath formation in phytophagous hemipterans and providing tools for future use in structural and compositional analysis.

Rapid assessment of insect fauna based on local knowledge: comparing ecological and ethnobiological methods.

Science.gov (United States)

Lima, Daniele Cristina de Oliveira; Ramos, Marcelo Alves; da Silva, Henrique Costa Hermenegildo; Alves, Angelo Giuseppe Chaves

2016-03-01

The rapid assessment of biodiversity making use of surveys of local knowledge has been successful for different biological taxa. However, there are no reports on the testing of such tools for sampling insect fauna. The present study aimed to evaluate the efficiency of different ethnobiological techniques for rapid sampling of insect fauna. Field research for the conventional survey of insect fauna was conducted on a private farm (9 ° 43'38.95 "S, 37 ° 45'11.97" W) , where there was intensive cultivation of okra (Abelmoschus esculentus L. (Moench)). The survey of local entomological knowledge was conducted among all the producers of okra living in the rural villages Pereira, Santa Luzia, and Nassau de Souza, within the Jacaré Curituba irrigated settlement scheme. The combined use of the techniques "free list" and projective interviews was analyzed, using two types of visual stimuli: stock photos and an entomological box. During the conventional survey of insect fauna, the species Bemisia tabaci biotype B, Aphis gossypii, Phenacoccus sp., Icerya purchasi and Lagria villosa were the primary pests found in the okra crop. Regarding the survey of insect pests, the results were convergent  in both techniques (conventional sampling and free list). Comparing the interview with visual stimuli (pictures) and specimen witnesses (entomological box) revealed that the latter was more effective. Techniques based on the recording and analysis of local knowledge about insects are effective for quick sampling of pest insects, but ineffective in sampling predator insects. The utilization of collected insects, infested branches, or photos of the symptoms of damage caused by pests in projective interviews is recommended.

Relationship of coarse woody debris to arthropod Availability for Red-Cockaded Woodpeckers and other bark-foraging birds on loblolly pine boles.

Energy Technology Data Exchange (ETDEWEB)

Horn, Scott; Hanula, James, L.

2008-04-01

Abstract This study determined if short-term removal of coarse woody debris would reduce prey available to red-cockaded woodpeckers (Picoides borealis Vieillot) and other bark-foraging birds at the Savannah River Site in Aiken and Barnwell counties, SC. All coarse woody debris was removed from four 9-ha plots of mature loblolly pine (Pinus taeda L.) in 1997 and again in 1998. We sampled arthropods in coarse woody debris removal and control stands using crawl traps that captured arthropods crawling up tree boles, burlap bands wrapped around trees, and cardboard panels placed on the ground. We captured 27 orders and 172 families of arthropods in crawl traps whereas 20 arthropod orders were observed under burlap bands and cardboard panels. The most abundant insects collected from crawl traps were aphids (Homoptera: Aphididae) and ants (Hymenoptera: Forrnicidae). The greatest biomass was in the wood cockroaches (Blattaria: Blattellidae), caterpillars (Lepidoptera) in the Family Noctuidae, and adult weevils (Coleoptera: Curculionidae). The most common group observed underneath cardboard panels was lsoptera (termites), and the most common taxon under burlap bands was wood cockroaches. Overall, arthropod abundance and biomass captured in crawl traps was similar in control and removal plots. In contrast, we observed more arthropods under burlap bands (mean & SE; 3,021.5 k 348.6, P= 0.03) and cardboard panels (3,537.25 k 432.4, P= 0.04) in plots with coarse woody debris compared with burlap bands (2325 + 171.3) and cardboard panels (2439.75 + 288.9) in plots where coarse woody debris was removed. Regression analyses showed that abundance beneath cardboard panels was positively correlated with abundance beneath burlap bands demonstrating the link between abundance on the ground with that on trees. Our results demonstrate that short-term removal of coarse woody debris from pine forests reduced overall arthropod availability to bark-foraging birds.

ASSESSING OF HERBIVOROUS AND BENEFICIAL INSECTS ON SWITCHGRASS IN UKRAINE.

Science.gov (United States)

Stefanovska, T; Kucherovska, S; Pisdlisnyuk, V

2014-01-01

A perennial switchgrass, (Panicum virgatum L.), (C4) that is native to North America has good potential for biomass production because of its wide geographic distribution and adaptability to diverse environmental conditions. Insects can significantly impact the yield and quality of biofuel crops. If switchgrass are to be grown on marginally arable land or in monoculture, it are likely to be plagued with herbivore pests and plant diseases at a rate that exceeds what would be expected if the plants were not stressed in this manner. This biofuel crop has been under evaluation for commercial growing in Ukraine for eight years. However, insect diversity and the potential impact of pests on biomass production of this feedstock have not been accessed yet. The objective of our study, started in 2011, is a survey of switch grass insects by trophic groups and determine species that have pest status at two sites in the Central part of Ukraine (Kiev and Poltava regions). In Poltava site we investigated the effect of nine varieties of switchgrass (lowland and upland) to insects' diversity. We assessed changes over time in the densities of major insects' trophic groups, identifying potential pests and natural enemies. Obtained results indicates that different life stages of herbivorous insects from Hymenoptera, Homoptera, Diptera and Coleoptera orders were present on switchgrass during the growing season. Our study results suggests that choice of variety has an impact on trophic groups' structure and number of insects from different orders on swicthgrass. Herbivores and beneficial insects were the only groups that showed significant differences across sampling dates. The highest population of herbivores insects we recorded on 'Alamo' variety for studied years, although herbivore diversity tended to increase on 'Shelter', 'Alamo' and 'Cave-in-Rock' during 2012 and 2013. 'Dacotah', 'Nebraska', 'Sunburst', 'Forestburg' and 'Carthage' showed the highest level of beneficial insects

Vitex agnus-castus is a preferred host plant for Hyalesthes obsoletus.

Science.gov (United States)

Sharon, Rakefet; Soroker, Victoria; Wesley, S Daniel; Zahavi, Tirtza; Harari, Ally; Weintraub, Phyllis G

2005-05-01

Hyalesthes obsoletus Signoret (Homoptera: Cixiidae) is a polyphagous planthopper that transmits stolbur phytoplasma (a causative agent of "yellows" disease) to various weeds, members of the Solanaceae, and wine grapes (Vitis vinifera L.) in Europe and the Middle East. Planthoppers were collected by hand vacuuming eight native plant species. Vitex agnus-castus L., a shrub in the Verbenaceae, hosted the largest number of H. obsoletus, although Olea europaea L. also served as a host for adults. Using a Y-olfactometer, we compared the planthoppers relative preference for V. agnus-castus, Convolvulus arvensis, and V. vinifera. V. agnus-castus was more attractive to both male and female H. obsoletus than the other plants. H. obsoletus antennal response was stronger to volatiles collected from V. agnuscastus than from Cabernet Sauvignon variety of V. vinifera. To determine if V. agnus-castus would serve as a reservoir for the pathogen, H. obsoletus were collected from leaf and stem samples of native V. agnus-castus, and were tested by polymerase chain reaction (PCR) for the presence of phytoplasma DNA. While 14% and 25% (2003 and 2004, respectively) of the insects tested positive for phytoplasma DNA, none of the plant samples tested positive. To determine if V. agnus-castus could serve as a host plant for the development of the planthopper, we placed emergence cages beneath field shrubs and enclosed wild-caught H. obsoletus in a cage with a potted young shrub. We found adult H. obsoletus in the emergence cases and planthopper nymphs in the soil of the potted plant. We concluded that V. agnus-castus is attractive to H. obsoletus, which seems to be refractory to phytoplasma infections and warrants further testing as a trap plant near vineyards.

Temporal dynamics of arthropods on six tree species in dry woodlands on the Caribbean Island of Puerto Rico.

Science.gov (United States)

Beltrán, William; Wunderle, Joseph M

2014-01-01

The seasonal dynamics of foliage arthropod populations are poorly studied in tropical dry forests despite the importance of these studies for understanding arthropod population responses to environmental change. We monitored the abundance, temporal distributions, and body size of arthropods in five naturalized alien and one native tree species to characterize arthropod seasonality in dry novel Prosopis-Leucaena woodlands in Puerto Rico. A branch clipping method was used monthly to sample foliage arthropod abundance over 39 mo. Seasonal patterns of rainfall and abundance within various arthropod taxa were highly variable from year to year. Abundance for most taxa did not show significant seasonality over the 3 yr, although most taxa had abundance peaks each year. However, Homoptera displayed high seasonality with significant temporal aggregations in each year. Formicidae, Orthoptera, and Coleoptera showed high variation in abundance between wet and dry periods, whereas Hemiptera were consistently more abundant in the wet period. Seasonal differences in mean abundance were found only in a few taxa on Tamarindus indica L., Bucida buceras L., Pithecellobium dulce, and (Roxburgh) Benth. Mean arthropod abundance varied among tree species, with highest numbers on Prosopis juliflora, (Swartz) De Candolle, Pi. dulce, Leucaena leucocephala, and (Lamarck) de Wit. Abundance of Araneae, Orthoptera, Coleoptera, Lepidoptera larvae, and all arthropods showed weak relationships with one or more climatic variables (rainfall, maximum temperature, or relative humidity). Body size of arthropods was usually largest during the dry periods. Overall, total foliage arthropod abundance showed no consistent seasonality among years, which may become a more common trend in dry forests and woodlands in the Caribbean if seasonality of rainfall becomes less predictable. © The Author 2014. Published by Oxford University Press on behalf of the Entomological Society of America.

Macrofauna edáfica asociada con sistemas agroforestales en la Amazonía Colombiana

Directory of Open Access Journals (Sweden)

Juan Carlos Suárez Salazar

2015-07-01

Full Text Available La densidad, riqueza y diversidad de la macrofauna edáfica son afectadas, entre otros factores, por la configuración de los agroecosistemas y la estacionalidad de la precipitación. Con el fin de evaluar estos efectos en mayo y noviembre de 2011, correspondientes a épocas de máxima y mínima precipitación, respectivamente, se realizaron estudios sobre la composición de la macrofauna edáfica asociada con los arreglos agroforestales ubicados en el Centro de Investigaciones Macagual Cesar Augusto Estrada González, Amazonia, Caquetá, Colombia. El experimento se dispuso en un diseño completo al azar bifactorial con cuatro tratamientos (arreglos agroforestales: AB = abarco - Cariniana pyriformis Miers; CH = caucho Hevea brasiliensis (Willd. ex A. Juss. Müll. Arg. ; CP = caucho-parica Schizolobium amazonicum Huber; UV = uvito Genipa Americana L. y dos épocas (máxima y mínima precipitación, y cuatro repeticiones en parcelas divididas. Para explorar las relaciones entre los órdenes de macrofauna, se realizó un análisis de componentes principales y se evalúo el efecto de los arreglos agroforestales con una prueba de Monte Carlo. Los resultados mostraron que la densidad de la macrofauna fue mayor en el periodo de máxima precipitación (1129 individuos en comparación con el de mínima (598 individuos. Los arreglos agroforestales influyen sobre la presencia o ausencia de algunos grupos taxonómicos (P < 0.05 como Homoptera (Insecta y Raphidioptera (Insecta; además los UV y AB pueden favorecer a la macrofauna del estrés por sequía

Comparative Proteomic Analysis of Susceptible and Resistant Rice Plants during Early Infestation by Small Brown Planthopper

Directory of Open Access Journals (Sweden)

Yan Dong

2017-10-01

Full Text Available The small brown planthopper (Laodelphax striatellus Fallén, Homoptera, Delphacidae-SBPH is one of the major destructive pests of rice (Oryza sativa L.. Understanding on how rice responds to SBPH infestation will contribute to developing strategies for SBPH control. However, the response of rice plant to SBPH is poorly understood. In this study, two contrasting rice genotypes, Pf9279-4 (SBPH-resistant and 02428 (SBPH-susceptible, were used for comparative analysis of protein profiles in the leaf sheath of rice plants in responses to SBPH infestation. One hundred and thirty-two protein spots that were differentially expressed between the resistant and susceptible rice lines were identified with significant intensity differences (≥2-fold, P < 0.05 at 0, 6, and 12 h after SBPH infestation. Protein expression profile analysis in the leaf sheath of SBPH-resistant and SBPH-susceptible rice lines after SBPH infestation showed that proteins induced by SBPH feeding were involved mainly in stress response, photosynthesis, protein metabolic process, carbohydrate metabolic process, energy metabolism, cell wall-related proteins, amino acid metabolism and transcriptional regulation. Gene expression analysis of 24 differentially expressed proteins (DEPs showed that more than 50% DEPs were positively correlated with their mRNA levels. Analysis of some physiological indexes mainly involved in the removal of oxygen reactive species showed that the levels of superoxide dismutase (SOD and glutathione (GSH were considerably higher in Pf9279-4 than 02428 during SBPH infestation. The catalase (CAT activity and hydroxyl radical inhibition were lower in Pf9279-4 than 02428. Analysis of enzyme activities indicates that Pf9279-4 rice plants defend against SBPH through the activation of the pathway of the salicylic acid (SA-dependent systemic acquired resistance. In conclusion, this study provides some insights into the molecular networks involved on cellular and

Excited state non-adiabatic dynamics of the smallest polyene, trans 1,3-butadiene. I. Time-resolved photoelectron-photoion coincidence spectroscopy

Science.gov (United States)

Boguslavskiy, Andrey E.; Schalk, Oliver; Gador, Niklas; Glover, William J.; Mori, Toshifumi; Schultz, Thomas; Schuurman, Michael S.; Martínez, Todd J.; Stolow, Albert

2018-04-01

The ultrafast excited state dynamics of the smallest polyene, trans-1,3-butadiene, were studied by femtosecond time-resolved photoelectron-photoion coincidence (TRPEPICO) spectroscopy. The evolution of the excited state wavepacket, created by pumping the bright 1Bu (ππ*) electronic state at its origin of 216 nm, is projected via one- and two-photon ionization at 267 nm onto several ionization continua. The results are interpreted in terms of Koopmans' correlations and Franck-Condon factors for the excited and cationic states involved. The known predissociative character of the cation excited states is utilized to assign photoelectron bands to specific continua using TRPEPICO spectroscopy. This permits us to report the direct observation of the famously elusive S1(21Ag) dark electronic state during the internal conversion of trans 1,3-butadiene. Our phenomenological analysis permits the spectroscopic determination of several important time constants. We report the overall decay lifetimes of the 11Bu and 21Ag states and observe the re-appearance of the hot ground state molecule. We argue that the apparent dephasing time of the S2(11Bu) state, which leads to the extreme breadth of the absorption spectrum, is principally due to large amplitude torsional motion on the 1Bu surface in conjunction with strong non-adiabatic couplings via conical intersections, whereupon nuclear wavepacket revivals to the initial Franck-Condon region become effectively impossible. In Paper II [W. J. Glover et al., J. Chem. Phys. 148, 164303 (2018)], ab initio multiple spawning is used for on-the-fly computations of the excited state non-adiabatic wavepacket dynamics and their associated TRPEPICO observables, allowing for direct comparisons of experiment with theory.

