WorldWideScience

Sample records for gossypii glover hemiptera

  1. Biological parameters of the non-target pest Aphis gossypii Glover ...

    African Journals Online (AJOL)

    Thiago Mota

    2013-04-17

    Apr 17, 2013 ... Development and commercial use of Bollgard cotton in the USA nearly promises versus today reality. Plant. J. 27:489-501. Pessoa LGA, Souza B, Carvalho CF, Silva M (2004). Aspectos da biologia de Aphis gossypii Glover, 1877 (Hemiptera: Aphididae) em quatro cultivares de Algodoeiro, em Laboratório.

  2. Fertility life table of Lysiphlebus testaceipes (Cresson) (Hymenoptera, Braconidae, Aphidiinae) in Rhopalosiphum maidis (Fitch) and Aphis gossypii Glover (Hemiptera, Aphididae); Tabela de vida de fertilidade de Lysiphlebus testaceipes (Cresson) (Hymenoptera, Braconidae, Aphidiinae) em Rhopalosiphum maidis (Fitch) e Aphis gossypii Glover (Hemiptera, Aphididae)

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Robson Jose da; Bueno, Vanda Helena Paes; Silva, Diego Bastos [Universidade Federal de Lavras (UFLA), MG (Brazil). Dept. de Entomologia. Lab. de Controle Biologico], e-mail: ecosbio@yahoo.com.br, e-mail: vhpbueno@ufla.br; Sampaio, Marcus Vinicius [Universidade Federal de Uberlandia, Umuarama, MG (Brazil). Inst. de Ciencias Agrarias], e-mail: mvsampaio@iciag.ufu.br

    2008-07-01

    Fertility life table of Lysiphlebus testaceipes (Cresson) (Hymenoptera, Braconidae, Aphidiinae) in Rhopalosiphum maidis (Fitch) and Aphis gossypii Glover (Hemiptera, Aphididae). The evaluation of the growth potential of Lysiphlebus testaceipes (Cresson) is important for its use in biological control programs of aphids. This work aimed to evaluate the fertility life table of L. testaceipes in Rhopalosiphum maidis (Fitch) and Aphis gossypii Glover. To determine the immature mortality, development and the sex ratio of the parasitoid, 12 females parasitoid, and 480 nymphs of each aphids were used. To evaluate the longevity and fertility 15 female parasitoid were used. Nymphs of each aphid (3 day old) were offered for each parasitoid female daily, until the female died, being 300 (first day); 250 (second day); 200 (third day); 150 (fourth day) and 50 nymphs in the other days. L. testaceipes showed immature mortality rates of 5.6 % in R. maidis and 9.2 % in A. gossypii. The development time of L. testaceipes in R. maidis and A. gossypii was 10.2 and 10.1 days, and the sex ratio of 0.71 and 0.66, respectively. The female of L. testaceipes had a fecundity of 498.8 eggs in R. maidis and 327.8 eggs in A. gossypii. The growth parameters the L. testaceipes in R. maidis and A. gossypii were, respectively R{sub o}= 205.38 and 164.08 females; r{sub m}= 0.449 and 0.431 females/females/day; {lambda}= 1.57 and 1.54 females/day; T= 11.86 and 11.83 days and TD= 10.78 and 11.27 days. L. testaceipes showed great growth potential on both aphid hosts. R. maidis could be a suitable host for proposals of mass-rearing and open rearing system using L. testaceipes. (author)

  3. Factors affecting colonization and abundance of Aphis gossypii glover (hemiptera: aphididae on okra plantations Fatores que afetam a colonização e abundância de Aphis gossypii glover (Hemiptera: Aphididae em plantações de quiabeiro

    Directory of Open Access Journals (Sweden)

    Germano Leão Demolin Leite

    2007-04-01

    Full Text Available The control of Aphis gossypii Glover (Hemiptera: Aphididae on okra Abelmoschus esculentus (L. (Malvaceae consist primarily in the use of insecticides, due to the lack of information on other mortality factors. The objective of this study was to determine the effects of predators and parasitoids, height of canopy, plant age, leaf areas, organic compounds leaves, levels of leaf nitrogen and potassium, density of leaf trichomes, total rainfall and median temperature on attack intensity of A. gossypii on two successive A. esculentus var. Santa Cruz plantations. Monthly number estimates of A. gossypii and natural enemies (visual inspection occurred on bottom, middle and apical parts of 30 plants/plantation (one leaf/plant. Plants senescence, leaf areas and natural enemies, mainly Adialytus spp., spiders and Coccinellidae, were some of the factors that most contributed to aphid reduction. A higher number of aphids was found on the bottom part than medium and apical parts of okra plants. Total rainfall can reduce the aphid population. Trichomes non-glandular or low density, organic compounds leaves and levels of N and K were not important for reducing aphid population.O controle de Aphis gossypii Glover (Hemiptera: Aphididae em quiabeiro Abelmoschus esculentus (L. (Malvaceae consiste principalmente no uso de inseticidas, em virtude da falta de informação sobre outros fatores de mortalidade. Objetivou-se com este estudo determinar os efeitos de predadores e parasitóides, altura de dossel, idade da planta, área foliar, compostos orgânicos foliares, níveis de nitrogênio e potássio, densidade de tricomas, pluviosidade e temperatura na intensidade de ataque de A. gossypii em dois cultivos sucessivos de Abelmoschus esculentus var. Santa Cruz. Estimou-se, mensalmente, o número de A. gossypii e de inimigos naturais (inspeção visual ocorridos nas folhas (uma folha/planta localizadas nas partes basal, mediana e apical de 30 plantas/plantação. Os

  4. A laboratory and field condition comparison of life table parameters of Aphis gossypii Glover (Hemiptera: Aphididae

    Directory of Open Access Journals (Sweden)

    Hosseini-Tabesh Behnaz

    2015-01-01

    Full Text Available Life table studies are essential tools for understanding population dynamics. The life table parameters of Aphis gossypii Glover (Hemiptera: Aphididae feeding on the host plant, Hibiscus syriacus L. were studied under laboratory (25±1°C and relative humidity of 65±5% and a photoperiod of 16L : 8D h and field conditions (23-43°C, and relative humidity of 27-95%. The data were analysed using the age-stage, two-sex life table theory. The life table studies were started with 50 and 40 nymphs in laboratory and field conditions, respectively. Under laboratory conditions, A. gossypii reared on H. syriacus had a higher survival rate, fecundity, and longevity than those reared under field conditions. When reared under field conditions, A. gossypii had a longer nymphal developmental time, shorter adult longevity, and lower fecundity than those reared under laboratory conditions. The intrinsic rate of increase (r, net reproductive rate (R0, and the finite rate of increase (λ under laboratory conditions, were higher than those obtained under field conditions. Nevertheless, there were no significant differences in the mean generation time T (days between field and laboratory conditions. In the present study, the results clearly showed that life table parameters of A. gossypii were significantly different under field and laboratory conditions. These results could help us to understand the A. gossypii population dynamics under field conditions. The results could also help us make better management decisions for economically important crops

  5. Fertility life table of Lysiphlebus testaceipes (Cresson) (Hymenoptera, Braconidae, Aphidiinae) in Rhopalosiphum maidis (Fitch) and Aphis gossypii Glover (Hemiptera, Aphididae)

    International Nuclear Information System (INIS)

    Silva, Robson Jose da; Bueno, Vanda Helena Paes; Silva, Diego Bastos; Sampaio, Marcus Vinicius

    2008-01-01

    Fertility life table of Lysiphlebus testaceipes (Cresson) (Hymenoptera, Braconidae, Aphidiinae) in Rhopalosiphum maidis (Fitch) and Aphis gossypii Glover (Hemiptera, Aphididae). The evaluation of the growth potential of Lysiphlebus testaceipes (Cresson) is important for its use in biological control programs of aphids. This work aimed to evaluate the fertility life table of L. testaceipes in Rhopalosiphum maidis (Fitch) and Aphis gossypii Glover. To determine the immature mortality, development and the sex ratio of the parasitoid, 12 females parasitoid, and 480 nymphs of each aphids were used. To evaluate the longevity and fertility 15 female parasitoid were used. Nymphs of each aphid (3 day old) were offered for each parasitoid female daily, until the female died, being 300 (first day); 250 (second day); 200 (third day); 150 (fourth day) and 50 nymphs in the other days. L. testaceipes showed immature mortality rates of 5.6 % in R. maidis and 9.2 % in A. gossypii. The development time of L. testaceipes in R. maidis and A. gossypii was 10.2 and 10.1 days, and the sex ratio of 0.71 and 0.66, respectively. The female of L. testaceipes had a fecundity of 498.8 eggs in R. maidis and 327.8 eggs in A. gossypii. The growth parameters the L. testaceipes in R. maidis and A. gossypii were, respectively R o = 205.38 and 164.08 females; r m = 0.449 and 0.431 females/females/day; λ= 1.57 and 1.54 females/day; T= 11.86 and 11.83 days and TD= 10.78 and 11.27 days. L. testaceipes showed great growth potential on both aphid hosts. R. maidis could be a suitable host for proposals of mass-rearing and open rearing system using L. testaceipes. (author)

  6. Effect of silicon and acibenzolar-s-methyl on colored cotton plants infested or not with Aphis gossypii Glover (Hemiptera, Aphididae

    Directory of Open Access Journals (Sweden)

    Eliana Alcantra

    2011-06-01

    Full Text Available Effect of silicon and acibenzolar-s-methyl on colored cotton plants infested or not with Aphis gossypii Glover (Hemiptera, Aphididae. The aphid Aphis gossypii is an insect pest that causes damage mainly at the beginning of the cotton plant development. The effect of resistance inductors silicon and acibenzolar-s-methyl (ASM on the development of colored cotton plants were researched in the presence and absence of A. gossypii. Three colored cotton cultivars were sown in pots and individually infested with 25 apterous aphids, 13 days after the application of the inductors. Fifteen days after plant emergence, the silicon was applied at a dosage equivalent to 3 t/ha and acibenzolar-s-methyl in 0.2% solution of the product BION 500®. After 21 days of infestation the following parameters were evaluated: plant height, stem diameter, dry matter of aerial part and root, and total number of aphids replaced. It was verified that the plant height was reduced in the presence of aphids and all variables were negatively affected by the application of ASM. However, silicon did not affect plant development.