Untangling natural seascape variation from marine reserve effects using a landscape approach.

Directory of Open Access Journals (Sweden)

Brittany E Huntington

Full Text Available Distinguishing management effects from the inherent variability in a system is a key consideration in assessing reserve efficacy. Here, we demonstrate how seascape heterogeneity, defined as the spatial configuration and composition of coral reef habitats, can mask our ability to discern reserve effects. We then test the application of a landscape approach, utilizing advances in benthic habitat mapping and GIS techniques, to quantify this heterogeneity and alleviate the confounding influence during reserve assessment. Seascape metrics were quantified at multiple spatial scales using a combination of spatial image analysis and in situ surveys at 87 patch reef sites in Glover's Reef Lagoon, Belize, within and outside a marine reserve enforced since 1998. Patch reef sites were then clustered into classes sharing similar seascape attributes using metrics that correlated significantly to observed variations in both fish and coral communities. When the efficacy of the marine reserve was assessed without including landscape attributes, no reserve effects were detected in the diversity and abundance of fish and coral communities, despite 10 years of management protection. However, grouping sites based on landscape attributes revealed significant reserve effects between site classes. Fish had higher total biomass (1.5x and commercially important biomass (1.75x inside the reserve and coral cover was 1.8 times greater inside the reserve, though direction and degree of response varied by seascape class. Our findings show that the application of a landscape classification approach vastly improves our ability to evaluate the efficacy of marine reserves by controlling for confounding effects of seascape heterogeneity and suggests that landscape heterogeneity should be considered in future reserve design.

Reef Sharks Exhibit Site-Fidelity and Higher Relative Abundance in Marine Reserves on the Mesoamerican Barrier Reef

Science.gov (United States)

Bond, Mark E.; Babcock, Elizabeth A.; Pikitch, Ellen K.; Abercrombie, Debra L.; Lamb, Norlan F.; Chapman, Demian D.

2012-01-01

Carcharhinid sharks can make up a large fraction of the top predators inhabiting tropical marine ecosystems and have declined in many regions due to intense fishing pressure. There is some support for the hypothesis that carcharhinid species that complete their life-cycle within coral reef ecosystems, hereafter referred to as “reef sharks”, are more abundant inside no-take marine reserves due to a reduction in fishing pressure (i.e., they benefit from marine reserves). Key predictions of this hypothesis are that (a) individual reef sharks exhibit high site-fidelity to these protected areas and (b) their relative abundance will generally be higher in these areas compared to fished reefs. To test this hypothesis for the first time in Caribbean coral reef ecosystems we combined acoustic monitoring and baited remote underwater video (BRUV) surveys to measure reef shark site-fidelity and relative abundance, respectively. We focused on the Caribbean reef shark (Carcharhinus perezi), the most common reef shark in the Western Atlantic, at Glover's Reef Marine Reserve (GRMR), Belize. Acoustically tagged sharks (N = 34) were detected throughout the year at this location and exhibited strong site-fidelity. Shark presence or absence on 200 BRUVs deployed at GRMR and three other sites (another reserve site and two fished reefs) showed that the factor “marine reserve” had a significant positive effect on reef shark presence. We rejected environmental factors or site-environment interactions as predominant drivers of this pattern. These results are consistent with the hypothesis that marine reserves can benefit reef shark populations and we suggest new hypotheses to determine the underlying mechanism(s) involved: reduced fishing mortality or enhanced prey availability. PMID:22412965

Molecular dynamics of detoxification and toxin-tolerance genes in brown planthopper (Nilaparvata lugens Stål., Homoptera: Delphacidae) feeding on resistant rice plants.

Science.gov (United States)

Yang, Zhifan; Zhang, Futie; He, Qing; He, Guangcun

2005-06-01

To investigate the molecular response of brown planthopper, Nilaparvata lugens (BPH) to BPH-resistant rice plants, we isolated cDNA fragments of the genes encoding for carboxylesterase (CAR), trypsin (TRY), cytochrome P450 monooxygenase (P450), NADH-quinone oxidoreductase (NQO), acetylcholinesterase (ACE), and Glutathione S-transferase (GST). Expression profiles of the genes were monitored on fourth instar nymphs feeding on rice varieties with different resistance levels. Northern blot hybridization showed that, compared with BPH reared on susceptible rice TN1, expression of the genes for P450 and CAR was apparently up-regulated and TRY mRNA decreased in BPH feeding on a highly resistant rice line B5 and a moderately resistant rice variety MH63, respectively. Two transcripts of GST increased in BPH feeding on B5; but in BPH feeding on MH63, this gene was inducible and its expression reached a maximum level at 24 h, and then decreased slightly. The expression of NQO gene was enhanced in BPH on B5 plants but showed a constant expression in BPH on MH63 plants. No difference in ACE gene expression among BPH on different rice plants was detected by the RT-PCR method. The results suggest these genes may play important roles in the defense response of BPH to resistant rice.

Microsatellite markers reveal a predominant sugarcane aphid (Homoptera: Aphididae) clone is found on sorghum in seven states and one territory of the USA

Science.gov (United States)

The sugarcane aphid, Melanaphis sacchari, has become a serious pest causing severe economic losses to sorghum grown in the southern United States (U.S.). Since its original detection in four states in 2013, M. sacchari on sorghum has now, for 2016, spread to 19 states. The presence of one or multip...

Development of a population-based threshold model of conidial germination for analysing the effects of physiological manipulation on the stress tolerance and infectivity of insect pathogenic fungi.

Science.gov (United States)

Andersen, M; Magan, N; Mead, A; Chandler, D

2006-09-01

Entomopathogenic fungi are being used as biocontrol agents of insect pests, but their efficacy can be poor in environments where water availability is reduced. In this study, the potential to improve biocontrol by physiologically manipulating fungal inoculum was investigated. Cultures of Beauveria bassiana, Lecanicillium muscarium, Lecanicillium longisporum, Metarhizium anisopliae and Paecilomyces fumosoroseus were manipulated by growing them under conditions of water stress, which produced conidia with increased concentrations of erythritol. The time-course of germination of conidia at different water activities (water activity, aw) was described using a generalized linear model, and in most cases reducing the water activity of the germination medium delayed the onset of germination without affecting the distribution of germination times. The germination of M. anisopliae, L. muscarium, L. longisporum and P. fumosoroseus was accelerated over a range of aw levels as a result of physiological manipulation. However, the relationship between the effect of physiological manipulation on germination and the osmolyte content of conidia varied according to fungal species. There was a linear relationship between germination rate, expressed as the reciprocal of germination time, and aw of the germination medium, but there was no significant effect of fungal species or physiological manipulation on the aw threshold for germination. In bioassays with M. anisopliae, physiologically manipulated conidia germinated more rapidly on the surface of an insect host, the melon cotton aphid Aphis gossypii, and fungal virulence was increased even when relative humidity was reduced after an initial high period. It is concluded that physiological manipulation may lead to improvements in biocontrol in the field, but choice of fungal species/isolate will be critical. In addition, the population-based threshold model used in this study, which considered germination in terms of physiological

Melhoramento do algodoeiro no Estado de São Paulo: obtenção da cultivar IAC 21

Directory of Open Access Journals (Sweden)

CIA EDIVALDO

2001-01-01

Full Text Available Neste trabalho é relatado o esquema utilizado para obtenção da cultivar IAC 21 realizado durante o período de 1981/82 a 1993/94. A cultivar foi originada por resseleção da IAC 19, direcionada principalmente para resistência a Colletotrichum gossypii var. cephalosporioides e nematóides, através do melhoramento genealógico. No início dos estudos as seleções e respectivas progênies foram comparadas à cultivar original IAC 19 e, posteriormente, a 'IAC 20'. Além das características econômicas de produção e qualidade da fibra, a linhagem foi avaliada para resistência múltipla às doenças: murchas de Fusarium e Verticillium, mancha-angular, ramulose e nematóides. A cultivar IAC 21 foi superior a 'IAC 19' em 6,2%, em produtividade, na média geral dos experimentos, chegando a 18,1% em solos altamente infectados por patógenos; 4,6% em produção de sementes, 2,4% em tenacidade da fibra e 6,9% em tenacidade do fio, sem perdas significativas em outras características, com exceção da porcentagem de fibra que decresceu 2,6%. Com respeito às doenças, apresentou melhores índices para murcha de Fusarium e ramulose mantendo-se, entretanto, no mesmo nível para as demais. Estudos preliminares mostraram que 'IAC 21' apresentou índices inferiores a 'CNPA ITA 90' para a anomalia "murchamento avermelhado". Devido às vantagens verificadas em relação a 'IAC 19' e 'IAC 20', 'IAC 21' foi recomendada para plantio em todas as áreas do Estado de São Paulo, excluindo-se as de ocorrência do "murchamento avermelhado".

Activity of aphids associated with lettuce and broccoli in Spain and their efficiency as vectors of Lettuce mosaic virus.

Science.gov (United States)

Nebreda, M; Moreno, A; Pérez, N; Palacios, I; Seco-Fernández, V; Fereres, A

2004-03-01

This research sought to identify the aphid virus vector species associated with lettuce and broccoli crops in Spain, and to determine their population dynamics and ability to transmit Lettuce mosaic virus (LMV). Green tile traps and Moericke yellow water-pan traps were used to monitor aphid flights during the spring and autumn growing seasons of 2001. Aphid species feeding on lettuce were counted weekly. The transmission efficiencies of LMV were determined for the aphid species caught most frequently. The Moericke traps generally caught more aphid species than the tile trap, but the latter was the most suitable to estimate flight activity of species involved in virus spread. Spring aphid catches indicated that the main aphid species landing on lettuce in the regions of Madrid and Murcia was Hyperomyzus lactucae, but Brachycaudus helichrysi was also abundant in both regions. In broccoli in the Navarra region, the most abundant species in spring were Aphis fabae, B. helichrysi and H. lactucae. In autumn-sown crops, the main species landing on lettuce in the Madrid region were Hyadaphis coriandri and Aphis spiraecola. In Murcia, A. spiraecola and Myzus persicae were the most abundant, while in Navarra, Therioaphis trifolii, and various Aphis spp. were the most numerous landing on broccoli. The main aphid species colonising lettuce was Nasonovia ribisnigri, but other less abundant colonising species were Aulacorthum solani and Macrosiphum euphorbiae. The most efficient vectors of LMV were M. persicae, Aphis gossypii and M. euphorbiae, while A. fabae and H. lactucae transmitted with low efficiency, and Rhopalosiphum padi and N. ribisnigri did not transmit. Occurrence of LMV epidemics in central Spain in relation to aphid flights and the role of weeds as virus reservoirs is discussed.

A comparison of the criterion validity of popular measures of narcissism and narcissistic personality disorder via the use of expert ratings.

Science.gov (United States)

Miller, Joshua D; McCain, Jessica; Lynam, Donald R; Few, Lauren R; Gentile, Brittany; MacKillop, James; Campbell, W Keith

2014-09-01

The growing interest in the study of narcissism has resulted in the development of a number of assessment instruments that manifest only modest to moderate convergence. The present studies adjudicate among these measures with regard to criterion validity. In the 1st study, we compared multiple narcissism measures to expert consensus ratings of the personality traits associated with narcissistic personality disorder (NPD; Study 1; N = 98 community participants receiving psychological/psychiatric treatment) according to the Diagnostic and Statistical Manual of Mental Disorders (4th ed., text rev.; DSM-IV-TR; American Psychiatric Association, 2000) using 5-factor model traits as well as the traits associated with the pathological trait model according to the Diagnostic and Statistical Manual of Mental Disorders (5th ed.; American Psychiatric Association, 2013). In Study 2 (N = 274 undergraduates), we tested the criterion validity of an even larger set of narcissism instruments by examining their relations with measures of general and pathological personality, as well as psychopathology, and compared the resultant correlations to the correlations expected by experts for measures of grandiose and vulnerable narcissism. Across studies, the grandiose dimensions from the Five-Factor Narcissism Inventory (FFNI; Glover, Miller, Lynam, Crego, & Widiger, 2012) and the Narcissistic Personality Inventory (Raskin & Terry, 1988) provided the strongest match to expert ratings of DSM-IV-TR NPD and grandiose narcissism, whereas the vulnerable dimensions of the FFNI and the Pathological Narcissism Inventory (Pincus et al., 2009), as well as the Hypersensitive Narcissism Scale (Hendin & Cheek, 1997), provided the best match to expert ratings of vulnerable narcissism. These results should help guide researchers toward the selection of narcissism instruments that are most well suited to capturing different aspects of narcissism. PsycINFO Database Record (c) 2014 APA, all rights reserved.

Are CO Observations of Interstellar Clouds Tracing the H2?

Science.gov (United States)

Federrath, Christoph; Glover, S. C. O.; Klessen, R. S.; Mac Low, M.

2010-01-01

Interstellar clouds are commonly observed through the emission of rotational transitions from carbon monoxide (CO). However, the abundance ratio of CO to molecular hydrogen (H2), which is the most abundant molecule in molecular clouds is only about 10-4. This raises the important question of whether the observed CO emission is actually tracing the bulk of the gas in these clouds, and whether it can be used to derive quantities like the total mass of the cloud, the gas density distribution function, the fractal dimension, and the velocity dispersion--size relation. To evaluate the usability and accuracy of CO as a tracer for H2 gas, we generate synthetic observations of hydrodynamical models that include a detailed chemical network to follow the formation and photo-dissociation of H2 and CO. These three-dimensional models of turbulent interstellar cloud formation self-consistently follow the coupled thermal, dynamical and chemical evolution of 32 species, with a particular focus on H2 and CO (Glover et al. 2009). We find that CO primarily traces the dense gas in the clouds, however, with a significant scatter due to turbulent mixing and self-shielding of H2 and CO. The H2 probability distribution function (PDF) is well-described by a log-normal distribution. In contrast, the CO column density PDF has a strongly non-Gaussian low-density wing, not at all consistent with a log-normal distribution. Centroid velocity statistics show that CO is more intermittent than H2, leading to an overestimate of the velocity scaling exponent in the velocity dispersion--size relation. With our systematic comparison of H2 and CO data from the numerical models, we hope to provide a statistical formula to correct for the bias of CO observations. CF acknowledges financial support from a Kade Fellowship of the American Museum of Natural History.

Strand displacement by DNA polymerase III occurs through a tau-psi-chi link to single-stranded DNA-binding protein coating the lagging strand template.

Science.gov (United States)

Yuan, Quan; McHenry, Charles S

2009-11-13

In addition to the well characterized processive replication reaction catalyzed by the DNA polymerase III holoenzyme on single-stranded DNA templates, the enzyme possesses an intrinsic strand displacement activity on flapped templates. The strand displacement activity is distinguished from the single-stranded DNA-templated reaction by a high dependence upon single-stranded DNA binding protein and an inability of gamma-complex to support the reaction in the absence of tau. However, if gamma-complex is present to load beta(2), a truncated tau protein containing only domains III-V will suffice. This truncated protein is sufficient to bind both the alpha subunit of DNA polymerase (Pol) III and chipsi. This is reminiscent of the minimal requirements for Pol III to replicate short single-stranded DNA-binding protein (SSB)-coated templates where tau is only required to serve as a scaffold to hold Pol III and chi in the same complex (Glover, B., and McHenry, C. (1998) J. Biol. Chem. 273, 23476-23484). We propose a model in which strand displacement by DNA polymerase III holoenzyme depends upon a Pol III-tau-psi-chi-SSB binding network, where SSB is bound to the displaced strand, stabilizing the Pol III-template interaction. The same interaction network is probably important for stabilizing the leading strand polymerase interactions with authentic replication forks. The specificity constant (k(cat)/K(m)) for the strand displacement reaction is approximately 300-fold less favorable than reactions on single-stranded templates and proceeds with a slower rate (150 nucleotides/s) and only moderate processivity (approximately 300 nucleotides). PriA, the initiator of replication restart on collapsed or misassembled replication forks, blocks the strand displacement reaction, even if added to an ongoing reaction.

Abyssal fauna of the UK-1 polymetallic nodule exploration area, Clarion-Clipperton Zone, central Pacific Ocean: Cnidaria.

Science.gov (United States)

Dahlgren, Thomas G; Wiklund, Helena; Rabone, Muriel; Amon, Diva J; Ikebe, Chiho; Watling, Les; Smith, Craig R; Glover, Adrian G

2016-01-01

We present data from a DNA taxonomy register of the abyssal Cnidaria collected as part of the Abyssal Baseline (ABYSSLINE) environmental survey cruise 'AB01' to the UK Seabed Resources Ltd (UKSRL) polymetallic-nodule exploration area 'UK-1' in the eastern Clarion-Clipperton Zone (CCZ), central Pacific Ocean abyssal plain. This is the second paper in a series to provide regional taxonomic data for a region that is undergoing intense deep-sea mineral exploration for high-grade polymetallic nodules. Data were collected from the UK-1 exploration area following the methods described in Glover et al. (2015b). Morphological and genetic data are presented for 10 species and 18 records identified by a combination of morphological and genetic data, including molecular phylogenetic analyses. These included 2 primnoid octocorals, 2 isidid octocorals, 1 anemone, 4 hydroids (including 2 pelagic siphonophores accidentally caught) and a scyphozoan jellyfish (in the benthic stage of the life cycle). Two taxa matched previously published genetic sequences (pelagic siphonophores), two taxa matched published morphological descriptions (abyssal primnoids described from the same locality in 2015) and the remaining 6 taxa are potentially new species, for which we make the raw data, imagery and vouchers available for future taxonomic study. We have used a precautionary approach in taxon assignments to avoid over-estimating species ranges. The Clarion-Clipperton Zone is a region undergoing intense exploration for potential deep-sea mineral extraction. We present these data to facilitate future taxonomic and environmental impact study by making both data and voucher materials available through curated and accessible biological collections. For some of the specimens we also provide image data collected at the seabed by ROV, wich may facilitate more accurate taxon designation in coming ROV or AUV surveys.

IRECCSEM: Evaluating Clare Basin potential for onshore carbon sequestration using magnetotelluric data (Preliminary results). New approaches applied for processing, modeling and interpretation

Science.gov (United States)

Campanya i Llovet, J.; Ogaya, X.; Jones, A. G.; Rath, V.

2014-12-01

The IRECCSEM project (www.ireccsem.ie) is a Science Foundation Ireland Investigator Project that is funded to evaluate Ireland's potential for onshore carbon sequestration in saline aquifers by integrating new electromagnetic data with existing geophysical and geological data. The main goals of the project are to determine porosity-permeability values of the potential reservoir formation as well as to evaluate the integrity of the seal formation. During the Summer of 2014 a magnetotelluric (MT) survey was carried out at the Clare basin (Ireland). A total of 140 sites were acquired including audiomagnetotelluric (AMT), broadband magnetotelluric (BBMT) and long period magnetotelluric (LMT) data. The nominal space between sites is 0.6 km for AMT sites, 1.2 km for BBMT sites and 8 km for LMT sites. To evaluate the potential for carbon sequestration of the Clare basin three advances on geophysical methodology related to electromagnetic techniques were applied. First of all, processing of the MT data was improved following the recently published ELICIT methodology. Secondly, during the inversion process, the electrical resistivity distribution of the subsurface was constrained combining three different tensor relationships: Impedances (Z), induction arrows (TIP) and multi-site horizontal magnetic transfer-functions (HMT). Results from synthetic models were used to evaluate the sensitivity and properties of each tensor relationship. Finally, a computer code was developed, which employs a stabilized least squares approach to estimate the cementation exponent in the generalized Archie law formulated by Glover (2010). This allows relating MT-derived electrical resistivity models to porosity distributions. The final aim of this procedure is to generalize the porosity - permeability values measured in the boreholes to regional scales. This methodology will contribute to the evaluation of possible sequestration targets in the study area.

Role of vegetation type on hydraulic conductivity in urban rain gardens

Science.gov (United States)

Schott, K.; Balster, N. J.; Johnston, M. R.

2009-12-01

Although case studies report improved control of urban stormwater within residential rain gardens, the extent to which vegetation type (shrub, turf, prairie) affects the saturated hydraulic conductivity (Ksat) of these depressions has yet to be investigated in a controlled experiment. We hypothesized that there would be significant differences in hydraulic conductivity by vegetation type due to differences in soil physical characteristics and rooting dynamics such that Ksat of shrub gardens would exceed that of prairie, followed by turf. To test this hypothesis, we measured changes in Ksat relative to the above vegetation types as well as non-vegetative controls, each of which were replicated three times for a total of 12 rain gardens. Ksat was calculated using a published method for curve-fitting to single-ring infiltration with a two-head approach where the shape factor is independent of ponding depth. Constant-head infiltration rates were measured at two alternating ponding depths within each garden twice over the growing season. Root core samples were also taken to qualify belowground characteristics including soil bulk density and rooting dynamics relative to differences in Ksat. We found the control and shrub gardens had the lowest mean Ksat of 3.56 (SE = 0.96) and 3.73 (1.22) cm3 hr-1, respectively. Prairie gardens had the next highest mean Ksat of 12.18 (2.26) cm3 hr-1, and turf had the highest mean value of 23.63 (1.81) cm3 hr-1. These data suggest that a denser rooting network near the soil surface may influence saturated hydraulic conductivity. We applied our observed flow rates to a Glover solution model for 3-dimensional flow, which revealed considerably larger discrepancies in turf gardens than beneath prairie or shrub. This indicated that lateral flow conditions in the turf plots could be the explanation for our observed infiltration rates.

Interactive Effects of Southern Rice Black-Streaked Dwarf Virus Infection of Host Plant and Vector on Performance of the Vector, Sogatella furcifera (Homoptera: Delphacidae).

Science.gov (United States)

Lei, Wenbin; Liu, Danfeng; Li, Pei; Hou, Maolin

2014-10-01

Performance of insect vectors can be influenced by the viruses they transmit, either directly by infection of the vectors or indirectly via infection of the host plants. Southern rice black-streaked dwarf virus (SRBSDV) is a propagative virus transmitted by the white-backed planthopper, Sogatella furcifera (Hovath). To elucidate the influence of SRBSDV on the performance of white-backed planthopper, life parameters of viruliferous and nonviruliferous white-backed planthopper fed rice seedlings infected or noninfected with SRBSDV were measured using a factorial design. Regardless of the infection status of the rice plant host, viruliferous white-backed planthopper nymphs took longer to develop from nymph to adult than did nonviruliferous nymphs. Viruliferous white-backed planthopper females deposited fewer eggs than nonviruliferous females and both viruliferous and nonviruliferous white-backed planthopper females laid fewer eggs on infected than on noninfected plants. Longevity of white-backed planthopper females was also affected by the infection status of the rice plant and white-backed planthopper. Nonviruliferous white-backed planthopper females that fed on infected rice plants lived longer than the other three treatment groups. These results indicate that the performance of white-backed planthopper is affected by SRBSDV either directly (by infection of white-backed planthopper) or indirectly (by infection of rice plant). The extended development of viruliferous nymphs and the prolonged life span of nonviruliferous adults on infected plants may increase their likelihood of transmitting virus, which would increase virus spread. © 2014 Entomological Society of America.

The jacoona assemblage of the genus Dundubia Amyot & Serville (Homoptera: Cicadidae): a taxonomic study of its species and a discussion of its phylogenetic relationships

NARCIS (Netherlands)

Beuk, Paul L.Th.

1996-01-01

The species of Orientopsaltria with unicolorous opercula and three related species of Platylomia are transferred to the genus Dundubia and allocated in the ‘Dundubia jacoona assemblage’ pending further investigation. The assemblage comprises eleven species in total; all are found in the

Development of a stage-structured process-based predator–prey model to analyse biological control of cotton aphid, Aphis gossypii, by the sevenspot ladybeetle, Coccinella septempunctata, in cotton

NARCIS (Netherlands)

Xia, J.Y.; Wang, J.; Cui, J.J.; Leffelaar, P.A.; Rabbinge, R.; Werf, van der W.

2018-01-01

Agricultural system diversification is well known to affect the population dynamics of crop pests, but predator–prey dynamics in crop systems are difficult to analyse due to interactions between multiple life stages of predator and prey, the modulating effect of temperature, the actions of

Climate Risk Modelling of Balsam Woolly Adelgid Damage Severity in Subalpine Fir Stands of Western North America.

Science.gov (United States)

Hrinkevich, Kathryn H; Progar, Robert A; Shaw, David C

2016-01-01

The balsam woolly adelgid (Adelges piceae (Ratzeburg) (Homoptera: Adelgidae)) (BWA) is a nonnative, invasive insect that threatens Abies species throughout North America. It is well established in the Pacific Northwest, but continues to move eastward through Idaho and into Montana and potentially threatens subalpine fir to the south in the central and southern Rocky Mountains. We developed a climatic risk model and map that predicts BWA impacts to subalpine fir using a two-step process. Using 30-year monthly climate normals from sites with quantitatively derived BWA damage severity index values, we built a regression model that significantly explained insect damage. The sites were grouped into two distinct damage categories (high damage and mortality versus little or no mortality and low damage) and the model estimates for each group were used to designate distinct value ranges for four climatic risk categories: minimal, low, moderate, and high. We then calculated model estimates for each cell of a 4-kilometer resolution climate raster and mapped the risk categories over the entire range of subalpine fir in the western United States. The spatial variation of risk classes indicates a gradient of climatic susceptibility generally decreasing from the Olympic Peninsula in Washington and the Cascade Range in Oregon and Washington moving eastward, with the exception of some high risk areas in northern Idaho and western Montana. There is also a pattern of decreasing climatic susceptibility from north to south in the Rocky Mountains. Our study provides an initial step for modeling the relationship between climate and BWA damage severity across the range of subalpine fir. We showed that September minimum temperature and a metric calculated as the maximum May temperature divided by total May precipitation were the best climatic predictors of BWA severity. Although winter cold temperatures and summer heat have been shown to influence BWA impacts in other locations, these

[Effect of pine plantations on soil arthropods in a high Andean forest].

Science.gov (United States)

León-Gamboa, Alba Lucía; Ramos, Carolina; García, Mary Ruth

2010-09-01

One of the most common problems in the Colombian mountains has been the replacement of native vegetation by pine plantations. Soil arthropods are a fundamental component of forest ecosystem, since they participate in the organic matter fragmentation, previous to decomposition. This role is more valuable in high altitude environments, where low temperatures limit the dynamics of biological processes, where the effects of pine plantations on soil arthropods are still not well-known. In a remnant of high-andean forest (Neusa - Colombia) and a pine plantation of about 50 years-old, it was evaluated the composition, richness and abundance of arthropods at surface (S), organic horizon (O) and mineral horizon (A) of soil, to establish the differences associated to the soil use transformation. It was used "Pitfall" sampling to register the movement of the epigeous fauna, and extraction by funnel Berlese for determining the fauna density from O and A horizons. The Shannon and Simpson indexes estimated the diversity at different places and horizons, and the trophic structure of the community was evaluated. Overall, there were collected 38 306 individuals from forest and 17 386 individuals from pine plantation, mainly distributed in Collembola (42.4%), Acari (27%), Diptera (17.6%) and Coleoptera (4.6%). The most important differences were given in the surface, where the mobilization in forest (86 individuals/day) almost triplicates the one in pine plantation (33 individuals/day). The differences in composition were given in Collembola, Araneae, Hemiptera, Homoptera and Hymenoptera. The dynamics of richness and abundance along the year had significant high values in the native forest than in the pine plantation. The general trophic structure was dominated by saprophagous (75%), followed by predators (14%) and phytophagous (9%), but in two layers of the pine plantation soil (S and O) this structural pattern was not given. Based on the results, it was concluded that pine

Insect growth regulator effects of azadirachtin and neem oil on survivorship, development and fecundity of Aphis glycines (Homoptera: Aphididae) and its predator, Harmonia axyridis (Coleoptera: Coccinellidae).

Science.gov (United States)

Kraiss, Heidi; Cullen, Eileen M

2008-06-01

Aphis glycines Matsumura, an invasive insect pest in North American soybeans, is fed upon by a key biological control agent, Harmonia axyridis Pallas. Although biological control is preferentially relied upon to suppress insect pests in organic agriculture, approved insecticides, such as neem, are periodically utilized to reduce damaging pest populations. The authors evaluated direct spray treatments of two neem formulations, azadirachtin and neem seed oil, under controlled conditions for effects on survivorship, development time and fecundity in A. glycines and H. axyridis. Both azadirachtin and neem seed oil significantly increased aphid nymphal mortality (80 and 77% respectively) while significantly increasing development time of those surviving to adulthood. First-instar H. axyridis survival to adulthood was also significantly reduced by both neem formulations, while only azadirachtin reduced third-instar survivorship. Azadirachtin increased H. axyridis development time to adult when applied to both instars, while neem oil only increased time to adult when applied to first instar. Neither neem formulation affected the fecundity of either insect. Results are discussed within the context of future laboratory and field studies aimed at clarifying if neem-derived insecticides can be effectively integrated with biological control for soybean aphid management in organic soybeans. Copyright (c) 2008 Society of Chemical Industry.