  7. Efeito repelente de azadiractina e óleos essenciais sobre Aphis gossypii Glover (Hemiptera: Aphididae em algodoeiro Repellent effect of azadirachtin and essential oils on Aphis gossypii Glover (Hemiptera: Aphididae in cotton plants

    Directory of Open Access Journals (Sweden)

    Lígia Helena de Andrade

    2013-09-01

    Full Text Available A repelência de inseticidas botânicos tem se destacado como uma tática promissora no controle alternativo de pragas agrícolas e urbanas, podendo ser um dos componentes do manejo integrado de pragas. Objetivou-se com este trabalho identificar a repelência de inseticidas botânicos sobre fêmeas ápteras de Aphis gossypii Glover. Testes com chance de escolha foram realizados com discos de folha de algodoeiro, imersos nas caldas dos inseticidas e testemunha (água destilada com DMSO a 2%. Utilizou-se azadirachtina (0,075% e os óleos essenciais de Piper hispidinervum CDC, P. aduncum L., Cymbopogon winterianus (L., C. citratus (D.C. Stapf, Foeniculum vulgare Mill, Syzygium aromaticum (L. Merrill e Perry, Cinnamomum zeylanicum Blume, Schinus terebinthifolius Raddi e Chenopodium ambrosioides L. na concentração de 0,05%. C. citratus, C. winterianus, P. aduncum, S. terebinthifolius, azadirachtina e C. zeylanicum apresentaram os maiores percentuais de repelência, 100; 84; 66,67; 64; 60,87 e 48% respectivamente e reduziram a produção de ninfas em 100; 92; 42,9; 87,5; 80,65 e 89,74%, apresentando resultados significativos pelo teste do χ2 ao nível de 10% de probabilidade. Nos testes com F. vulgare (χ2 = 3,66, P = 0,05 as fêmeas de A. gossypii foram atraídas significativamente para os discos tratados e ocorreu um aumento na produção de ninfas nos resultados obtidos para F. vulgare (χ2 = 5,87, P = 0,02 e C. ambrosioides (χ2 = 14,31, P = 0,001.The repellence of botanical insecticides has emerged as a promising technique in the alternative control of urban and agricultural pests, being seen as one component of integrated pest management. The aim of this work was to identify the repellence of botanical insecticides on apterous females of Aphis gossypii Glover. Random-choice tests were carried out with discs from the leaves of cotton plants immersed in insecticide solution and in a control (distilled water with 2% DMSO. Azadirachtin was used

  8. Tabela de vida de fertilidade de Lysiphlebus testaceipes (Cresson (Hymenoptera, Braconidae, Aphidiinae em Rhopalosiphum maidis (Fitch e Aphis gossypii Glover (Hemiptera, Aphididae Fertility life table of Lysiphlebus testaceipes (Cresson (Hymenoptera, Braconidae, Aphidiinae in Rhopalosiphum maidis (Fitch and Aphis gossypii Glover (Hemiptera, Aphididae

    Directory of Open Access Journals (Sweden)

    Robson José da Silva

    2008-01-01

    Full Text Available Avaliar o potencial de crescimento de Lysiphlebus testaceipes (Cresson é importante para seu uso em programas de controle biológico de pulgões. Este trabalho teve como objetivo determinar a tabela de vida de fertilidade de L. testaceipes em Rhopalosiphum maidis (Fitch e Aphis gossypii Glover. Na avaliação da mortalidade de imaturos, do desenvolvimento e da razão sexual foram utilizadas 12 fêmeas do parasitóide e 480 ninfas de cada pulgão testado. Na avaliação da longevidade e da fertilidade foram utilizadas 15 fêmeas do parasitóide e uma colônia por dia de cada pulgão, até a morte da fêmea do parasitóide, sendo 300 (1º dia; 250 (2º dia; 200 (3º dia; 150 (4º dia; 100 (5º dia e 50 ninfas nos demais dias. L. testaceipes apresentou taxas de mortalidade de imaturos de 5,6% em R. maidis e de 9,2% em A. gossypii, desenvolvimento de 10,2 e 10,1 dias e razão sexual de 0,71 e 0,66, respectivamente. L. testaceipes apresentou fecundidade de 498,2 ovos em R. maidis e de 327,8 ovos em A. gossypii. Os parâmetros de crescimento de L. testaceipes em R. maidis e A. gossypii foram, respectivamente, R O= 205,38 e 164,08 fêmeas; r m= 0,449 e 0,431 fêmeas/fêmeas/dia; lambda = 1,57 e 1,54 fêmeas/dia; T= 11,86 e 11,83 dias e TD= 10,78 e 11,27 dias. L. testaceipes apresenta alto potencial de crescimento em R. maidis e A. gossypii. R. maidis mostrou ser hospedeiro adequado aos propósitos de criação massal e utilização em sistema de criação aberta para L. testaceipes.The evaluation of the growth potential of Lysiphlebus testaceipes (Cresson is important for its use in biological control programs of aphids. This work aimed to evaluate the fertility life table of L. testaceipes in Rhopalosiphum maidis (Fitch and Aphis gossypii Glover. To determine the immature mortality, development and the sex ratio of the parasitoid, 12 females parasitoid, and 480 nymphs of each aphids were used. To evaluate the longevity and fertility 15 female

  9. Distribuição espacial de Aphis gossypii (Glover (Hemiptera, Aphididae e Bemisia tabaci (Gennadius biótipo B (Hemiptera, Aleyrodidae em algodoeiro Bt e não-Bt Spatial distribution of Aphis gossypii (Glover (Hemiptera, Aphididae and Bemisia tabaci (Gennadius biotype B (Hemiptera, Aleyrodidae on Bt and non-Bt cotton

    Directory of Open Access Journals (Sweden)

    Tatiana Rojas Rodrigues

    2010-03-01

    Full Text Available Distribuição espacial de Aphis gossypii (Glover (Hemiptera, Aphididae e Bemisia tabaci (Gennadius biótipo B (Hemiptera, Aleyrodidae em algodoeiro Bt e não-Bt. O estudo da distribuição espacial de adultos de Bemisia tabaci e de Aphis gossypii nas culturas do algodoeiro Bt e não-Bt é fundamental para a otimização de técnicas de amostragens, além de revelar diferenças de comportamento de espécies não-alvo dessa tecnologia Bt entre as duas cultivares. Nesse sentido, o experimento buscou investigar o padrão da distribuição espacial dessas espécies de insetos no algodoeiro convencional não-Bt e no cultivar Bt. As avaliações ocorreram em dois campos de 5.000 m² cada, nos quais se realizou 14 avaliações com contagem de adultos da mosca-branca e colônias de pulgões. Foram calculados os índices de agregação (razão variância/média, índice de Morisita e Expoente k da Distribuição Binomial Negativa e realizados os testes ajustes das classes numéricas de indivíduos encontradas e esperadas às distribuições teóricas de freqüência (Poisson, Binomial Negativa e Binomial Positiva. Todas as análises mostraram que, em ambas as cultivares, a distribuição espacial de B. tabaci ajustou-se a distribuição binomial negativa durante todo o período analisado, indicando que a cultivar transgênica não influenciou o padrão de distribuição agregada desse inseto. Já com relação às análises para A. gossypii, os índices de agregação apontaram distribuição agregada nas duas cultivares, mas as distribuições de freqüência permitiram concluir a ocorrência de distribuição agregada apenas no algodoeiro convencional, pois não houve nenhum ajuste para os dados na cultivar Bt. Isso indica que o algodão Bt alterou o padrão normal de dispersão dos pulgões no cultivo.The study of spatial distribution of the adults of Bemisia tabaci and the colonies of Aphis gossypii on Bt and non-Bt cotton crop is fundamental for

  10. Respon Fungsional Menochilus sexmaculatus Fabricius terhadap Aphis Gossypii Glover

    Directory of Open Access Journals (Sweden)

    F. X. Wagiman

    1996-12-01

    Full Text Available Laboratory and field-cage experiments were conducted at the Universiti Pertanian Malaysia. Objective of the study was to determine the functional response of Menochilus sexmaculatus Fabricius (Coleoptera: Coccinellidae predating on chilli aphid Aphis gossypii Glover (Homoptera: Aphididae. The larvae and adults of the predaceous coccinellid exhibited the Hulling's Type II functional response. A first instar of the coccinellid predating on single first instar of the aphid within 24.6 minutes in the laboratory and 16.8 minutes in the field. While a fourth instar and an adult of the coccinellid predating on single fourth instar of the aphid within 4.2 and 1.5 minutes respectively.