Insecticide resistance in Bemisia tabaci Gennadius (Homoptera: Aleyrodidae) and Anopheles gambiae Giles (Diptera: Culicidae) could compromise the sustainability of malaria vector control strategies in West Africa.

Science.gov (United States)

Gnankiné, Olivier; Bassolé, Imael H N; Chandre, Fabrice; Glitho, Isabelle; Akogbeto, Martin; Dabiré, Roch K; Martin, Thibaud

2013-10-01

Insecticides from the organophosphate (OP) and pyrethroid (PY) chemical families, have respectively, been in use for 50 and 30 years in West Africa, mainly against agricultural pests, but also against vectors of human disease. The selection pressure, with practically the same molecules year after year (mainly on cotton), has caused insecticide resistance in pest populations such as Bemisia tabaci, vector of harmful phytoviruses on vegetables. The evolution toward insecticide resistance in malaria vectors such as Anopheles gambiae sensus lato (s.l.) is probably related to the current use of these insecticides in agriculture. Thus, successful pest and vector control in West Africa requires an investigation of insect susceptibility, in relation to the identification of species and sub species, such as molecular forms or biotypes. Identification of knock down resistance (kdr) and acetylcholinesterase gene (Ace1) mutations modifying insecticide targets in individual insects and measure of enzymes activity typically involved in insecticide metabolism (oxidase, esterase and glutathion-S-transferase) are indispensable in understanding the mechanisms of resistance. Insecticide resistance is a good example in which genotype-phenotype links have been made successfully. Insecticides used in agriculture continue to select new resistant populations of B. tabaci that could be from different biotype vectors of plant viruses. As well, the evolution of insecticide resistance in An. gambiae threatens the management of malaria vectors in West Africa. It raises the question of priority in the use of insecticides in health and/or agriculture, and more generally, the question of sustainability of crop protection and vector control strategies in the region. Here, we review the susceptibility tests, biochemical and molecular assays data for B. tabaci, a major pest in cotton and vegetable crops, and An. gambiae, main vector of malaria. The data reviewed was collected in Benin and Burkina Faso between 2008 and 2010 under the Corus 6015 research program. This review aims to show: (i) the insecticide resistance in B. tabaci as well as in An. gambiae; and (ii) due to this, the impact of selection of resistant populations on malaria vector control strategies. Some measures that could be beneficial for crop protection and vector control strategies in West Africa are proposed. Copyright © 2013 Elsevier B.V. All rights reserved.

Minimising losses caused by Zucchini yellow mosaic virus in vegetable cucurbit crops in tropical, sub-tropical and Mediterranean environments through cultural methods and host resistance.

Science.gov (United States)

Coutts, B A; Kehoe, M A; Jones, R A C

2011-08-01

Between 2006 and 2009, 10 field experiments were done at Kununurra, Carnarvon or Medina in Western Australia (WA) which have tropical, sub-tropical and Mediterranean climates, respectively. These experiments investigated the effectiveness of cultural control measures in limiting ZYMV spread in pumpkin, and single-gene resistance in commercial cultivars of pumpkin, zucchini and cucumber. Melon aphids (Aphis gossypii) colonised field experiments at Kununurra; migrant green peach aphids (Myzus persicae) visited but did not colonise at Carnarvon and Medina. Cultural control measures that diminished ZYMV spread in pumpkin included manipulation of planting date to avoid exposing young plants to peak aphid vector populations, deploying tall non-host barriers (millet, Pennisetum glaucum) to protect against incoming aphid vectors and planting upwind of infection sources. Clustering of ZYMV-infected pumpkin plants was greater without a 25m wide non-host barrier between the infection source and the pumpkin plants than when one was present, and downwind compared with upwind of an infection source. Host resistance gene zym was effective against ZYMV isolate Knx-1 from Kununurra in five cultivars of cucumber. In zucchini, host resistance gene Zym delayed spread of infection (partial resistance) in 2 of 14 cultivars but otherwise did not diminish final ZYMV incidence. Zucchini cultivars carrying Zym often developed severe fruit symptoms (8/14), and only the two cultivars in which spread was delayed and one that was tolerant produced sufficiently high marketable yields to be recommended when ZYMV epidemics are anticipated. In three pumpkin cultivars with Zym, this gene was effective against isolate Cvn-1 from Carnarvon under low inoculum pressure, but not against isolate Knx-1 under high inoculum pressure, although symptoms were milder and marketable yields greater in them than in cultivars without Zym. These findings allowed additional cultural control recommendations to be added

Identification of two acetylcholinesterases in Pardosa pseudoannulata and the sensitivity to insecticides.

Science.gov (United States)

Zhang, Yixi; Shao, Ying; Jiang, Feng; Li, Jian; Liu, Zewen

2014-03-01

Pardosa pseudoannulata is an important predatory enemy against insect pests, such as rice planthoppers and leafhoppers. In order to understand the insecticide selectivity between P. pseudoannulata and insect pests, two acetylcholinesterase genes, Pp-ace1 and Pp-ace2, were cloned from this natural enemy. The putative proteins encoded by Pp-ace1 and Pp-ace2 showed high similarities to insect AChE1 (63% to Liposcelis entomophila AChE1) and AChE2 (36% to Culex quinquefasciatus AChE2) with specific functional motifs, which indicated that two genes might encode AChE1 and AChE2 proteins respectively. The recombinant proteins by expressing Pp-ace1 and Pp-ace2 genes in insect sf9 cells showed high AChE activities. The kinetic parameters, Vmax and Km, of two recombinant AChE proteins were significantly different. The sensitivities to six insecticides were determined in two recombinant AChEs. Pp-AChE1 was more sensitive to all tested insecticides than Pp-AChE2, such as fenobucarb (54 times in Ki ratios), isoprocarb (31 times), carbaryl (13 times) and omethoate (6 times). These results indicated that Pp-AChE1 might be the major synaptic enzyme in the spider. By sequence comparison of P. pseudoannulata and insect AChEs, the key amino acid differences at or close to the functional sites were found. The locations of some key amino acid differences were consistent with the point mutation sites in insect AChEs that were associated with insecticide resistance, such as Phe331 in Pp-AChE2 corresponding to Ser331Phe mutation in Myzus persicae and Aphis gossypii AChE2, which might play important roles in insecticide selectivity between P. pseudoannulata and insect pests. Of course, the direct evidences are needed through further studies. Copyright © 2014 Elsevier Ltd. All rights reserved.

Preparing for the European Language Portfolio: Internet connections

Directory of Open Access Journals (Sweden)

Mualla Bilgin AKSU

2005-01-01

Full Text Available Preparing for the European Language Portfolio: Internet connections Lectures Philip GLOVER Asst. Prof. Dr. Ismail Hakký MIRICI Akdeniz University Faculty of Education, ELT Department Antalya-TURKEY Prof. Dr. Mualla Bilgin AKSU Inonu University, Faculty of Education, Educational Sciences Department Malatya, TURKEY ABSTRACT The European Language Portfolio (ELP is a tool for developing learner responsibility and autonomy through reflection and self-awareness. The ELP is based on the Common European Framework (CEF Reference Levels that enable learners to describe what they can do in different languages. The CEF is a Council of Europe initiative aimed at improving the learning of foreign languages. This paper uses the internet to look at how the ELP has been implemented in different settings and to suggest how the ELP may be approached. The paper introduces a small-scale case study of ELP pilot implementation in a university preparatory school. The results from this institution show many similarities with responses in other places, and demonstrate the importance of integrating the ELP with the existing programme, providing teacher training and clarifying the status and purpose of the ELP. Analysis of documents on the internet shows a number of important factors. The most successful examples of ELP use involved integration of the ELP in the institution’s programme, training for teachers and students and a high level of commitment of time and financial resources by teachers and administrators. Responses from teachers were often extremely positive, others showed interest but many also expressed reservations about the ELP. Student responses were generally but not universally positive and a number of criticisms were raised concerning the status and purpose of the ELP. The paper provides full internet links so readers can access the same documents. The paper concludes firstly that future ELP use could exploit the internet for teacher training and

Metodología para la evaluación del potencial insecticida de especies forestales.

Directory of Open Access Journals (Sweden)

Morales Soto León

2000-06-01

Full Text Available La diversidad florística de Colombia plantea enormes retos de investigación, con miras a una utilización racional e integral de sus recursos forestales. Las plantas con efectos biocidas utilizables en el control de plagas o enfermedades revisten una singular importancia. El objetivo de este trabajo es plantear una metodología de fácil aplicación, bajo costo y rápidos resultados, que permita acopiar la información necesaria sobre el mayor número de especies con potencial en este sentido. La metodología plantea la siguiente secuencia: selección de las especies vegetales de interés, apoyada en los reportes bibliográficos, conocimiento ancestral y observaciones personales; recolección del material en el campo; preparación del extracto total a partir del material seco; pruebas iniciales con Artemia salina Lech. para detectar actividad biológica, a través de la determinación de la LC50 (las especies con LC50 menores de 1000 ppm se consideran promisorias y ameritan procesos posteriores de fraccionamiento químico, bioensayos con las sustancias más promisorias sobre algún organismo de interés particular y determinación final de los compuestos activos en la planta. La metodología descrita fue empleada en la evaluación del potencial de acción biocida de 5 especies arbóreas o arbustivas, Guarea guidonia (L. Sleumer y Trichia hirta L. (Meliaceae, Machaerium moritzianum Benth. (Fabaceae, Swinglea glutinosa Merrill. (Rutaceae y Mammea americana L. (Clusiaceae. Se utilizó para los bioensayos iniciales el microcrustáceo Artemia salina Leach como indicador del potencial biocida con el fin de seleccionar las dos especies más promisorias a partir de las LC50 obtenidas. Con las dos se realizaron los bioensayos para evaluar la acción fagoinhibidora en la hormiga arriera Atta cephalotes (L., y el posible control de Alconeura sp. (Homoptera: Cicadellidae, insecto chupador que afecta la ceiba verde Pseudobombax septenatum (Jacq. Dugand

Ocorrência do vírus do mosqueado do morangueiro no estado de São Paulo Occurrence of the strawberry mottle virus in São Paulo

Directory of Open Access Journals (Sweden)

Ana Maria B. Carvalho

1961-01-01

Full Text Available Verificou-se a ocorrência de estirpes do vírus do grupo denominado mosqueado («strawberry mottle» em plantações de morangueiro no Estado de São Paulo. Variedades antigas, como a Dr. Morère. acham-se totalmente infetatas. sendo portadoras sem sintomas. Alguns clones novos plantados apenas por poucos anos em campo, já se acham parcialmente infetados, indicando que há transmissão da moléstia sob condições naturais. Sintomas de palidez das nervuras, mosqueado, paralisação no crescimento e encrespamento são apresentados por plantas de Fragaria vesca infetadas pelos vírus dêsse grupo. Numerosas espécies de plantas-teste habituais foram inoculadas com diferentes isolados do vírus, por meio do vetor, mas os resultados foram geralmente negativos. Afídios virulíferos, colonizados sôbre plantas novas de Cassia accidentalis, Chenopodiam quinoa, Leonotis nepaetifolia e Leonurus sibiricus. induziram o aparecimento de sintomas. Não se conseguiu retransmitir o vírus dessas espécies para F. vesca, existindo, portanto, dúvidas sôbre a verdadeira identidade do vírus que infetava tais plantas. O vírus do mosqueado não foi aparentemente transmitido pela semente. Também não se mostrou transmissível mecânicamente para Frogaria vesca. O virus obtido por inoculação com o vetor em Chenopodium quinoa e que se supõe ser o do mosqueado, pôde se transmitido mecânicamente de C. quinoa para C. quinoa. mas não para F. vesca. O pulgão Pentatrichopus fragaefolii mostrou-se eficiente vetor do mosqueado, conseguindo-se obter em média mais de 50% de infecção em infestações com 1 afidio por planta. Aphis gossypii também transmitiu o vírus do mosqueado, mas com muito menor eficiência. Não se conseguiu transmitir o mosqueado com uma espécie de Cuscuta que ocorre comumeute em Campinas. Em testes de transmissão por enxertia de fôlhas, os resultados foram muito fracos devido ao mau pegamento. O pulgão Pentatrichopus fragaefolii

Resistência do algodoeiro à ferrugem tropical potencializada pelo silício

Directory of Open Access Journals (Sweden)

Antonia Mirian Nogueira de Moura Guerra

2013-01-01

Full Text Available Este trabalho teve como objetivo estudar o efeito do silício (Si sobre componentes de resistência do algodoeiro à ferrugem tropical causada por Phakopsora gossypii. Plantas das cultivares BRS Buriti e FM 993 cresceram em solução nutritiva contendo zero (-Si ou 2 mmol Si L- 1 (+Si. A maior concentração foliar de Si aumentou o período de incubação e o período latente em 9% e 14,3%, respectivamente, reduziu a área pustular, a área abaixo da curva de progresso da ferrugem e a área abaixo da curva de progresso da área da pústula em 27,5%, 36% e 22%, respectivamente. Nas plantas das cultivares BRS Buriti e FM 993 supridas com Si houve redução no número de pústulas em 70% e 30% e no número de urédias em 40,3% e 19,5%, respectivamente. A concentração de compostos fenólicos nas plantas da cultivar BRS Buriti supridas com Si aumentou até os 10 dai e, para a cultivar FM993, até os 30 dai. A concentração de derivados da lignina-ácido tioglicólico aumentou depois dos 20 dai para as duas cultivares supridas com Si. Atividade da peroxidas e aumentou até os 25 dai e os 10 dai para as plantas das cultivares BRS Buriti e FM 993 supridas com Si, respectivamente. A atividade da quitinase aumentou até 10 dai para as plantas da cultivar BRS Buriti e aos 10 e 20 dai para as plantas da cultivar supridas com Si. A atividade da glucanase aumentou até os 10 dai para as plantas da cultivar BRS Buriti supridas com Si e até os 20 dai para as plantas da cultivar FM 993 supridas com Si. Em conclusão, o suprimento de Si contribuiu para aumentar a resistência do algodoeiro à ferrugem devido à maior atividade das enzimas de defesa.