  11. Biological control of cotton aphid (Aphis gossypii Glover) in cotton (inter)cropping systems in China : a simulation study

    NARCIS (Netherlands)

    Xia, J.

    1997-01-01

    Cotton aphid ( Aphis gossypii Glover) is the key insect pest of seedling cotton ( Gossypium hirsutum L. ) in China, particularly in the North China cotton region. The resulting annual losses amount to 10-15% of the attainable yield. Sole reliance on

  12. The control and protection of cotton plants using natural insecticides against the colonization by Aphis gossypii Glover (Hemiptera: Aphididae - doi: 10.4025/actasciagron.v35i2.15764

    Directory of Open Access Journals (Sweden)

    Ezio Santos Pinto

    2012-12-01

    Full Text Available The cotton aphid, Aphis gossypii Glover (Hemiptera: Aphididae, is a key pest of cotton, irrespective of the use of conventional or organic management. In organic systems, however, the use of synthetic insecticides is not allowed, increasing the difficulty of controlling this pest. This work evaluated aphid control and the ability of products to prevent aphid infestation using natural insecticides compared to a standard synthetic insecticide. The control trial was conducted with four products [Beauveria bassiana (Boveril®, neem oil (Neemseto®, and cotton seed oil compared to thiamethoxam (Actara®], and untreated plants served as the control group. The trial testing the efficacy of these products in preventing aphid infestation was conducted using the same products, excluding Boveril®. The evaluations were conducted 72 and 120h post-treatment for the efficacy and the protection against colonization trials, respectively. The aphid control by cotton seed oil, Neemseto®, and thiamethoxam was similar, with 100% control being achieved on the thiamethoxam-treated plants. Regarding the plant protection against aphid colonization, the insecticide thiamethoxam exhibited a better performance compared to the other tested products with steady results over the evaluation period. The natural products exhibited variable results with low protection against plant colonization throughout the evaluation period.

  13. Nano-formulation enhances insecticidal activity of natural pyrethrins against Aphis gossypii (Hemiptera: Aphididae) and retains their harmless effect to non-target predators.

    Science.gov (United States)

    Papanikolaou, Nikos E; Kalaitzaki, Argyro; Karamaouna, Filitsa; Michaelakis, Antonios; Papadimitriou, Vassiliki; Dourtoglou, Vassilis; Papachristos, Dimitrios P

    2018-04-01

    The insecticidal activity of a new nano-formulated natural pyrethrin was examined on the cotton aphid, Aphis gossypii Glover (Hemiptera: Aphididae), and the predators Coccinella septempunctata L. (Coleoptera: Coccinellidae) and Macrolophus pygmaeus Rambur (Hemiptera: Miridae), in respect with the nano-scale potential to create more effective and environmentally responsible pesticides. Pyrethrin was nano-formulated in two water-in-oil micro-emulsions based on safe biocompatible materials, i.e., lemon oil terpenes as dispersant, polysorbates as stabilizers, and mixtures of water with glycerol as the dispersed aqueous phase. Laboratory bioassays showed a superior insecticidal effect of the pyrethrin micro-emulsions compared to two commercial suspension concentrates of natural pyrethrins against the aphid. The nano-formulated pyrethrins were harmless, in terms of caused mortality and survival time, to L3 larvae and four-instar nymphs of the predators C. septempunctata and M. pygmaeus, respectively. We expect that these results can contribute to the application of nano-technology in optimization of pesticide formulation, with further opportunities in the development of effective plant protection products compatible with integrated pest management practices.

  14. Effects of nitrogen fertilization in cotton crop on Aphis gossypii Glover (Hemiptera: Aphididae) biology; Efeitos da adubacao nitrogenada em algodoeiro sobre a biologia de Aphis gossypii Glover (Hemiptera: Aphididae)

    Energy Technology Data Exchange (ETDEWEB)

    Barros, Ricardo; Degrande, Paulo E.; Fernandes, Marcos G.; Nogueira, Rodrigo F. [Universidade Federal da Grande Dourados, MS (Brazil). Faculdade de Ciencias Agrarias]. E-mail: rbarrosufms@yahoo.com.br, degrande@ufgd.edu.br

    2007-09-15

    The cotton aphid, Aphis gossypii Glove, is one of the pests of cotton crop and its relation with the host seem to depend on the amount of nitrogen available to the plant. The biology of A. gossypii using different cotton nitrogen fertility regimes was studied under greenhouse conditions, in Dourados, MS. A completely randomized design with nine replications in a factorial scheme (2x4x2)+1 was used. Two nitrogen sources (sulphate of ammonium and urea), four doses of nitrogen (50, 100, 150 and 200 kg ha-1), two different times of nitrogen application and one additional treatment without nitrogen were taken as factors. The nymphal phases, the pre-reproductive, reproductive and pos-reproductive periods, longevity, the life cycle and fecundity of the cotton aphid were evaluated. The doses of nitrogen influenced the cotton aphid biology in both sources and times of application, favoring its development and fecundity. (author)

  15. Effects of nitrogen fertilization in cotton crop on Aphis gossypii Glover (Hemiptera: Aphididae) biology

    International Nuclear Information System (INIS)

    Barros, Ricardo; Degrande, Paulo E.; Fernandes, Marcos G.; Nogueira, Rodrigo F.

    2007-01-01

    The cotton aphid, Aphis gossypii Glove, is one of the pests of cotton crop and its relation with the host seem to depend on the amount of nitrogen available to the plant. The biology of A. gossypii using different cotton nitrogen fertility regimes was studied under greenhouse conditions, in Dourados, MS. A completely randomized design with nine replications in a factorial scheme (2x4x2)+1 was used. Two nitrogen sources (sulphate of ammonium and urea), four doses of nitrogen (50, 100, 150 and 200 kg ha-1), two different times of nitrogen application and one additional treatment without nitrogen were taken as factors. The nymphal phases, the pre-reproductive, reproductive and pos-reproductive periods, longevity, the life cycle and fecundity of the cotton aphid were evaluated. The doses of nitrogen influenced the cotton aphid biology in both sources and times of application, favoring its development and fecundity. (author)

  16. Interspecific Associations between Cycloneda sanguinea and Two Aphid Species (Aphis gossypii and Hyadaphis foeniculi) in Sole-Crop and Fennel-Cotton Intercropping Systems.

    Science.gov (United States)

    Fernandes, Francisco S; Ramalho, Francisco S; Malaquias, José B; Godoy, Wesley A C; Santos, Bárbara Davis B

    2015-01-01

    Aphids cause significant damage to crop plants. Studies regarding predator-prey relationships in fennel (Foeniculum vulgare Mill.) and cotton (Gossypium hirsutum L.) crops are important for understanding essential ecological interactions in the context of intercropping and for establishing pest management programs for aphids. This study evaluated the association among Hyadaphis foeniculi (Passerini) (Hemiptera: Aphididae), Aphis gossypii Glover (Hemiptera: Aphididae) and Cycloneda sanguinea (L.) (Coleoptera: Coccinellidae) in cotton with coloured fibres, fennel and cotton intercropped with fennel. Association analysis was used to investigate whether the presence or absence of prey and predator species can indicate possible interactions between aphids and ladybugs. Significant associations among both apterous and alate H. foeniculi and C. sanguinea were observed in both the fennel and fennel-cotton intercropping systems. The similarity analysis showed that the presence of aphids and ladybugs in the same system is significantly dependent on the type of crop. A substantial amount of evidence indicates that the presence of the ladybug C. sanguinea, is associated with apterous or alate A. gossypii and H. foeniculi in fennel-cotton intercropping system. We recommend that future research vising integrated aphid management taking into account these associations for take decisions.

  17. Primeiro Registro de Afídeos (Hemiptera: Aphidoidea) em Carambola (Averrhoa carambola L.) no Brasil

    OpenAIRE

    Cunha, Suzan Beatriz Zambon da; Sousa e Silva, Carlos Roberto

    2016-01-01

    A carambola (Averrhoa carambola L.) árvore de origem Asiática foi introduzida no Brasil em 1817, desde então vem aumentando sua área de cultivo no país. A planta é atacada por poucos insetos como as moscas e percevejos. Este trabalho relata a presença de Aphis gossypii Glover em A. carambola pela primeira vez no Brasil. First Record of Aphids (Hemiptera: Aphididae) on Starfruit (Averrhoa carambola L.) in Brazil Abstract. The starfruit (Averrhoa carambola L.) has origin Asiatic an...

  18. Effects of botanical insecticides on the instantaneous population growth rate of Aphis gossypii Glover (Hemiptera: Aphididae in cotton=Efeitos de inseticidas botânicos na taxa instantânea de crescimento populacional de Aphis gossypii Glover (Hemiptera: Aphididae em algodão

    Directory of Open Access Journals (Sweden)

    Edmilson Jacinto Marques

    2012-04-01

    Full Text Available Botanical insecticides have been studied aiming the alternative pest control. The present study investigated the effects of these insecticides on the instantaneous population growth rate (ri of Aphis gossypii. Botanical insecticides were tested in the following concentrations: Compostonat®, Rotenat-CE® and Neempro (0, 0.50, 0.75, 1.00, 1.25, 1.50 and 1.75%; Natuneem® and Neemseto® (0, 0.25, 0.50, 0.75 and 1.00% and essential oils of Foeniculum vulgare Mill., Cymbopogom winterianus (L., Chenopodium ambrosioides L. and Piper aduncum L (0, 0.0125, 0.025, 0.0375 and 0.05%. Cotton leaf discs, CNPA 8H cultivar with 5 cm in diameter were immersed for 30 seconds in products broth and dried for 30 minutes. Eight replicates per concentration were used and each disc was infested with five apterous adult females of A. gossypii uniform in size and confined for 10 days. Compostonat®, Rotenat® and Neempro provided negative ri decreasing A. gossypii population. Natuneem® and Neemseto® and the essential oil of F. vulgare showed positive ri increasing the population. The coefficients of determination (R2 of regression lines ranged from 0.46 to 0.85. The essential oils of C. winterianus, C. ambrosioides and P. aduncum were not statistically significant precluding the establishment of regression lines.Inseticidas botânicos têm sido estudados, visando o controle alternativo de pragas. O presente trabalho objetivou estudar os efeitos desses inseticidas sobre a taxa instantânea de crescimento populacional (ri de Aphis gossypii. Os inseticidas botânicos foram testados nas seguintes concentrações: Compostonat®, Rotenat-CE® e Neempro (0; 0,50; 0,75; 1,00; 1,25; 1,50 e 1,75%; Nautneem® e Neemseto® (0; 0,25; 0,50; 0,75 e 1,00%; e os óleos essenciais de Foeniculum vulgare Mill., Cymbopogom winterianus (L., Chenopodium ambrosioides L. e Piper aduncum L. (0; 0,0125; 0,025; 0,0375 e 0,05%. Discos de folhas de algodoeiro, cultivar CNPA 8H, com 5 cm de di

  19. Both point mutations and low expression levels of the nicotinic acetylcholine receptor β1 subunit are associated with imidacloprid resistance in an Aphis gossypii (Glover) population from a Bt cotton field in China.

    Science.gov (United States)

    Chen, Xuewei; Li, Fen; Chen, Anqi; Ma, Kangsheng; Liang, Pingzhuo; Liu, Ying; Song, Dunlun; Gao, Xiwu

    2017-09-01

    Aphis gossypii Glover is a destructive pest of numerous crops throughout the world. Although the expansion of Bt cotton cultivation has helped to control some insect pests, the damage from cotton aphids has not been mitigated. The evolution of aphid resistance to imidacloprid has made its chemical control more difficult since its introduction in 1991. Field populations of A. gossypii that were collected from different transgenic (Bt) cotton planting areas of China in 2014 developed different levels of resistance to imidacloprid. The IMI_R strain has developed high resistance to imidacloprid with the resistance ratio >1200-fold. Compared with the susceptible IMI_S strain, the IMI_R strain also developed a high level cross resistance to sulfoxaflor and acetamiprid. The limited synergism with either PBO or DEF suggests that resistance may be due to the site mutation of molecular target rather than to enhanced detoxification. Three target-site mutations within the nicotinic acetylcholine receptor (nAChR) β1 subunit were detected in the IMI_R strain. The R81T mutation has been reported to be responsible for imidacloprid resistance in A. gossypii and M. persicae. Both V62I and K264E were first detected in A. gossypii. These point mutations are also present in field populations, suggesting that they play a role in the resistance to imidacloprid. Furthermore, the expression level of transcripts encoding β1 subunit was decreased significantly in the IMI_R strain compared with the IMI_S strain, suggesting that both point mutations and the down-regulation of nAChR β1 subunit expression may be involved in the resistance mechanism for imidacloprid in A. gossypii. These results should be useful for the management of imidacloprid-resistant cotton aphids in Bt cotton fields in China. Copyright © 2016 Elsevier B.V. All rights reserved.

  20. Host Range Specificity of Scymnus camptodromus (Coleoptera: Coccinellidae), A Predator of Hemlock Woolly Adelgid (Hemiptera: Adelgidae).

    Science.gov (United States)

    Limbu, Samita; Cassidy, Katie; Keena, Melody; Tobin, Patrick; Hoover, Kelli

    2016-02-01

    Scymnus (Neopullus) camptodromus Yu and Liu (Coleoptera: Coccinellidae) was brought to the United States from China as a potential biological control agent for hemlock woolly adelgid (Adelges tsugae Annand) (Hemiptera: Adelgidae). Scymnus camptodromus phenology is closely synchronized with that of A. tsugae and has several characteristics of a promising biological control agent. As a prerequisite to field release, S. camptodromus was evaluated for potential nontarget impacts. In host range studies, the predator was given the choice of sympatric adelgid and nonadelgid prey items. Nontarget testing showed that S. camptodromus will feed to some degree on other adelgid species, but highly prefers A. tsugae. We also evaluated larval development of S. camptodromus on pine bark adelgid (Pineus strobi (Hartig)) (Hemiptera: Adelgidae) and larch adelgid (Adelges laricis Vallot) (Hemiptera: Adelgidae); a small proportion of predator larvae was able to develop to adulthood on P. strobi or A. laricis alone. Scymnus camptodromus showed no interest in feeding on woolly alder aphid (Paraprociphilus tessellatus Fitch) (Hemiptera: Aphididae) or woolly apple aphid (Eriosoma lanigerum (Hausmann)) (Hemiptera: Aphididae), and minimal interest in cotton aphid (Aphis gossypii Glover) (Hemiptera: Aphididae) in choice and no-choice experiments. Scymnus camptodromus females did not oviposit on any host material other than A. tsugae-infested hemlock. Under the circumstances of the study, S. camptodromus appears to be a specific predator of A. tsugae, with minimal risk to nontarget species. Although the predator can develop on P. strobi, the likelihood that S. camptodromus would oviposit on pine hosts of this adelgid is small.

  1. Separate and Combined Effects of Mentha piperata and Mentha pulegium Essential Oils and a Pathogenic Fungus Lecanicillium muscarium Against Aphis gossypii (Hemiptera: Aphididae).

    Science.gov (United States)

    Ebadollahi, Asgar; Davari, Mahdi; Razmjou, Jabrael; Naseri, Bahram

    2017-06-01

    In the present study, the toxicity of essential oils of Mentha piperata L. and Mentha pulegium L. and pathogenicity of Lecanicillium muscarium (Zare & Gams) were studied in the melon aphid, Aphis gossypii Glover. Analyses of the essential oils by GC-MS indicated limonene (27.28%), menthol (24.71%), menthone (14.01%), and carvol (8.46%) in the M. piperata essential oil and pulegone (73.44%), piperitenone (5.49%), decane (4.99%), and limonene (3.07%) in the essential oil of M. pulegium as the main components. Both essential oils and the pathogenic fungus had useful toxicity against A. gossypii. Probit analysis indicated LC50 values (lethal concentrations to kill 50% of population; 95% confidence limits in parentheses) of M. piperata and M. pulegium essential oils as 15.25 (12.25-19.56) and 23.13 (19.27-28.42) µl/liter air, respectively. Susceptibility to the pathogenic fungus increased with exposure time. Aphid mortality also increased when the essential oils were combined with L. muscarium, although the phenomena was additive rather than synergistic. Mycelial growth inhibition of L. muscarium exposed to the essential oils was also very low. Based on our results, M. piperata and M. pulegium essential oils and the pathogenic fungus L. muscarium have some potential for management of A. gossypii. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  2. National Plant Diagnostic Network, Taxonomic training videos: Aphids under the microscope - Aphis gossypii

    Science.gov (United States)

    Training is a critical part of aphid (Hemiptera: Aphididae) identification. This video provides provides training to identify the cotton aphid, Aphis gossypii, using a compound microscope and an electronic identification key called “LUCID.” The video demonstrates key morphological structures that ca...