The inventions technology on water resources to support environmental engineering based infrastructure

Science.gov (United States)

Sunjoto, S.

2017-03-01

Since the Stockholm Declaration, declared on the United Nation Conference on the Human Environment in Sweden on 5-16 June 1972 and attended the 113 country delegations, all the infrastructure construction should comply the sustainable development. As a consequence, almost research and studies were directing to the environmental aspect of construction including on water resources engineering. This paper will present the inventions which are very useful for the design of infrastructure, especially on the Groundwater engineering. This field has been rapidly developed since the publication of the well known law of flow through porous materials by Henri Darcy in 1856 on his book "Les fontaine publiques de la ville de Dijon". This law states that the discharge through porous media is proportional to the product of the hydraulic gradient, the cross-sectional area normal to the flow and the coefficient of permeability of the material. Forchheimer in 1930 developed a breakthrough formula by simplifying solution in a steady state flow condition especially in the case of radial flow to compute the permeability coefficient of casing hole or tube test with zero inflow discharge. The outflow discharge on the holes is equal to shape factor of tip of casing (F) multiplied by coefficient of permeability of soils (K) and multiplied by hydraulic head (H). In 1988, Sunjoto derived an equation in unsteady state flow condition based on this formula. In 2002, Sunjoto developed several formulas of shape factor as the parameters of the equation. In the beginning this formula is implemented to compute for the dimension of recharge well as the best method of water conservation for the urban area. After a long research this formula can be implemented to compute the drawdown on pumping or coefficient of permeability of soil by pumping test. This method can substitute the former methods like Theis (1935), Cooper-Jacob (1946), Chow (1952), Glover (1966), Papadopulos-Cooper (1967), Todd (1980

Efecto de plantaciones de pino en la artropofauna del suelo de un bosque Altoandino

Directory of Open Access Journals (Sweden)

Alba Lucía León-Gamboa

2010-09-01

Full Text Available Los artrópodos del suelo son un componente fundamental de los ecosistemas de bosque, ya que participan en la fragmentación de los residuos orgánicos previa a la descomposición. Esta función es más valuable en ambientes de altura, donde las bajas temperaturas limitan la dinámica de los procesos biológicos. Sin embargo, uno de los problemas más comunes en las montañas colombianas ha sido el reemplazo de vegetación nativa por plantaciones de pino. Los efectos sobre los artrópodos del suelo aún son poco conocidos. En un remanente de bosque Altoandino (Embalse del Neusa-Colombia con una plantación adyacente de unos 50 años (aprox. 900 has, fue evaluada la composición, riqueza y abundancia de artrópodos en los estratos superficial (S orgánico (O y mineral (A del suelo, para establecer las diferencias asociadas con la transformación del uso del suelo. Se utilizaron trampas "Pitfall" para registrar el movimiento de fauna epígea, y embudos Berlese para estimar la densidad de fauna de los horizontes O y A. Se calcularon los índices de Shannon y Simpson para estimar la diversidad en diferentes lugares y horizontes, además fue evaluada la estructura trófica de la comunidad. Se recolectaron 38 306 individuos en el bosque y 17 386 en la plantación, principalmente distribuidos en los taxa Collembola, (42.4%, Acari (27%, Diptera (17.6% y Coleoptera (4.6%. Las diferencias más importantes se dieron en la superficie, donde la movilización en bosque (86 individuos/día casi triplicó la movilización en la plantación (33 individuos/día. Las diferencias en la composición se dieron en los taxa Collembola, Araneae, Hemiptera, Homoptera e Hymenoptera. La dinámica de la riqueza y abundancia a lo largo del año tuvo picos significativos en el bosque, no observados en la plantación. La estructura trófica fue dominada por saprófagos (75%, depredadores (14% y fitófagos (9%, pero en dos estratos de la plantación de pino (S y O no se dio

Occurrence of Diaretiella rapae (Mc´Intosh, 1855 (Hymenoptera: Aphidiidae Parasitising Lipaphis erysimi (Kaltenbach, 1843 and Brevicoryne brassicae (L. 1758 (Homoptera: Aphididae in Brassica napus in Mato Grosso do Sul

Directory of Open Access Journals (Sweden)

Mussury Rosilda Mara

2002-01-01

Full Text Available The occurrence of Diaretiella rapae parasitising Lipaphis erysimi and Brevicoryne brassicae in canola field (Brassica napus was evaluated through two sample methods in Dourados-MS. The methods, used weekly, were: entomologic sweep net and plants sacking. The aphids population was observed from initial to the senescence plant development. Aphids were more abundant during the flowering phase, and they were usually located in the stems of the inflorescence and development fruits. In this phase the largest parasitism level for D. rapae (89,7% occurred. The sample method with a sweep net captured significantly (t=4,484, P <= 0,01 more D. rapae while sacking method captured more parasitise aphids (t=2,199 with P <= 0,05 and active aphids (t=3,513, P <= 0,01.

[Characteristics of floor litter and soil arthropod community in different types ot subtropical forest in Ailao Mountain of Yunnan, Southwest China].

Science.gov (United States)

Yang, Zhao; Yang, Xiao-Dong

2011-11-01

By using line transect method, an investigation was conducted on the floor litter and soil arthropod community in a mid mountain wet evergreen broad-leaved forest, a mossy dwarf forest, and a Populus bonatii forest in Ailao Mountain of Yunnan in April (dry and hot season), June (rainy season), and December (dry and cold season), 2005. In both dry and rainy seasons, the existing floor litter mass, C storage, and C/N ratio in the three forests all increased in the order of mossy dwarf forest > P. bonatii forest > evergreen broad-leaved forest, but the N storage had less difference. In the floor litter layer of the forests, Acari and Collembola were the dominant groups of soil arthropod community, while Diptera larvae, Coleoptera, ants, and Homoptera were the common groups. The Sorenson coefficients of soil arthropod community in the three forests were extremely great. No significant differences were observed in the soil arthropod density (ind x m(-2)) in the floor litter layer among the three forests, but the relative density (ind x g(-1)) of soil arthropods was higher in the evergreen broad-leaved forest and P. bonatii forest than in the mossy dwarf forest. In the three forests, the density of soil arthropods was significantly higher in dry season than in rainy season, but the Shannon diversity index had less difference. There were significant positive correlations between the existing floor litter mass and the individual density (ind x m(-2)) and dominant groups of soil arthropod communities in dry and hot season (April), but negative correlations between the existing floor litter mass and the relative density (ind x g(-1)) of soil arthropod communities and Acari in dry and cold season (December). The individual densities of Collembola and Coleoptera also had positive correlations with the N storage of the existing floor litter mass in the three forests. It was considered that the floor litter and the development of soil arthropod community in the litter layer of

What is the phylogenetic signal limit from mitogenomes? The reconciliation between mitochondrial and nuclear data in the Insecta class phylogeny

Directory of Open Access Journals (Sweden)

Talavera Gerard

2011-10-01

Full Text Available Abstract Background Efforts to solve higher-level evolutionary relationships within the class Insecta by using mitochondrial genomic data are hindered due to fast sequence evolution of several groups, most notably Hymenoptera, Strepsiptera, Phthiraptera, Hemiptera and Thysanoptera. Accelerated rates of substitution on their sequences have been shown to have negative consequences in phylogenetic inference. In this study, we tested several methodological approaches to recover phylogenetic signal from whole mitochondrial genomes. As a model, we used two classical problems in insect phylogenetics: The relationships within Paraneoptera and within Holometabola. Moreover, we assessed the mitochondrial phylogenetic signal limits in the deeper Eumetabola dataset, and we studied the contribution of individual genes. Results Long-branch attraction (LBA artefacts were detected in all the datasets. Methods using Bayesian inference outperformed maximum likelihood approaches, and LBA was avoided in Paraneoptera and Holometabola when using protein sequences and the site-heterogeneous mixture model CAT. The better performance of this method was evidenced by resulting topologies matching generally accepted hypotheses based on nuclear and/or morphological data, and was confirmed by cross-validation and simulation analyses. Using the CAT model, the order Strepsiptera was recovered as sister to Coleoptera for the first time using mitochondrial sequences, in agreement with recent results based on large nuclear and morphological datasets. Also the Hymenoptera-Mecopterida association was obtained, leaving Coleoptera and Strepsiptera as the basal groups of the holometabolan insects, which coincides with one of the two main competing hypotheses. For the Paraneroptera, the currently accepted non-monophyly of Homoptera was documented as a phylogenetic novelty for mitochondrial data. However, results were not satisfactory when exploring the entire Eumetabola, revealing the

The phytosanitary form and fighting measures diseases and pests of sugar beet from Republic of Moldova

Directory of Open Access Journals (Sweden)

Timus Asea M.

2006-01-01

Full Text Available Sugar beet is one of the most important agricultural crops in the Republic of Moldova. The North and Central regions have good enough pedoclimatic conditions. The genetic potential of sorts and hybrids can be created through the application of modern technologies in order to grow at least 32-35 tons/ha of sugar beet roots. In the Republic of Moldova, sugar beet vegetates between 160 and 180 days in the first year and needs approximately an amount of 2400-2900°C, average of 15.3-15.4°C. Each phenological phase needs different temperatures: at least 4C° is necessary for planting and springing an amount of 650°C is necessary for foliar apparatus; an amount of 1150- 1800°C is necessary to grow the volume of roots and for sugar depositing the average of 2400 to 2600°C is necessary. The mentioned temperatures ensure a normal development of sugar beet plants. If these temperatures fluctuate, the pathogens and pests are stimulated to develop. The most frequent diseases of sugar beet are: Pythium de baryanum Hesse., Aphanomyces cochlioides Dresch. Peronospora schachtii Fuck., Phoma betae Fr. Cercospora beticola Sacc. Erysiphe communis Grev. f. betae Jacz., virosis - Beta virus 2, 3 si 4 etc. The main pests belong to the following categories: Homoptera: Aphis fabae Scop. (fam. Aphididae, Pemphigus fuscicornis Koch. (fam. Pemphigidae Coleoptera: Agriotes sp. (fam. Elateridae, Chaetocnema concinna M. Ch. breviuscula Fld., Cassida nebulosa L. (fam. Chrysomelidae, Atomaria linearis Step. (fam. Cryptophagidae; Bothynoderes punctiventris Germ., Tanymechus dilaticollis Gyll., T. palliatus F., Psalidium maxillosum F. (Curculionidae; Lepidoptera: Agrotis segetum Den. et Schiff., Authographa gamma L. Mamestra (Barathra brassicae L. (Noctuidae, Loxostege sticticalis L. (Pyralidae, Gnorimoschema ocellatella Boyd.; Diptera Pegomyia betae Curtis. (fam. Anthomyidae. Heterodera schachtii Schmidt (Heteroderidae. The most recommended insecticides for fighting the

Contribución al conocimiento de las interacciones entre plantas, hormigas y homópteros en bosques secos de Colombia

Directory of Open Access Journals (Sweden)

Ramírez Mónica

2001-12-01

Full Text Available Las interacciones entre plantas y hormigas y entre plantas, hormigas y homópteros se estudiaron en 248 estaciones de muestreo situadas en nueve fragmentos de bosque seco del valle geográfico del río Cauca, entre enero y junio de 1997. Se registraron 352 interacciones que involucran 91 especies vegetales, hormigas de 67 especies y homópteros pertenecientes a nueve familias. El 4 7% de las asociaciones registradas implica el uso por parte de las hormigas de diferentes estructuras de las plantas (p. e. raíces de las epífitas, domacios en los tallos, hojarasca acumulada entre ramas y hojas, brácteas y peciolos de Heliconia spp. como refugios temporales o sitios de anidamiento. El restante 53% involucra la recolección de miel de homópteros y de sustancias azucaradas en nectarios extraflorales. asmannia auropunctata (17%, Dolichoderus bispinosus (11% Y Brachymyrmex heeri (7% fueron las especies de hormigas registradas con mayor frecuencia. Las plantas más utilizadas fueron Heliconia stricta (8%, Philodendron sp. nov. (7% y Passiflora coriacea (5%. Entre las relaciones observadas, predominan las de tipo generalista, en que las hormigas explotan diferentes recursos aparentemente en forma oportunista y las plantas pueden encontrarse en buen estado a pesar de la ausencia de las hormigas.Interactions between ants and plants and those involving homopterans were studied in 248 sampling points located within nine tropical decidous forest fragments in the Cauca river Valley, between january and june, 1997. A total of 352 interactions were recorded involving 91 plant species, 67 ant species and Homoptera belonging to nine families. 47% ofthe interactions involved ants using different plant structures (such as epiphyte roots, domacia, litter collected in branches and leaves, bracts and petioles of Heliconia spp. as nesting sites or temporary refugia. The remaining 53% involved the collection of homopteran honeydew and sugary substances from extrafloral

贵州斑大叶蝉属三新种(同翅目：大叶蝉科)%THREE NEW SPECIES OF THE GENUS ANATKINA FROM GUIZHOU PROVINCE,CHINA(HOMOPTERA:CICADELLIDAE)

Institute of Scientific and Technical Information of China (English)

杨茂发; 李子忠

2001-01-01

In this paper three new species of the genus Anatkina are described from Guizhou,China.All the type specimens are deposited in the Agricultural College of Guizhou University. 1　Anatkina livimacula sp.nov.　(Figs.1-7) 　　Length(incl.teg.):♂ 9.6?mm,♀9.0-9.3?mm. 　　This species resembles A.xanthomacula Kuoh in appearance,but can be distinguished from the latter by its crown with three distinct black markings;pronotum with four or two brown spots near anterior margin and a transverse black band in posterior portion;scutellum uniform black;forewing red with a blue marking on claval base and a pink marking in middle part of costal area;the shape of male pygofer process,subgenital plate,aedeagus and style also distinctly different. 　　Holotype ♂,Guizhou:Maolan(25°30′N,108°10′E),30 May 1998,collected by LI Zi-Zhong.Paratype 1♀,same location as holotype,18 May 1995,by CHEN Xiang-Sheng;1♀,Guizhou:Ziyun,18 Jul. 1988,by WEI Lian-Meng. 2　Anatkina rubipennis sp.nov.　(Figs.8-16) 　　Length (incl.teg.):♂ 13.2?mm. 　　This species is similar to A.nigriventris Li,but can be easily distinguished from the latter by the pronotum black-brown without distinct black spots;forewing dark red with a black spot in base of clavus and confluent dark markings bordering base of apical cells;the end of male paraphysis furcate,pygofer process smooth,subgenital plate curved abruptly dorsad with macrosetae not uniseriate. 　　Holotype ♂,Guizhou:Maolan (25°30′N,108°10′E)，19 May 1995,collected by CHEN Xiang-Sheng. 3　Anatkina bistriata sp.nov.　(Figs.17-25) 　　Length (incl.teg.):♂10.0?mm-10.6?mm,♀10.0?mm. 　　This species has unique colour pattern on head and pronotum,forewing black with two red stripes in basal half,which are different from those of any other species of the genus. 　　Holotype ♂,Guizhou:Maolan(25°30′N,108°10′E),21 May 1995,by CHEN Xiang-Sheng.Paratypes 2 ♂♂,1♀,same data as holotype.%记述斑大叶蝉属Anatkina Young 3新种，即蓝斑大叶蝉A.livimacula sp.nov.;红翅斑大叶蝉A.rubipennis sp.nov.;双条斑大叶蝉A.bistriata sp.nov.,模式标本保存在贵州大学农学院。

Effect of an alternate weed host, hairy nightshade, Solanum sarrachoides, on the biology of the two most important potato leafroll virus (Luteoviridae: Polerovirus) vectors, Myzus persicae and Macrosiphum euphorbiae (Aphididae: Homoptera).