  3. Plasticity in host utilization by two host-associated populations of Aphis gossypii Glover.

    Science.gov (United States)

    Barman, A K; Gadhave, K R; Dutta, B; Srinivasan, R

    2018-06-01

    Biological and morphological plasticity in polyphagous insect herbivores allow them to exploit diverse host plant species. Geographical differences in resource availability can lead to preferential host exploitation and result in inconsistent host specialization. Biological and molecular data provide insights into specialization and plasticity of such herbivore populations. In agricultural landscapes, Aphis gossypii encounters several crop and non-crop hosts, which exist in temporal and spatial proximity. We investigated the host-specialization of two A. gossypii host-associated populations (HAPs), which were field collected from cotton and squash (cotton-associated population and melon-associated population), and later maintained separately in the greenhouse. The two aphid populations were exposed to seven plant species (cotton, okra, watermelon, squash, cucumber, pigweed, and morning glory), and evaluated for their host utilization plasticity by estimating aphid's fitness parameters (nymphal period, adult period, fecundity, and intrinsic rate of increase). Four phenotypical characters (body length, head capsule width, hind tibia length and cornicle length) were also measured from the resulting 14 different HAP × host plant combinations. Phylogenetic analysis of mitochondrial COI sequences showed no genetic variation between the two HAPs. Fitness parameters indicated a significant variation between the two aphid populations, and the variation was influenced by host plants. The performance of melon-aphids was poor (up to 89% reduction in fecundity) on malvaceous hosts, cotton and okra. However, cotton-aphids performed better on cucurbitaceous hosts, squash and watermelon (up to 66% increased fecundity) compared with the natal host, cotton. Both HAPs were able to reproduce on two weed hosts. Cotton-aphids were smaller than melon-aphids irrespective of their host plants. Results from this study suggest that the two HAPs in the study area do not have strict host

  4. Primeiro Registro de Afídeos (Hemiptera: Aphidoidea em Carambola (Averrhoa carambola L. no Brasil

    Directory of Open Access Journals (Sweden)

    Suzan Cunha

    2016-12-01

    Abstract. The starfruit (Averrhoa carambola L. has origin Asiatic and was introduced in Brazil in 1817, since then has increased its cultivation area in the country. The plant is attacked by few insects like flies and bugs. This work reports the presence of Aphis gossypii Glover on A. carambola for the first time in Brazil.

  5. Tri-trophic interactions between Bt cotton, the herbivore Aphis gossypii Glover (Homoptera: Aphididae), and the predator Chrysopa pallens (Rambur) (Neuroptera: Chrysopidae).

    Science.gov (United States)

    Guo, Jian-Ying; Wan, Fang-Hao; Dong, Liang; Lövei, Gábor L; Han, Zhao-Jun

    2008-02-01

    Tri-trophic impacts of transgenic Bacillus thuringiensis (Bt) cotton GK12 and NuCOTN 99B were studied using a predator, the great lacewing Chrysopa pallens (Rambur), and its prey, the cotton aphid Aphis gossypii Glover, in laboratory feeding experiments. The parental nontransgenic cotton cultivar of GK12 was used as control. The predator was fed with uniform (aphids from a single cultivar) or mixed prey (aphids from the three cotton cultivars provided on alternate days). Mortality and development of the immature stages, pupal body mass, adult sex ratio, fecundity, and egg viability of C. pallens were measured. When fed GK12-originated aphid prey, pupal body mass of C. pallens was significantly higher than that of the control, more females emerged, and these females laid significantly more eggs. Other parameters were not impacted. Females emerging from larvae maintained on NuCOTN 99B-originated prey laid fewer eggs than those maintained on GK12. Other measurements did not differ significantly between the two Bt cotton cultivars. Compared with the control, mixed feeding significantly prolonged pupal development time and increased pupal body mass and percentage of females but did not affect other parameters. These results indicate that C. pallens is sensitive to aphid prey from different cotton cultivars. Transgenic Bt cotton GK12-originated aphid prey has no adverse impact on survival, development, and fecundity of C. pallens. Between the two Bt cotton cultivars, NuCOTN 99B-originated aphid prey provided to C. pallens in the larval stage may lower female fecundity. Mixed feeding of C. pallens with the two Bt cotton-originated prey and non-Bt prey may have some adverse impacts on pupal development.

  6. Plantas hospederas de Aphis gossypii (Aphididae), vector de virus del melón Cucumis melo (Cucurbitaceae) en Costa Rica

    OpenAIRE

    Sánchez, M.V.; Agüero, R.; Rivera, C.

    2001-01-01

    Se identificaron las especies hospederas naturales de Aphis gossypii Glover (Aphididae: Homoptera) en plantaciones comerciales de melón para la exportación en Costa Rica. El estudio se realizó en dos fincas, ubicadas una en la provincia de Guanacaste y la otra en la provincia de Puntarenas, correspondientes a dos zonas de vida vegetal diferentes. Se identificaron como especies hospederas del áfido todas aquellas especies vegetales en las que se observó la presencia del áfido en su forma ápter...

  7. [Host plants of Aphis gossypii (Aphididae), vector of virus of Cucumis melo melon (Cucurbitaceae) in Costa Rica].

    Science.gov (United States)

    Sánchez, M V; Agüero, R; Rivera, C

    2001-03-01

    Plant species associated with commercial melon crops and surrounding areas were examined to identity the natural host plants of Aphis gossypii Glover. The study was conducted in two farms located in different melon production areas and plant life zones of Costa Rica. Plant species diversity, percent coverage and distribution over time were recorded during one year. Differences between locations were observed. A total of 86 plant species (49 families) and 72 plant species (40 families) were identified associated to the crop in farms A and B, respectively. In both farms a total of 24 species plants (16 families) were colonized by A. gossypii and 16 (10 families) are new reports of host plant species for this aphid. The new reports are: Justicia comata, Tetramerium nervosum, Alternanthera pubiflora, Cassia massoni, C. reticulata, Cleome viscosa, C. spinosa, Croton argenteus, Caperonia palustris, Chamaesyce gyssopilopia, Phyllantus amarus, Sida decumbens, Ludwigia erecta, Passiflora foetida, Guazuma ulmifolia and Corchorus orinocensis.

  8. Population dynamics of Aphis gossypii Glover and in sole and intercropping systems of cotton and cowpea.

    Science.gov (United States)

    Fernandes, Francisco S; Godoy, Wesley A C; Ramalho, Francisco S; Garcia, Adriano G; Santos, Bárbara D B; Malaquias, José B

    2018-01-01

    Population dynamics of aphids have been studied in sole and intercropping systems. These studies have required the use of more precise analytical tools in order to better understand patterns in quantitative data. Mathematical models are among the most important tools to explain the dynamics of insect populations. This study investigated the population dynamics of aphids Aphis gossypii and Aphis craccivora over time, using mathematical models composed of a set of differential equations as a helpful analytical tool to understand the population dynamics of aphids in arrangements of cotton and cowpea. The treatments were sole cotton, sole cowpea, and three arrangements of cotton intercropped with cowpea (t1, t2 and t3). The plants were infested with two aphid species and were evaluated at 7, 14, 28, 35, 42, and 49 days after the infestations. Mathematical models were used to fit the population dynamics of two aphid species. There were good fits for aphid dynamics by mathematical model over time. The highest population peak of both species A. gossypii and A. craccivora was found in the sole crops, and the lowest population peak was found in crop system t2. These results are important for integrated management programs of aphids in cotton and cowpea.

  9. Factors affecting herbivory of Thrips palmi (Thysanoptera: Thripidae and Aphis gossypii (Homoptera: Aphididae on the eggplant (Solanum melongena

    Directory of Open Access Journals (Sweden)

    Germano Leão Demolin Leite

    2006-05-01

    Full Text Available The objective of this study was to evaluate effects of total rainfall, mean temperature, natural enemies, chemical composition of leaves, levels of nitrogen and potassium on leaves and density of leaf trichomes on attack intensity of Thrips palmi Karny (Thysanoptera: Thripidae and Aphis gossypii (Glover (Homoptera: Aphididae on plantations of the eggplant (Solanum melongena in two regions of Minas Gerais, Brazil. Higher numbers of A. gossypii/leaf and T. palmi/leaf were observed in plantations of this eggplant in the Municipalities of Viçosa and Guidoval, respectively. Guidoval had a rainy and hotter weather than Viçosa. T. palmi was almost positivelly correlated with rainfall (r= 0.49, P= 0.0538 while A. gossypii seemed to be more affected by mean temperature (r= -0.31; P= 0.1134. Higher number of aphids in eggplants in Viçosa than in Guidoval could be explained by the higher number of natural enemies such as Adialytus spp. (Hymenoptera: Braconidae, Cycloneda sanguinea (L. and Exochomus bimaculosus Mulsant (Coleoptera: Coccinellidae and Chrysoperla spp. (Neuroptera: Chrysopidae in this municipality. However, only Adialytus spp. was significativelly correlated with aphid populations. Higher number of T. palmi in eggplant plantations of Guidoval than in Viçosa could be due to the absence of its possible Eulophidae parasitoid in the first municipality. The spiders were significativelly correlated with this pest in both municipalities.O objetivo deste estudo foi avaliar os efeitos de pluviosidade total, temperatura média, inimigos naturais, composição química foliar, níveis de nitrogênio e potássio foliar e densidade de tricomas na intensidade de ataque de Thrips palmi Karny (Thysanoptera: Thripidae e Aphis gossypii (Glover (Homoptera: Aphididae em plantações de berinjela (Solanum melongena em dois municípios de Minas Gerais, Brasil. Observou-se maiores números de A. gossypii e T. palmi por folha em plantações de berinjela nos