Science.gov (United States)

Srinivasan, Rajagopalbabu; Alvarez, Juan M; Bosque-Pérez, Nilsa A; Eigenbrode, Sanford D; Novy, Richard G

2008-04-01

Hairy nightshade, Solanum sarrachoides (Sendtner), is a ubiquitous weed in potato agro-ecosystems and nonagricultural lands of southeastern Idaho and the Pacific Northwest. This weed increases the complexity of the Potato leafroll virus (PLRV) (Luteoviridae: Polervirus)-potato pathosystem by serving as aphid and virus reservoir. Previous field studies showed higher densities of green peach aphid, Myzus persicae (Sulzer), and potato aphid, Macrosiphum euphorbiae (Thomas), the two most important vectors of PLRV, on S. sarrachoides compared with potato plants in the same fields. Some of the S. sarrachoides plants sampled in these surveys tested positive for PLRV. Viral infections can alter the physiology of plant hosts and aphid performance on such plants. To understand better the potential effects of S. sarrachoides on the PLRV-potato-aphid pathosystem, the life histories of M. persicae and M. euphorbiae were compared on virus-free and PLRV-infected S. sarrachoides and potato. Individual nymphs of each aphid species were held in clip cages on plants from each treatment to monitor their development, survival, and reproductive output. Nymphal survival for both aphids across plant species was higher on S. sarrachoides than on potato, and, within plant species, it was higher on PLRV-infected plants than on noninfected plants. With a few exceptions, similar patterns occurred for fecundity, reproductive periods, adult longevity, and intrinsic rate of increase. The enhanced performance of aphids on S. sarrachoides and on PLRV-infected plants could alter the vector population dynamics and thus the PLRV-disease epidemiology in fields infested with this weed.

Spatial and temporal variability of thermohaline properties in the Bay of Koper (northern Adriatic Sea)

Science.gov (United States)

Soczka Mandac, Rok; Žagar, Dušan; Faganeli, Jadran

2013-04-01

suspended matter. Additionally, we will investigate the cross correlations between the above mentioned parameters with singular value decomposition method. Reference: 1. Faganeli, J., Planinc, R., Pezdic, J., Smodis, B., Stegnar, P., and Ogorelec, B. 1991. Marine geology of Gulf of Trieste (northern Adriatic): Geochemical aspects. Marine Geology, 99: 93-108. 2. Glover, M., Jenkins, J., and Doney, S. C. 2011. Modeling methods for marine science. Cambridge University Press, 571 p.

Effectiveness of two insect growth regulators against Bemisia tabaci (Gennadius) (Homoptera: Aleyrodidae) and Helicoverpa armigera (Hübner) (Lepidoptera: Noctuidae) and their impact on population densities of arthropod predators in cotton in Pakistan.

Science.gov (United States)

Gogi, Muhammad D; Sarfraz, Rana M; Dosdall, Lloyd M; Arif, Muhammad J; Keddie, Andrew B; Ashfaq, Muhammad

2006-10-01

Field efficacies of two insect growth regulators (IGRs) at two recommended application rates, buprofezin at 370 and 555 g AI ha(-1) and lufenuron at 37 and 49 g AI ha(-1), were determined against the sweet potato whitefly, Bemisia tabaci (Gennadius), and the cotton bollworm, Helicoverpa armigera (Hübner), in experimental plots of cotton at the Directorate of Cotton Research, Faisalabad, Pakistan. Adverse effects of the IGRs on populations of associated arthropod predators, namely geocorids, chrysopids, coccinellids, formicids and arachnids, were also assessed. Both IGRs significantly reduced populations of B. tabaci at each application rate 24, 48 and 72 h after treatment, and higher doses were more effective than lower doses. Buprofezin was not effective against H. armigera at any tested dose for any time of treatment in any spray. Lufenuron applied at 37 and 49 g AI ha(-1) effectively suppressed H. armigera populations, resulting in significant reductions in crop damage. At lower doses, both IGRs appeared safe to predator populations, which did not differ significantly in IGR-treated versus untreated control plots. Population densities of formicids and coccinellids were significantly lower at high concentrations of both IGRs in treatment plots, possibly as a result of reduced prey availability. The potential role of buprofezin and lufenuron for control of B. tabaci and H. armigera in a spray programme and the likelihood of direct toxic effects of IGRs on predatory fauna of cotton are discussed.

Study of microarthropod communities to assess soil quality in different managed vineyards

Science.gov (United States)

Gagnarli, Elena; Vignozzi, Nadia; Valboa, Giuseppe; Bouneb, Mabrouk; Corino, Lorenzo; Goggioli, Donatella; Guidi, Silvia; Lottero, Mariarosa; Tarchi, Franca; Simoni, Sauro

2014-05-01

conventional/IPM management). The mites represented about 50% of the arthropodofauna recorded, collembolans 30%, and 20% other microarthropods (Blattaria, Chilopoda, Coleoptera, Diplopoda, Diplura, Diptera, Hemiptera, Hymenoptera, Isopoda, Homoptera, Pauropoda, Protura, Pseudoscopionida, Psocoptera, Symphyla, Thysanoptera). The mesofauna abundance was affected by the type of management (P=0.015) and soil texture (P=0.029). At the identification level considered, the biological indices calculated showed no substantial differences between different crop managements (H'=1.26, D=0.97 in organic vineyard, H'=1.30, D=0.89 in IPM vineyard). The analysis of microarthropod communities by QBSar, however, showed higher values in organic compared to IPM managed vineyards (QBSar 199 vs 98 in 2011 and 205 vs 188 in 2012, respectively) which are close to figures characteristic of preserved soils.

Opportunities and challenges at the interface between petrochemistry and refinery. Preprints

Energy Technology Data Exchange (ETDEWEB)

Ernst, S.; Leitner, W.; Lercher, J.A.; Nees, F.; Perego, C.; Rupp, M.; Santacesaria. E. (eds.)

2007-07-01

Within the DGMK/SCI-Conference 'Opportunities and Challenges at the Interface between Petrochemistry and refinery' between 10th and 12th October, 2007, in Hamburg (Federal Republic of Germany) the following lectures were held: (a) Maximizing petrochemicals from refineries (B. Glover, T. Foley, S. Frey); (b) Opportunities and challenges at the interface between petrochemistry and refinery - the OMV view (J. Lichtscheidl); (c) Aspects of petrochemistry in a fuels refinery (J. Essler, J. Mielicke, T. Maier); (d) Enhanced propylene production in FCC by novel catalytic materials (C.P. Kelkar, D. Harris, M. Xu, J. Fu); (e) Retrofit of an MTBE-unit to ETBE (A. Rix, U. Peters); (f) Opportunities and challenges at the interface between petrochemistry and refinery - The BASF perspectives (H.-J. Blankertz); (g) Light olefins - challenges from new production routes? (H. Zimmermann); (h) Conversion of heavy aromatic hydrocarbons to valuable synthetic feed for steamcrackers (A. Cesana, L. Dalloro, F. Rivetti, R. Buzzoni, R. Bignazzi); (i) C{sub 4} olefin/paraffin separation over the metal organic framework material Cu{sub 3}BTC{sub 2} (S. Kunz, O. Tangermann, M. Hartmann); (j) Glycerol tertiary butyl ethers via etherification of glycerol with isobutene (A. Behr); (k) Biorefineries: From concepts to reality? (K. Wagemann); (l) Modern concepts in reactor and separation technologies (D. Agar); (m) Innovative reactive distillation process for the production of the MTBE substitute isooctane from isobutene (M. Chalakova, R. Kaur, H. Freund, S. Mahajani, K. Sundmacher); (n) Supported ionic liquid phase (SILP) systems - novel fixed bed reactor concepts for homogeneous catalysis (A. Riisager, R. Fehrmann, M. Haumann, M. Jakuttis, J. Joni, P. Wasserscheid); (o) Selective oxidations to industrial intermediates (S. Schunck); (p) Perspectives of industrial realization for propane oxidative dehydrogenation over chromium oxide catalysts (A.L. Lapidus, N.A. Gaidai, Yu. A. Agafonov, M

Reconnecting Thomas Gann with British Interest in the Archaeology of Mesoamerica: An Aspect of the Development of Archaeology as a University Subject

Directory of Open Access Journals (Sweden)

Colin Wallace

2011-05-01

Full Text Available ‘He [Thomas Gann] was lecturer in Central American archaeology at the University of Liverpool (1919–1938, and adviser to the British Museum expeditions to British Honduras’ (Dictionary of National Biography 1931–1940 [1949]: 306.Thus wrote the great archaeologist of the Maya, Sir John Eric Thompson (1898–1975, who knew Thomas Gann, the subject of this paper, from around 1926 until his death, and memorialised him elsewhere in the 'Boletín Bibliográfico de Antropología Americana'(Thompson 1940 and the 'British Medical Journal'(Thompson 1975. Curiously, all published sources, including Thompson, are seriously mistaken about Gann’s Liverpool connection, wrongly dating it to the period when it was inactive or had lapsed. Thus, ‘from 1919 to 1938 Gann was Lecturer in Central American Archaeology at Liverpool University, the first Americanist ever to hold a university position in Britain. I have never come across anyone who went to his lectures (I am not even sure if he gave any and he seems to have trained no students’ (Bray 1994: 6; cf. also Bray and Glover 1987: 119. I shall offer some new archival evidence to correct this. We shall also see that Bray’s conception of Gann as a British, university, ancestor, if an odd one, is unhelpful (but understandable; Gann’s position says as much about the atmosphere of the early years at Liverpool University (Freeman 'In preparation'; James 'In preparation' as it does about the study of Ancient America in Britain during the first few decades of the twentieth century. Recent historical research in the School of Archaeology, Classics and Egyptology at Liverpool (the direct descendant of the Institute of Archaeology with which Gann was connected, by Mac James, our supervisor Dr Philip Freeman and myself, has included exploring the papers of Francis Chatillon Danson, an important early supporter of the Institute. The following paper is based on the Danson papers, now in National Museums

Implementation of Digital Awareness Strategies to Engage Patients and Providers in a Lung Cancer Screening Program: Retrospective Study.

Science.gov (United States)

Jessup, Dana L; Glover Iv, McKinley; Daye, Dania; Banzi, Lynda; Jones, Philip; Choy, Garry; Shepard, Jo-Anne O; Flores, Efrén J

2018-02-15

after the digital awareness campaigns and the number of exams scheduled before and after the digital awareness campaigns being statistically significant (Pdigital awareness campaigns was associated with increased visits to institutional educational Web pages and scheduled LDCT exams. Digital platforms are an important tool to enhance health promotion activities and engagement with patients and providers. ©Dana L Jessup, McKinley Glover IV, Dania Daye, Lynda Banzi, Philip Jones, Garry Choy, Jo-Anne O Shepard, Efrén J Flores. Originally published in the Journal of Medical Internet Research (http://www.jmir.org), 15.02.2018.

Stimulation des défenses naturelles par l’application d’un Lombricompost. Effet sur les paramètres populationnels d’Aphis fabae scop. (Homoptera: Aphididae et la qualité Phytochimique de la fève

Directory of Open Access Journals (Sweden)

Zahr-Eddine Djazouli

2017-06-01

Full Text Available Chaichi, W. Djazouli, Z. Djemai, I. Abdelkader, S. Ribera, I. and Nancé, J. 2017. Stimulation of natural defences by the application of lombricompost. Effect on the Aphis fabae scop. (Homoptéra: Aphididae population and phytochemical quality of faba bean. Lebanese Science Journal, 18(1: 81-97. The integrated production in durable agriculture aims to improve the efficiency of biological inputs through formulations extending the remanence in the field or the incorporation of synergistic products which, being themselves nontoxic at used quantities, increase the protective action of the viabe cultivations. The lombricultivation represents an appropriate technology to enhance the value of the farm residues and manage, on a long term basis, plant health. The study focused on the stimulation of natural defenses of bean through the use of a lombricompost dilutions produced in two different seasons. The effect of lombricompost has been evaluated based on the Aphis fabae population density in relation to the phytochemical quality of the nutritional support. Variations of biochemical molecule contents and major mineral elements during the leaf expanding phase have been noticed. These changes affect the biological performance as well as the density of A. fabae population. The results allowed detecting a positive effect of lombricompost on plant chemistry. On the other hand, enrichment in proteins and proline under the effect of strong dilution was noticed. Finally, results related to the repressive effect of the different forms of lombricompost showed a marked difference between treatments and the control, with a stronger effect on the winged forms. Results also indicated some variability of the Aphis Fabae populational structure in relation to the phytochemical enrichments established by the application of lombricompost.