  10. Plantas hospederas de Aphis gossypii (Aphididae, vector de virus del melón Cucumis melo (Cucurbitaceae en Costa Rica

    Directory of Open Access Journals (Sweden)

    M.V. Sánchez

    2001-03-01

    Full Text Available Se identificaron las especies hospederas naturales de Aphis gossypii Glover (Aphididae: Homoptera en plantaciones comerciales de melón para la exportación en Costa Rica. El estudio se realizó en dos fincas, ubicadas una en la provincia de Guanacaste y la otra en la provincia de Puntarenas, correspondientes a dos zonas de vida vegetal diferentes. Se identificaron como especies hospederas del áfido todas aquellas especies vegetales en las que se observó la presencia del áfido en su forma áptera. En ambas fincas el estudio se realizó en los alrededores y dentro del cultivo de melón. En la finca A en cinco diferentes comunidades vegetales (cultivo, canal de drenaje, charral, potrero mejorado y semi-bosque previamente seleccionadas y en la finca B en cuatro comunidades vegetales (cultivo, charral, pastizal natural y semi-bosque. Especímenes de las plantas colonizadas por áfidos y los áfidos colonizadores de cada especie fueron recolectadas para su identificación. Los áfidos se preservaron en alcohol al 70% v/v e identificaron utilizando las claves taxonómicas para áfidos, confirmándose como especie dominante a A. gossypii. La diversidad, cobertura y época de aparición de las especies de plantas hospederas fue monitoreada durante un año calendario en las diferentes comunidades vegetales presentes en ambas fincas, observándose diferencias entre las dos fincas estudiadas. En la finca A se observaron 86 diferentes especies vegetales, pertenecientes a 49 familias, asociadas al cultivo del melón, mientras que en la finca B se identificaron 72 especies de 40 familias. En conjunto para ambas fincas, un de 24 especies de plantas (16 familias estaban colonizadas por el áfido A. gossypii. De éstas, 16 especies de 10 familias, son reportes nuevos de plantas hospederas para este áfido: Justicia comata, Tetramerium nervosum, Alternanthera pubiflora, Cassia massoni, C. reticulata, Cleome viscosa, C. spinosa, Croton argenteus, Caperonia

  11. Mass rearing and augmentative biological control evaluation of Rhynocoris fuscipes (Hemiptera: Reduviidae) against multiple pests of cotton.

    Science.gov (United States)

    Tomson, Majesh; Sahayaraj, Kitherian; Kumar, Vivek; Avery, Pasco B; McKenzie, Cindy L; Osborne, Lance S

    2017-08-01

    Rhynocoris fuscipes (Fab.) (Hemiptera: Reduviidae) is a generalist predator of cotton pests and is commonly found inhabiting cotton-growing regions in southern India. With the goal of integrating this predator in standard management practices used against cotton pests on a commercial scale, (1) we developed a protocol for adult group rearing of this predator inside micro-environmental cages (MECs), and (2) we evaluated the biocontrol potential of mass-produced predators against cotton pests under potted and field conditions. Higher fecundity and adult longevity of R. fuscipes was recorded in the MECs than under natural growing conditions. The reduviid predator preferred stones and fallen leaves as hiding places in the MECs. The predator showed a higher biocontrol potential during the night hours against two pests, Phenacoccus solenopsis Tinsley and Dysdercus cingulatus (Fab.), than during the day under potted conditions. Under field conditions, R. fuscipes significantly reduced the population of Aphis gossypii Glover, P. solenopsis, D. cingulatus and Helicoverpa armigera (Hübner) by 28, 70, 29 and 50%, respectively. No negative impact of R. fuscipes was reported on other natural enemies present in the cotton agroecosystem. Significantly higher crop yield and cost benefit ratio were observed in R. fuscipes-released plots than in the control plots. The results suggest that R. fuscipes can be mass produced efficiently under controlled conditions in MECs, and used in an integrated management program for multiple cotton pests. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  12. Effect of alternative prey on development and consumption of Orius insidiosus (Say) (Hemiptera, Anthocoridae) and oviposition behavior on chrysantemum cultivars

    International Nuclear Information System (INIS)

    Soglia, Maria da Conceicao M.; Bueno, Vanda Helena Paes; Carvalho, Livia Mendes

    2007-01-01

    This work aimed to evaluate the development time and the consumption of Orius insidiosus (Say, 1832) feeding on Aphis gossypii Glover, 1877 as well as its oviposition behavior on two chrysanthemum cut cultivars. The trials were conducted in climatic chamber at 25 ± 1 deg C, RH 70 ± 10% and 12h photo phase. Nymphs of the predator, less than 24h old, were kept individually in petri dishes (5cm) with 20 nymphs of A. gossypii (first, second and third instar) on leaf disc (4 cm) of each cultivar ('White Reagan' and 'Yellow Snowdon') in a layer of agar-water (1%). Petiole of each chrysanthemum cultivar as oviposition substrate was evaluated and the females were feeding on eggs of Anagasta kuehniella (Zeller, 1879). The predator complete its development feeding on A. gossypii kept in both cultivars. The duration of nymphal phase of O. insidiosus were 21.1 and 18.3 days on 'White Reagan' and 'Yellow Snowdon', respectively. The consumption of the females of O. insidiosus was higher (P<0.01) on A. gossypii in 'White Reagan' (2.63 nymphs) compared to the consumption in 'Yellow Snowdon' (0.7 nymphs). Females of O. insidiosus oviposited in petiole of both cultivars with 22.5 and 23.3 eggs/female on 'White Reagan' and 'Yellow Snowdon', respectively. Release of O. insidiosus on chrysanthemum crops could be important to decrease the A. gossypii population, as the predator completes its development having this aphid as prey, and the chrysanthemum cultivars offer conditions to colonization and establishment of O. insidiosus. (author)

  13. Effect of alternative prey on development and consumption of Orius insidiosus (Say) (Hemiptera, Anthocoridae) and oviposition behavior on chrysantemum cultivars; Efeito da presa alternativa no desenvolvimento e consumo de Orius insidiosus (Say) (Hemiptera, Anthocoridae) e comportamento de oviposicao em cultivares de crisantemo

    Energy Technology Data Exchange (ETDEWEB)

    Soglia, Maria da Conceicao M. [Universidade Federal da Bahia (UFBA), Cruz das Almas, BA (Brazil). Centro de Ciencias Agrarias e Ambientais], e-mail: mcsoglia@yahoo.com.br; Bueno, Vanda Helena Paes; Carvalho, Livia Mendes [Universidade Federal de Lavras (UFLA), MG (Brazil). Dept. de Entomologia], e-mail: vhpbueno@ufla.br

    2007-10-15

    This work aimed to evaluate the development time and the consumption of Orius insidiosus (Say, 1832) feeding on Aphis gossypii Glover, 1877 as well as its oviposition behavior on two chrysanthemum cut cultivars. The trials were conducted in climatic chamber at 25 {+-} 1 deg C, RH 70 {+-} 10% and 12h photo phase. Nymphs of the predator, less than 24h old, were kept individually in petri dishes (5cm) with 20 nymphs of A. gossypii (first, second and third instar) on leaf disc (4 cm) of each cultivar ('White Reagan' and 'Yellow Snowdon') in a layer of agar-water (1%). Petiole of each chrysanthemum cultivar as oviposition substrate was evaluated and the females were feeding on eggs of Anagasta kuehniella (Zeller, 1879). The predator complete its development feeding on A. gossypii kept in both cultivars. The duration of nymphal phase of O. insidiosus were 21.1 and 18.3 days on 'White Reagan' and 'Yellow Snowdon', respectively. The consumption of the females of O. insidiosus was higher (P<0.01) on A. gossypii in 'White Reagan' (2.63 nymphs) compared to the consumption in 'Yellow Snowdon' (0.7 nymphs). Females of O. insidiosus oviposited in petiole of both cultivars with 22.5 and 23.3 eggs/female on 'White Reagan' and 'Yellow Snowdon', respectively. Release of O. insidiosus on chrysanthemum crops could be important to decrease the A. gossypii population, as the predator completes its development having this aphid as prey, and the chrysanthemum cultivars offer conditions to colonization and establishment of O. insidiosus. (author)

  14. A comparative study on the effects of electron beam irradiation on imidacloprid-resistant and -susceptible Aphis gossypii (Hemiptera: Aphididae)

    Science.gov (United States)

    Yun, Seung-Hwan; Koo, Hyun-Na; Lee, Seon-Woo; Kim, Hyun Kyung; Kim, Yuri; Han, Bumsoo; Kim, Gil-Hah

    2015-07-01

    The melon and cotton aphid, Aphis gossypii, is a polyphagous insect pest. This study compared the development, reproduction, DNA damage, recovery, and gene expression in imidacloprid-resistant (IMI-R) and -susceptible (S) strains of A. gossypii by electron beam irradiation. When 1st instar nymphs were irradiated with 100 Gy, the fecundity (nymphs of F1 generation) of the resultant adults were completely inhibited. When adults were irradiated with 200 Gy, the number of total 1st instar nymphs produced per adult was 3.0±1.7 and 1.9±1.4 in the S and IMI-R strains, respectively, but adult development was completely suppressed. However, electron beam irradiation did not affect adult longevity in either the S or IMI-R strain. There was no statistically significant difference between the effect of irradiation on the S and IMI-R strains. Therefore, electron beam irradiation at 200 Gy could be used as a phytosanitary irradiation treatment for both S and IMI-R strains of A. gossypii. The DNA damage caused by electron beam irradiation was evaluated by an alkaline comet assay. Exposure to an electron beam (50 Gy) induced DNA damage that was repaired to a similar level as the untreated control group (0 Gy) over time. However, at more than 100 Gy, the DNA damage was not completely repaired. The expression of P450, HSP70, cuticle protein, and elongation factor genes were higher in the IMI-R strain than in the S strain.