Efecto de plantaciones de pino en la artropofauna del suelo de un bosque Altoandino

Directory of Open Access Journals (Sweden)

Alba Lucía León-Gamboa

2010-09-01

Full Text Available Los artrópodos del suelo son un componente fundamental de los ecosistemas de bosque, ya que participan en la fragmentación de los residuos orgánicos previa a la descomposición. Esta función es más valuable en ambientes de altura, donde las bajas temperaturas limitan la dinámica de los procesos biológicos. Sin embargo, uno de los problemas más comunes en las montañas colombianas ha sido el reemplazo de vegetación nativa por plantaciones de pino. Los efectos sobre los artrópodos del suelo aún son poco conocidos. En un remanente de bosque Altoandino (Embalse del Neusa-Colombia con una plantación adyacente de unos 50 años (aprox. 900 has, fue evaluada la composición, riqueza y abundancia de artrópodos en los estratos superficial (S orgánico (O y mineral (A del suelo, para establecer las diferencias asociadas con la transformación del uso del suelo. Se utilizaron trampas "Pitfall" para registrar el movimiento de fauna epígea, y embudos Berlese para estimar la densidad de fauna de los horizontes O y A. Se calcularon los índices de Shannon y Simpson para estimar la diversidad en diferentes lugares y horizontes, además fue evaluada la estructura trófica de la comunidad. Se recolectaron 38 306 individuos en el bosque y 17 386 en la plantación, principalmente distribuidos en los taxa Collembola, (42.4%, Acari (27%, Diptera (17.6% y Coleoptera (4.6%. Las diferencias más importantes se dieron en la superficie, donde la movilización en bosque (86 individuos/día casi triplicó la movilización en la plantación (33 individuos/día. Las diferencias en la composición se dieron en los taxa Collembola, Araneae, Hemiptera, Homoptera e Hymenoptera. La dinámica de la riqueza y abundancia a lo largo del año tuvo picos significativos en el bosque, no observados en la plantación. La estructura trófica fue dominada por saprófagos (75%, depredadores (14% y fitófagos (9%, pero en dos estratos de la plantación de pino (S y O no se dio

Use Google Scholar, Scopus and Web of Science for Comprehensive Citation Tracking. A review of: Bakkalbasi, Nisa, Kathleen Bauer, Janis Glover and Lei Wang. “Three Options for Citation Tracking: Google Scholar, Scopus and Web of Science.” Biomedical Digital Libraries 3.7 (2006.

Directory of Open Access Journals (Sweden)

Lorie A. Kloda

2007-09-01

Full Text Available Objective – To determine whether three competing citation tracking services result in differing citation counts for a known set of articles, and to assess the extent of any differences.Design – Citation analysis, observational study.Setting – Three citation tracking databases: Google Scholar, Scopus and Web of Science. Subjects – Citations from eleven journals each from the disciplines of oncology and condensed matter physics for the years 1993 and 2003.Methods – The researchers selected eleven journals each from the list of journals from Journal Citation Reports 2004 for the categories “Oncology” and “Condensed Matter Physics” using a systematic sampling technique to ensure journals with vary ingimpact factors were included. All references from these 22 journals were retrieved for the years 1993 and 2003 by searching three databases: Web of Science, INSPEC, and PubMed. Only research articles were included for the purpose of the study. From these, a stratified random sample was created to proportionally represent the content of each journal (oncology 1993: 234 references, 2003: 259 references; condensed matter physics 1993: 358 references, 2003: 364 references. In November of 2005, citations counts were obtained for all articles from Web of Science, Scopus and GoogleScholar. Due to the small sample size and skewed distribution of data, non‐parametric tests were conducted to determine whether significant differences existed between sets.Main Results – For 1993, mean citation counts were highest in Web of Science for both oncology (mean = 45.3, SD = 77.4 and condensed matter physics (mean = 22.5, SD= 32.5. For 2003, mean citation counts were higher in Scopus for oncology (mean = 8.9,SD = 12.0, and in Web of Science for condensed matter physics (mean = 3.0, SD =4.0. There was not enough data for the set of citations from Scopus for condensed matter physics for 1993 and it was therefore excluded from analysis. A Friedman test to measure for differences between all remaining groups suggested a significant difference existed, and so pairwise post‐hoc comparisons were performed. The Wilcoxon Signed Ranked tests demonstrated significant differences “in citation counts between all pairs (p Conclusion – The study does not confirm the authors’ hypothesis that differing scholarly coverage would result in different citation counts from the three databases. While there were significant differences in mean citation rates between all pairs of databases except for Google Scholar and Scopus in condensed matter physics for 2003, no one database performed better overall. Different databases performed better for different subjects, as well as for different years, especially Scopus, which only includes references starting in 1996. The results of this study suggest that the best citation database will depend on the years being searched as well as the subject area. For a complete picture of citation behaviour, the authors suggest all three be used.

Book reviews

Directory of Open Access Journals (Sweden)

Redactie KITLV

2009-05-01

�� and sails the boat downstream: Malay Sufi poems of the boat (Suryadi Gilles Gravelle; Meyah: An east Bird’s Head language of Papua, Indonesia (Ian Tupper Penny Edwards; Cambodge: The cultivation of a nation, 1860-1945 (Un Leang J. Stephen Lansing; Perfect order: Recognizing complexity in Bali (Carol Warren Roxana Waterson (ed.; Southeast Asian lives: Personal narratives and historical experience (C.W. Watson Jean DeBernardi; The way that lives in the heart: Chinese popular religion and spirit mediums in Penang, Malaysia (Robert Wessing REVIEW ESSAY Environmental and archaeological perspectives on Southeast Asia Peter Boomgaard; Southeast Asia: An environmental history Peter Boomgaard (ed.; A world of water: Rain, rivers and seas in Southeast Asian histories Ian Glover and Peter Bellwood (eds; Southeast Asia: From prehistory to history Avijit Gupta (ed.; The physical geography of Southeast Asia (Eric C. Thompson

A survey of homopteran species (Auchenorrhyncha from coffee shrubs and poró and laurel trees in shaded coffee plantations, in Turrialba, Costa Rica

Directory of Open Access Journals (Sweden)

Liliana Rojas

2001-12-01

Full Text Available Asurvey of homopteran species (Auchenorryncha was conducted in coffee plantations with no shade (C, and in those with shade of either poró (Erythrina poeppigiana (CP or poró plus laurel (Cordia alliodora (CPL, in Turrialba, Costa Rica. A total of 130 species in ten families were collected, dominated by Cicadellidae (82 species. Species richness was highest in the CP system (88, followed by CPL (74 and C systems (60. Five most common species for all systems were Fusigonalia lativittata, Hebralebra nicaraguensis, Neocoelidia sp., Oliarus sp. and Clastoptera sp. Diversification of the coffee agroecosystem favors some species while limiting others, and have no effect on the majority of species. Thus, only F. lativittata, Neocoelidia sp. and Scaphytopius ca. latidens were well represented in all systems, but were more abundant in coffee shrubs. Additionally, the following were the dominant species in each system: Graphocephala sp. 1 (C, F. lativittata (CP and H. nicaraguensis (CPL. Four species abundant on laurel trees, including H. nicaraguensis, appeared almost exclusively on these tree species. Species similarity was highest on the CP and CPL systems (51 % of the species in common, followed by the C and CP (39 % and the C and CPL systems (38 %. These findings show that even disturbed systems can harbor many insect species, so that they deserve attention from conservation advocatesand biologistsEn Turrialba, Costa Rica, se efectuó un inventario de especies de chicharritas (Homoptera: Auchenorryncha en plantaciones de café sin sombra (C, así como en café asociado con árboles de poró (Erythrina poeppigiana (CP o de poró y laurel (Cordia alliodora (CPL. Se recolectaron 131 especies, pertenecientes a diez familias, entre las cuales predominó Cicadellidae (82 especies. La riqueza de especies fue mayor para el sistema CP (88 especies, seguido por CPL y C, con 74 y 60 especies, respectivamente. Las cinco especies más comunes para los tres

Intensidade da ramulose sob semeadura convencional e direta do algodoeiro Ramulosis intensity under conventional and no-tillage cotton crop systems

Directory of Open Access Journals (Sweden)

Daniela Kubiak de Salvatierra

2009-01-01

Full Text Available Foram realizados em Piracicaba (SP, em 2004/05 e 2005/06, experimentos com o algodoeiro (Gossypium hirsutum L. var. latifolium Hutch, sob preparo do solo e semeadura convencional; e ausência de preparo do solo com semeadura sobre palhada de milheto, com o objetivo de avaliar as modificações microclimáticas (temperatura e duração do período de molhamento-DPM, decorrentes da utilização da palhada de milheto, no desenvolvimento da ramulose (Colletotrichum gossypii South. var. cephalosporioides Costa do algodoeiro. Foi utilizado também um índice de favorabilidade temperatura-molhamento (IF-tm para a ramulose do algodoeiro, para avaliar o desenvolvimento da doença nos dois sistemas de semeadura. Os dados climáticos foram medidos por uma plataforma de aquisição de dados sob o dossel das plantas e na região central da área experimental. A ramulose foi avaliada por escala de notas (1 a 5 e as médias das notas analisadas estatisticamente. Alterações no progresso da doença foram observadas, com ocorrência mais severa no sistema convencional de semeadura, porém não podendo ser atribuídas às variações na temperatura e DPM, consideradas isoladamente, mas decorrente de interações entre estas e a precipitação pluvial. O IF-tm teve boa relação com o aumento da severidade da doença, e a diferença, observada em maior proporção no sistema convencional de semeadura, ocorreu em períodos cujos valores de IF-tm foram altos, associados a períodos com chuvas e fase de maior suscetibilidade das plantas ao patógeno. Com IF-tm menores que 0,500 não se observa aumento efetivo da severidade da ramulose em quaisquer sistema de semeadura.During the years of 2004/05 and 2005/06, in Piracicaba, State of São Paulo, experiments were carried out with cotton crop under conventional tillage seeding and no-tillage. The seeding was performed over the mulching of millet, with the objective to evaluate if such mulching could interfere on

Evaluation of Thermal Oxidative Aging Effect on the Rheological Performance of Modified Asphalt Binders

Science.gov (United States)

Zhu, Cheng

Modified asphalt binder, which is combined by base binder and additive modifier, has been implemented in pavement industry for more than 30 years. Recently, the oxidative aging mechanism of asphalt binder has been studied for several decades, and appreciable finding results of asphalt binder aging mechanism were achieved from the chemistry and rheological performance aspects. However, most of these studies were conducted with neat binders, the research of aging mechanism of modified asphalt binder was limited. Nowadays, it is still highly necessary to clarify how the asphalt binder aging happens with the modified asphalt binder, what is the effect of the different modifiers (additives) on the binder aging process, how the rheological performance changes under the thermal oxidative aging conditions and so on. The objective of this study was to investigate the effect of isothermal oxidative aging conditions on the rheological performance change of the modified and controlled asphalt binders. There were totally 14 different sorts of asphalt binders had been aged in the PAV pans in the air-force drafted ovens at 50°C, 60°C and 85°C for 0.5 day to 240 days. The Fourier-Transform Infrared Spectroscopy (FT-IR) and Dynamic Shear Rheometer (DSR) were used to perform the experiments. The analysis of rheological indices (Low shear viscosity-LSV, Crossover modulus-G*c, Glover-Rowe Parameter-G-R, DSR function-DSR Fn) as a function of carbonyl area (CA) was conducted. With the SBS modification, both of the hardening susceptibility of the rheological index-LSV and G-R decreases compared with the corresponding base binder. The TR increased the hardening susceptibility of all the rheological indexes. While for the G*c, SBS increases the slope of the most modified asphalt binders except A and B_TR_X series binders. The multiple linear regression statistical analysis results indicate that the oxidative aging conditions play an important role on the CA, and rheological performance

Distribution and prevalence of knemidokoptic mange in Hawai`i `Amakihi on the island of Hawaii

Science.gov (United States)

Gaudioso, Jacqueline; LaPointe, Dennis; Atkinson, Carter T.; Apelgren, Chloe

2014-01-01

Knemidokoptic mange was first observed on two Hawai‘i ‘Amakihi (Hemignathus virens) mist netted in Manuka Natural Area Reserve (NAR) on the Island of Hawai‘i in June 2007. Microscopic examination of skin scrapings from lesions of the infested individuals revealed the scaley-leg mite, Knemidokoptes jamaicensis. Continued surveillance at Manuka NAR (2007-2009) documented a 24% (15/63) prevalence of mange among Hawai‘i ‘Amakihi distributed from coastal habitat to 1,500 m above sea level (asl). From 2012-2014, we conducted an island-wide survey of wild passerine birds from several leeward sites (Manuka NAR, Kahuku Unit of Hawai‘i Volcanoes National Park (HAVO), Pu‘u Wa‘awa‘a Forest Bird Sanctuary, and Kipahoehoe NAR) and windward sites (Hakalau Forest National Wildlife Refuge, ‘Ᾱinahou Ranch of HAVO, Malama Ki Forest Reserve, and Keauohana Forest Reserve) to determine the current distribution and host range of knemidokoptic mange. We also determined the prevalence of malaria in Hawai‘i ‘Amakihi populations where mange was present and treated a subset of infested Hawai‘i ‘Amakihi mange with a single, topical dose of moxidectin. We mist netted and examined a total of 1,734 passerines, including 738 Hawai‘i ‘Amakihi. Mange was present in Hawai‘i ‘Amakihi at Manuka NAR (595 and 305 m asl), Kahuku Ranch Unit of HAVO (Glover site: 1,201 m asl and Kipuka Akala site: 1,532 m asl), Malama Ki Forest Reserve and Keauohana Forest Reserve (293 m asl). No other passerine birds (n = 995) were infected. Mange prevalence ranged from a high of 69% (40/58) in Keauohana Forest Reserve to a low of 2% (1/65) in the Kahuku Ranch Unit of HAVO (Kipuka Akala). At Manuka NAR prevalence had decreased from 26% in 2010 to 10% (7/81) in 2012–2014. We found no significant relationship between the prevalence of mange and the prevalence of avian malaria in mesic habitats at Manuka NAR (P = 0.59 (FET, n = 81)), but there was a significant association between the

The Formation of Primordial Luminous Objects

International Nuclear Information System (INIS)

Ripamonti, Emanuele; Kapteyn Astron. Inst., Groningen; Abel, Tom; KIPAC, Menlo Park

2005-01-01

leave the discussion of feedback to lecture notes by Ferrara and Salvaterra and by Madau and Haardt in this same book and focus only on the aspects of the formation of the first objects. The advent of cosmological numerical hydrodynamics in particular allow a fresh new look at these questions. Hence, these notes will touch on aspects of theoretical cosmology to chemistry, computer science, hydrodynamics and atomic physics. For further reading and more references on the subject we refer the reader to other relevant reviews such as Barkana and Loeb 2001, and more recently Ciardi and Ferrara 2004, Glover 2004 and Bromm and Larson 2004. In these notes, we try to give a brief introduction to only the most relevant aspects. We will start with a brief overview of the relevant cosmological concepts in section 2, followed by a discussion of the properties of primordial material (with particular emphasis to its cooling and its chemistry) in section 3. We will then review the technique and the results of numerical simulations in sections 4 and 5: the former will deal with detailed 3D simulations of the formation of gaseous clouds which are likely to transform into luminous objects, while the latter will examine results (mostly from 1D codes) about the modalities of such transformation. Finally, in section 6 we will critically discuss the results of the previous sections, examining their consequences and comparing them to our present knowledge of the universe

HERBAL SUPPLEMENTS: CAUSE FOR CONCERN?

Directory of Open Access Journals (Sweden)

Paolo Borrione

2008-12-01

effects. Also, some herbs are safe in modest amounts but they may become toxic at higher doses. For example, liquorice root can be used safely for treating duodenal and gastric ulcers, but large amounts of liquorice can cause serious side effects such as hypokalemia, high blood pressure, and heart failure. Finally, other herbs, toxic by themselves: for example, germander, an herb used in some weight-loss programs, can cause fatal hepatitis. Other herbs may be toxic because of possible contaminants: the Chinese herbs caowu and chuanwu used for the management of rheumatism, arthritis, bruises, and fractures may contain highly toxic potentially fatal alkaloids such as aconitine.Therefore, despite the increased tendency to seek natural therapies, athletes have to be aware that "natural" does not equal to "safe." Herbs should not be touted as miraculous side effects-free substances, but rather as compounds that work through simple biochemistry. The effects of most herbal supplements have not been studied using rigorous scientific methodology, and the hyperbolic advertising and advocacy literature surrounding herbal products often contains untested claims, and under-reports side effects.All the preparations mentioned above exhibit hormone-like activity. Evidence in animals of reproductive disturbances associated with ingestion of feed rich in oestrogenic substances includes a lower conception rate in sheep after prolonged isoflavones consumption, infertility in cattle after consuming feed containing coumestrol, decreased fertility in captive cheetahs fed with dietary oestrogens, hyperoestrogenism in pigs fed with diets containing zearalenone, uterotropic effects in mice fed with soybean, reduced fecundity in adult males rats fed a high phytoestrogen diet for 3 days (Glover and Assinder, 2006; Srilatha, 2004 Also, in a population-based cohort study in the United Kingdom, a vegetarian diet during pregnancy was associated with a 5-fold higher risk of hypospadias, and consumption

(Brief report Evaluation of Suitable Host Plant, as Banker Plant for Eretmocerus mundus, Whiteflies Parasitoid

Directory of Open Access Journals (Sweden)

M. J. Ardeh

2016-03-01

Full Text Available Introduction: Whiteflies (Homoptera; Aleyrodidae are the key pests of agricultural crops worldwide. Two species, which seriously damage crops, are the Silver leaf whitefly “Bemisia tabaci (Gennadius” and the Greenhouse whitefly “Trialeorodes vaporariorum (Westwood”. These pests are active on the underside of the leaves where they are relatively protected from insecticide. Moreover, emergence of resistant biotypes of whitelies impose much more costs on its chemical control. Therefore, during falling the past population, several researches have been carried out to find and use efficient biocontrol methods. One of the biocontrol agents to control B. tabaci is “Eretmocerus mundus” (Hy., Aphelinidae. The parasitoid should be introduced to control pest in the greenhouses. One of the methods, which is used in introducing of biological control agents, is ‘Banker Plant System’. In this system, the host plant has a population of reproducing natural enemy used as a reservoir. Therefore, as soon as the pest infection occurs, the parasitoids can find them and control the damage. İn a banker plant system, several aspects should be considered. Some of the behavioral and biological aspects are important. For example characteristics of leaf surface influence on the host finding time of the parasitoid. The biochemical characteristics of the host plants affect the parasitoid fitness. Therefore, we tried to compare these aspects of E. mundus in two host plants (eggplant and cotton from banker plant point of view, to control B. tabaci in the greenhouses. Materials and Methods: The two host plants (eggplant and cotton, were planted in the greenhouse and a culture of B. tabaci was reared on the plants. After two weeks, some of the infested plants were put in separate cages, and the parasitoid, E. mundus, that was collected from the egg plant and cotton fields of the Varamin region were released on the plants. Then, the biological characteristics of

Local Purchasing of Journals is Required in Addition to a Nationally Purchased Collection to Meet the Information Needs of NHS Staff. A review of: Glover, Steven William, John Addison, Colette Gleghorn, and John Bramwell. “Journal Usage in NHS Hospitals: A Comparison Report of Total Usage at an Acute NHS Trust and a Specialist NHS Trust in the North West of England.” Health Information and Libraries Journal 24.3 (2007: 193‐9.

Directory of Open Access Journals (Sweden)

Jennie Kelson

2008-03-01

Full Text Available Objective ‐ To compare journal usage between an acute National Health Service (NHS Trust and a specialist NHS Trust located in North West England to provide some evidence as to how well the National Core Content Collection (provided by ProQuest meets the needs of staff in these settings.Design ‐ Comparative studySetting ‐ An acute NHS Trust, comprising four hospital sites, and a cancer specialist NHS Trust based on a single site. Both Trusts are located in North West England. The cancer specialist NHS Trust is a teaching hospital with undergraduate nurses, medical students, and student radiographers. This Trust is also closely associated with an adjoining cancer research institute. The acute NHS Trust has a large number of healthcare staff in training and was not described as a teaching hospital.Subjects ‐ Staff of the respective NHS Trusts. The staff numbers for each organisation were not provided.Methods ‐ COUNTER usage statistics of online journals, obtained from publisher administration tools, were collected for one year covering the period 1 December 2005 to 30 November 2006. Where available, the number of photocopies made from print journals during the same period by library users for their own use was also included. All full‐text downloads of journal articles were counted as part of this study, hence the possibility of double counting if a single article was requested in both HTML and PDF versions. Details of free or open access articles accessed without the need for a username and password were not included in the study. To encourage use of the electronic journals, library services at both Trusts implemented a number of initiatives to maximize publicity. These included direct e‐mails to staff, posters, and presentations to staff. Athens registration, required for access to the electronic journal collections, was promoted as part of the induction process for new library users. Staff members were encouraged to apply for the electronic table of contents alert for journals in their area of specialty. An A‐Z list of journals was accessible via the Trusts’ intranet and internet sites, and direct links to electronic journals were added to the NHS Dialog/Datastar databases and on PubMed.Main results ‐ The libraries at both Trusts in the study provide the majority of their journals in electronic‐only format. In addition to the National Core Content titles, the cancer specialist Trust provides access to an additional five journal collections: Science Direct Health Sciences, Blackwell Synergy Medical and Nursing collection, five journals selected from Nature Publishing Group, selected society journals via HighWire Press and Oxford University Press titles. Staff members of the acute Trust have access to an additional three journal collections: Science Direct Health Sciences, the BMJ Publishing Group (BMJPG collection and 16 LWW titles via Ovid. During the study period, a total of 93,376 articles were downloaded or copied. Of these, 47,079 articles were downloaded or copied by staff of the cancer specialist NHS Trust and 46,297 articles were downloaded or copied by staff of the acute NHS Trust. The usage of each of the journal collections during the study period for each Trust is shown in the table below with the most used resource shown in bold. (See article for table General information regarding some of the commonly used journal titles by staff of each Trust was included in the commentary, but levels of use were not enumerated. Staff of the cancer specialist NHS Trust favoured cancer‐related titles, whilst staff of the acute NHS Trust accessed journal titles over a greater range of subject areas. Details of the top titles accessed from the National Core Content collection were not provided for either Trust. A possible reason given for the lower usage level of the National Core Content collection by the cancer specialist NHS Trust compared to the acute NHS Trust was the presence of embargoes on many cancer‐related titles within the National Core Content collection. Information about training offered to staff, their level of access to computer facilities,or familiarity with accessing electronic journal collections was not provided.Conclusion ‐ Staff of both Trusts in the study recorded a high level of journal use, with a total of 93,376 articles downloaded or photocopied during the study period. There was a marked difference in the usage patterns of the National Core Content journals between the two Trusts studied with the acute NHS Trust showing a higher proportion of usage (29.9%compared with the cancer specialist Trust(4.5%. Staff members of the acute NHS Trust accessed a greater range of subject areas, while staff those at the cancer specialist NHS Trust favoured cancer related titles.The results indicated that the National Core Content collection did not meet the information needs of the specialist cancer Trust as well as it met the needs of the more generalist acute Trust. The National Core Content collection appears insufficient to meet the diverse information needs of all NHS staff. Local purchasing of journals, in addition to national level provision, is therefore required to ensure that the needs of local specialties are adequately supported.

Psicopatologia da despersonalização

Directory of Open Access Journals (Sweden)

Darcy M. Uchôa

1959-09-01

adequate defence was the split (masochistic mechanism. 7- In many cases the split is not sufficient, even when processed at the most archaic levels by the effect of regression. Then, arise the "restitution mechanisms" (Freud or "progression mechanisms" (Glover as hallucinations, delusions, automatic phenomena of influence (transitivism, presenting the picture of depersonalization within the psychosis. This means greater weakness of the ego or greater intensity of conflicts. 8- In many cases we note the close relationship of depersonalization with hypochondria, considered as an increase in the investment of organs in detriment to that of objects. The repression by the countercathexis of the displeasing sensations can lead to feelings of alienation or strangeness, as shown by Tausk, Fenichel and others. However, also in these cases a deeper investigation always reveal the aggression impulses against immediate objects (considered as primaries objects turned back against the ego. If hypochondria is a phenomenon of an increase of the narcisistic investment of the organ, the aggression component in organs symbolizing objects is also at times very evident. 9 - In neurotic depersonalization psychotherapy analytically oriented (exhuming the conflicts and solving them or preferably psychoanalytic treatment is indicated. When depersonalization is part of the symptomatology of a psychosis, it accompanies the general indications of modern biologic techniques of shock and the modern methods of psychotherapy.

Grassland birds wintering at U.S. Navy facilities in southern Texas

Science.gov (United States)

Woodin, Marc C.; Skoruppa, Mary Kay; Bryan, Pearce D.; Ruddy, Amanda J.; Hickman, Graham C.

2010-01-01

transects during the study were Species of Conservation Concern: Le Conte’s Sparrow, Sedge Wren (Cistothorus platensis), Grasshopper Sparrow (Ammodramus savannarum), Long-billed Curlew (Numenius americanus), Sprague’s Pipit (Anthus spragueii), Cassin’s Sparrow (Aimophila cassinii), and Loggerhead Shrike (Lanius ludovicianus). Native grasslands consistently supported greater bird species richness than exotic grasslands. In one winter, exotic grasslands supported more birds than native grasslands.Native grasslands were determined to have more forb cover, more bare ground, and greater plant species richness than exotic grasslands, whereas exotic grasslands were characterized by more grass cover and relatively greater vegetation density during dry years. Not only did these individual measures differ between native and exotic grasslands, but components of variation also differed. In native grasslands, grass density and cover contributed more to variation, whereas in exotic grasslands, non-grass vegetation was a greater component of variation. Total bird numbers and bird species richness in native grasslands were related to the principal component that contained a measure of litter cover. Total bird numbers and bird species richness in exotic grasslands indicated no significant relationships with any of the principal components of variation.The two most common insect orders in native grasslands were Hymenoptera and Coleoptera, which accounted for 42 percent of all insects. The two most common insect orders in exotic grasslands were Hemiptera and Homoptera, which accounted for about 80 percent of all insects. Insect family richness was greater in exotic grasslands than in native grasslands in two of four seasons. Proportions of arachnid families were similar in native and exotic grasslands, but arachnid family richness was greater in exotic grasslands than in native grasslands.Abundance of seeds was greater in exotic than in native grasslands. However, seed diversity was

Selected Abstracts of the 2nd Congress of joint European Neonatal Societies (jENS 2017; Venice (Italy; October 31-November 4, 2017; Session "Quality Improvement, Parents Centered Care"

Directory of Open Access Journals (Sweden)

--- Various Authors

2017-10-01

INFANTS DECREASES THE RATE OF INTRACRANIAL HEMORRHAGE AND IMPROVES NEURODEVELOPMENTAL OUTCOME AT THE AGE OF 24 MONTHS • L. Schiefele, F. Reister, J. Essers, B. Mayer, M. Schmid, H. HummlerABS 33. THE IMPLEMENTATION OF THE CLOSE COLLABORATION WITH PARENTS TRAINING PROGRAM IN 5 NEONATAL UNITS – A QUALITATIVE STUDY • M. Toivonen, L. Lehtonen, S. Ahlqvist-Björkroth, A. AxelinABS 34. A USER CENTRED DESIGN APPROACH TO EVALUATE A VALIDATED INFANT PAIN MEASURE E-LEARNING MODULE • B. Stevens, S. Gibbins, M. Campbell-Yeo, C. McNair, J. Yamada, K. Dionne, S. Dinsdale, C. Johnston, A. TaddioABS 35. EVALUATION OF PROLONGED PAIN IN PRETERM INFANTS WITH PNEUMOTHORAX USING HRV ANALYSIS AND EDIN SCORES • M. Buyuktiryaki, N. Uras, N. Okur, M.Y. Oncel, G. Kadioglu Simsek, S. Isik, S.S. OguzABS 36. NAME BANDS IN PRETERM INFANTS – WHAT IS THE NATION DOING? • A. Doerr, A. Glover, F. EmeryABS 37. DELIVERING EVIDENCE-BASED INFORMATION AT THE POINT OF CARE • A. Dunlop, L. Osborne, P. SatodiaABS 38. COST-EFFECTIVENESS OF TRANSCUTANEOUS BILIRUBIN (TcB MONITORING IN A GROWING HEALTH ECONOMY • L. Mohammed, B.N. OfoegbuABS 39. IMPROVING THE QUALITY OF DISCHARGE IN BABIES WITH DOWN SYNDROME • C.M. Moore, S.M. Eldaw, M. McCormack, J.J. FitzsimonsABS 40. CLOSE COLLABORATION WITH PARENTS™ IN­TER­VENTION PREVENTS PROLONGED MATER­NAL POSTPARTUM DEPRESSIVE SYMP­TOMS • S. Ahlqvist-Björkroth1, A. Axelin, R. Korja, M. Huhtala, L. LehtonenABS 41. NOISE IN THE NICU. INTRODUCING A NOISE REDUCTION POLICY TO SOUTHMEAD NEONATAL INTENSIVE CARE UNIT: PRIMARY RESULTS FROM A 3 MONTH SERVICE IMPROVEMENT PROJECT • J. Hawksley, E. Helliwell, F. EmeryABS 42. IS BREAST MILK ODOR APPROPRIATE TO MANAGE PAIN IN PRETERM NEONATES? • G. De Clifford-Faugère, A. Lavallée, M. AitaABS 43. REDUCING UNNECESSARY BLOOD SAMPLING IN NEONATAL UNIT – A QUALITY IMPROVEMENT INITIATIVE • H. McDermott, A. Smith, P. NathABS 44. ALARM VISIBILITY AND INFUSION CONTINUITY: ENVIRONMENTAL CHANGE AND TECHNOLOGY