  15. Hábito de crescimento de Colletotrichum gossypii e C. gossypii var. Cephalosporioides em sementes de algodoeiro Growth habit of Colletotrichum gossypii and C. Gossypii var. Cephalosporioides on cotton seeds

    Directory of Open Access Journals (Sweden)

    Maria Aparecida de Souza Tanaka

    1996-01-01

    Full Text Available Observações sobre o hábito de crescimento de Colletotrichum gossypii e C. gossypii var. cephalosporioides em sementes de algodoeiro, inoculadas artificialmente e incubadas a 20-22°C durante cinco a sete dias, evidenciaram as seguintes características: (a em raízes: acérvulos isolados ou em grupos, massa conidial cor branco-suja, alaranjada ou salmão (mais freqüente, setas marrom-escuras, muitas vezes encobertas pela matriz gelatinosa; conídios produzidos também no micélio aéreo ou nas extremidades das setas, onde ficam aderidos, formando pequenos aglomerados; (b na superfície das sementes: conídios produzidos nos ápices de setas que emergem diretamente do tegumento, ficando aderidos uns aos outros, formando cachos, semelhantes a cadeias, que são vistos brilhantes sob a luz, em estereomicroscópio. As setas férteis são formadas também no micélio aéreo que recobre as sementes, geralmente após cinco dias de incubação. Os acérvulos com massa conidial raramente são visíveis, exceto em sementes danificadas ou mortas. Como característica de C. gossypii, observou-se que as sementes exibem, de modo geral, uma coloração rosada, em decorrência da abundante esporulação; a ausência ou escassez de micélio aéreo e as setas curtas resultam em um crescimento rente ao tegumento e aspecto compacto. Comparativamente, nas sementes com C. gossypii var. cephalosporioides, as setas são mais longas e menos densas; o micélio aéreo com setas férteis ocorre com mais freqüência, conferindo às sementes tonalidades acinzentadas e aspecto solto. A constatação de setas férteis em lesões foliares de ramulose evidencia que, no campo, essas estruturas podem funcionar como autênticos conidióforos, desempenhando um importante papel epidemiológico, ao possibilitar a disseminação dos esporos pelos ventos, a longas distâncias.The growth habit of Colletotrichum gossypii and C. gossypii var. cephalosporioides on artificially

  16. The behavior of Aphis gossypii and Aphis craccivora (Hemiptera: Aphididae) and of their predator Cycloneda sanguinea (Coleoptera: Coccinellidae) in cotton-cowpea intercropping systems.

    Science.gov (United States)

    Fernandes, Francisco S; Godoy, Wesley A C; Ramalho, Francisco S; Malaquias, José B; Santos, Bárbara D B

    2018-01-01

    The intercropping is an important cultural practice commonly used in pest management. It is based on the principle that increased plant diversity in the agro-ecosystem can lead to reductions of pest populations in the crop. The current study aimed to assess the impact the colored fiber cotton-cowpea intercropped systems on Aphis gossypii and Aphis craccivora and on their predator Cycloneda sanguinea and the losses and the dispersion behavior of these aphids and their predator in these cropping systems. The experiment had a randomized block experimental design with two bioassays and four treatments. The number of apterous and alate aphids (A. gossypii) per cotton plant was 1.46 and 1.73 or 1.97 and 2.19 times highest in the solid cotton system than that found in the cotton-cowpea intercropped systems (S1) and (S2), respectively. On the other hand, the cotton-cowpea intercropped systems (S1 and S2) reduced, respectively, in 43% and 31% the number of apterousA. gossypiiper cotton plant compared to the control. Implementing cotton-cowpea intercropped system in the S1 scheme reduced A. gossypii infestation, favored the multiplication of C. sanguinea, and allowed obtaining heavier open bolls.

  17. A comparative study on the effects of electron beam irradiation on imidacloprid-resistant and -susceptible Aphis gossypii (Hemiptera: Aphididae)

    International Nuclear Information System (INIS)

    Yun, Seung-Hwan; Koo, Hyun-Na; Lee, Seon-Woo; Kim, Hyun Kyung; Kim, Yuri; Han, Bumsoo; Kim, Gil-Hah

    2015-01-01

    The melon and cotton aphid, Aphis gossypii, is a polyphagous insect pest. This study compared the development, reproduction, DNA damage, recovery, and gene expression in imidacloprid-resistant (IMI-R) and -susceptible (S) strains of A. gossypii by electron beam irradiation. When 1st instar nymphs were irradiated with 100 Gy, the fecundity (nymphs of F 1 generation) of the resultant adults were completely inhibited. When adults were irradiated with 200 Gy, the number of total 1st instar nymphs produced per adult was 3.0±1.7 and 1.9±1.4 in the S and IMI-R strains, respectively, but adult development was completely suppressed. However, electron beam irradiation did not affect adult longevity in either the S or IMI-R strain. There was no statistically significant difference between the effect of irradiation on the S and IMI-R strains. Therefore, electron beam irradiation at 200 Gy could be used as a phytosanitary irradiation treatment for both S and IMI-R strains of A. gossypii. The DNA damage caused by electron beam irradiation was evaluated by an alkaline comet assay. Exposure to an electron beam (50 Gy) induced DNA damage that was repaired to a similar level as the untreated control group (0 Gy) over time. However, at more than 100 Gy, the DNA damage was not completely repaired. The expression of P450, HSP70, cuticle protein, and elongation factor genes were higher in the IMI-R strain than in the S strain. - Highlights: • Electron beam irradiation induces abnormal development in both the IMI-R and -S strain. • Electron beam irradiation induces DNA damage in both the S and IMI-R strain. • The expression of several specific genes were higher in the IMI-R strain. • 200 Gy could be used as a phytosanitary treatment for both strains of this species

  18. Molecular determinants of sporulation in Ashbya gossypii.

    Science.gov (United States)

    Wasserstrom, Lisa; Lengeler, Klaus B; Walther, Andrea; Wendland, Jürgen

    2013-09-01

    Regulation of development and entry into sporulation is critical for fungi to ensure survival of unfavorable environmental conditions. Here we present an analysis of gene sets regulating sporulation in the homothallic ascomycete Ashbya gossypii. Deletion of components of the conserved pheromone/starvation MAP kinase cascades, e.g., STE11 and STE7, results in increased sporulation. In kar3 mutants sporulation is severely reduced, while deletion of KAR4 as well as of homologs of central Saccharomyces cerevisiae regulators of sporulation, IME1, IME2, IME4, and NDT80, abolishes sporulation in A. gossypii. Comparison of RNAseq transcript profiles of sporulation-deficient mutants identified a set of 67 down-regulated genes, most of which were up-regulated in the oversporulating ste12 mutant. One of these differentially expressed genes is an endoglucanase encoded by ENG2. We found that Eng2p promotes hyphal fragmentation as part of the developmental program of sporulation, which generates single-celled sporangia. Sporulation-deficient strains are arrested in their development but form sporangia. Supply of new nutrients enabled sporangia to return to hyphal growth, indicating that these cells are not locked in meiosis. Double-strand break (DSB) formation by Spo11 is apparently not required for sporulation; however, the absence of DMC1, which repairs DSBs in S. cerevisiae, results in very poor sporulation in A. gossypii. We present a comprehensive analysis of the gene repertoire governing sporulation in A. gossypii and suggest an altered regulation of IME1 expression compared to S. cerevisiae.

  19. Blockage of the pyrimidine biosynthetic pathway affects riboflavin production in Ashbya gossypii.

    Science.gov (United States)

    Silva, Rui; Aguiar, Tatiana Q; Domingues, Lucília

    2015-01-10

    The Ashbya gossypii riboflavin biosynthetic pathway and its connection with the purine pathway have been well studied. However, the outcome of genetic alterations in the pyrimidine pathway on riboflavin production by A. gossypii had not yet been assessed. Here, we report that the blockage of the de novo pyrimidine biosynthetic pathway in the recently generated A. gossypii Agura3 uridine/uracil auxotrophic strain led to improved riboflavin production on standard agar-solidified complex medium. When extra uridine/uracil was supplied, the production of riboflavin by this auxotroph was repressed. High concentrations of uracil hampered this (and the parent) strain growth, whereas excess uridine favored the A. gossypii Agura3 growth. Considering that the riboflavin and the pyrimidine pathways share the same precursors and that riboflavin overproduction may be triggered by nutritional stress, we suggest that overproduction of riboflavin by the A. gossypii Agura3 may occur as an outcome of a nutritional stress response and/or of an increased availability in precursors for riboflavin biosynthesis, due to their reduced consumption by the pyrimidine pathway. Copyright © 2014 Elsevier B.V. All rights reserved.

  20. Cucumber Plants Baited with Methyl Salicylate Accelerates Scymnus (Pullus) sodalis (Coleoptera: Coccinellidae) Visiting to Reduce Cotton Aphid (Hemiptera: Aphididae) Infestation.

    Science.gov (United States)

    Dong, Y J; Hwang, S Y

    2017-10-01

    The cotton aphid, Aphis gossypii (Glover) (Hemiptera: Aphididae), is a major pest of many crops worldwide and a major cucumber plant pest in Taiwan. Because cotton aphids rapidly develop insecticide resistance and because of the insecticide residue problem, a safe and sustainable method is required to replace conventional chemical control methods. Methyl salicylate (MeSA), a herbivore-induced plant volatile, has been shown to affect aphids' behavior and attract the natural enemies of aphids for reducing their population. Therefore, this study examined the direct effects of MeSA on cotton aphids' settling preference, population development, and attractiveness to natural enemies. The efficiency of using MeSA and the commercial insecticide pymetrozine for reducing the cotton aphid population in laboratory and outdoor cucumber plant pot was also examined. The results showed no difference in winged aphids' settling preference and population development between the MeSA and blank treatments. Cucumber plants infested with cotton aphids and baited with 0.1% or 10% MeSA contained significantly higher numbers of the natural enemy of cotton aphids, namely Scymnus (Pullus) sodalis (Weise) (Coleoptera: Coccinellidae), and MeSA-treated cucumber plants contained a lower number of aphids. Significantly lower cotton aphid numbers were found on cucumber plants within a 10-m range of MeSA application. In addition, fruit yield showed no difference between the MeSA and pymetrozine treatments. According to our findings, 0.1% MeSA application can replace insecticides as a cotton aphid control tool. However, large-scale experiments are necessary to confirm its efficiency and related conservation biological control strategies before further use. © The Author 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  1. The joint action of destruxins and botanical insecticides (rotenone, azadirachtin and paeonolum) against the cotton aphid, Aphis gossypii Glover.

    Science.gov (United States)

    Yi, Fei; Zou, Chunhua; Hu, Qiongbo; Hu, Meiying

    2012-06-18

    The joint action of destruxins and three botanical insecticides, rotenone (Rot), azadirachtin (Aza) and paeonolum (Pae) against the cotton aphid, Aphis gossypii, was bioassayed. In laboratory experiment, several synergistic groups of destruxins with botanical insecticides were found by means of Sun's Co-toxicity Coefficients (CTC) and Finney's Synergistic Coefficient (SC). The best synergistic effect was discovered in the ratio group Des/Rot 1/9 with the CTC or SC and LC₅₀ values of 479.93 or 4.8 and 0.06 μg/mL, respectively. The second and third synergistic effects were recorded in the ratio groups Des/Rot 7/3 and 9/1. Although the ratio groups Des/Aza 6/4, Des/Pae 4/6, 3/7 and 2/8 indicated synergism by Sun's CTC, they were determined as additive actions by Finney's SC. Additive actions were also found in most of the ratio groups, but antagonism were recorded only in three ratio groups: Des/Pae 9/1, 7/3 and 6/4. In greenhouse tests, the highest mortality was 98.9% with the treatment Des/Rot 1/9 at 0.60 μg/mL, meanwhile, the treatments Des/Pae 4/6 and Des/Aza 6/4 had approximately 88% mortality.

  2. Engineering Ashbya gossypii strains for de novo lipid production using industrial by-products.

    Science.gov (United States)

    Lozano-Martínez, Patricia; Buey, Rubén M; Ledesma-Amaro, Rodrigo; Jiménez, Alberto; Revuelta, José Luis

    2017-03-01

    Ashbya gossypii is a filamentous fungus that naturally overproduces riboflavin, and it is currently exploited for the industrial production of this vitamin. The utilization of A. gossypii for biotechnological applications presents important advantages such as the utilization of low-cost culture media, inexpensive downstream processing and a wide range of molecular tools for genetic manipulation, thus making A. gossypii a valuable biotechnological chassis for metabolic engineering. A. gossypii has been shown to accumulate high levels of lipids in oil-based culture media; however, the lipid biosynthesis capacity is rather limited when grown in sugar-based culture media. In this study, by altering the fatty acyl-CoA pool and manipulating the regulation of the main ∆9 desaturase gene, we have obtained A. gossypii strains with significantly increased (up to fourfold) de novo lipid biosynthesis using glucose as the only carbon source in the fermentation broth. Moreover, these strains were efficient biocatalysts for the conversion of carbohydrates from sugarcane molasses to biolipids, able to accumulate lipids up to 25% of its cell dry weight. Our results represent a proof of principle showing the promising potential of A. gossypii as a competitive microorganism for industrial biolipid production using cost-effective feed stocks. © 2016 The Authors. Microbial Biotechnology published by John Wiley & Sons Ltd and Society for Applied Microbiology.

  3. Type of prey influences biology and consumption rate of Orius insidiosus (Say (Hemiptera, Anthocoridae

    Directory of Open Access Journals (Sweden)

    Simone M. Mendes

    2002-01-01

    Full Text Available Generalist predators are capable of consuming different types of prey, and as each prey may have distinct nutritional values, each may have a distinct impact on the biology of the predator. Therefore, the aim of this study was to determine how the consumption of different prey influences certain biological characteristics and the predatory capacity of Orius insidiosus (Say. The investigation was performed in climatic chamber at 25 ±1 ºC, RH 70 ± 10% and fotophase 12. Eggs of Anagasta kuehniella (Zeller, adults of Caliothrips phaseoli (Hood and nymphs of Aphis gossypii Glover were used as prey and were provided daily ad libitum for all the mobile stages of the predator. The results showed that biological parameters of O. insidiosus are affected differently depending on the type of prey ingested. The development time of the nymphal stage was 13.1, 11.23 and 10.25 days for O. insidiosus feeding on eggs of A. kuehniella, nymphs of A. gossypii and adults of C. phaseoli, respectively. Longevity was five times larger for adults fed on eggs of A. kuehniella (56.25 days compared to that of adults that preyed on nymphs of A. gossypii (11.44 days, and four times larger when the prey were adults of C. phaseoli (13.58 days. The consumption of eggs of A. kuehniella by predator females resulted in a shorter pre-oviposition period (3.2 days and a longer oviposition period (44.4 days when compared to the consumption of other types of prey. In addition, fecundity was increased with the consumption of eggs of A. kuehniella (195.25 eggs laid / female when compared to feeding on the other prey, C. phaseoli (70.00 eggs laid / female or A. gossypii (22.50 eggs laid / female. However, the consumption of aphids was larger (148.28 nymphs/ nymphal stage than that of thrips (74.10 thrips / nymphal stage or eggs of A. kuehniella (37.03 eggs /nymphal stage for all of the nymphal stages of the predator. The results indicate that the eggs of A. kuehniella are the type of

  4. Metabolic engineering of riboflavin production in Ashbya gossypii through pathway optimization.

    Science.gov (United States)

    Ledesma-Amaro, Rodrigo; Serrano-Amatriain, Cristina; Jiménez, Alberto; Revuelta, José Luis

    2015-10-14

    The industrial production of riboflavin mostly relies on the microbial fermentation of flavinogenic microorganisms and Ashbya gossypii is the main industrial producer of the vitamin. Accordingly, bioengineering strategies aimed at increasing riboflavin production in A. gossypii are highly valuable for industry. We analyze the contribution of all the RIB genes to the production of riboflavin in A. gossypii. Two important metabolic rate-limiting steps that limit the overproduction of riboflavin have been found: first, low mRNA levels of the RIB genes hindered the overproduction of riboflavin; second, the competition of the AMP branch for purinogenic precursors also represents a limitation for riboflavin overproduction. Thus, overexpression of the RIB genes resulted in a significant increase in riboflavin yield. Moreover, both the inactivation and the underexpression of the ADE12 gene, which controls the first step of the AMP branch, also proved to have a positive effect on riboflavin production. Accordingly, a strain that combines both the overexpression of the RIB genes and the underexpression of the ADE12 gene was engineered. This strain produced 523 mg/L of riboflavin (5.4-fold higher than the wild-type), which is the highest titer of riboflavin obtained by metabolic engineering in A. gossypii so far. Riboflavin production in A. gossypii is limited by a low transcription activity of the RIB genes. Flux limitation towards AMP provides committed substrate GTP for riboflavin overproduction without detrimental effects on biomass formation. A multiple-engineered Ashbya strain that produces up to 523 mg/L of riboflavin was generated.

  5. African Journal of Biotechnology - Vol 12, No 16 (2013)

    African Journals Online (AJOL)

    ... extracted from marine brown algae collected from Mandapam Island, India · EMAIL FREE ... Influence of plant growth regulators on somatic embryogenesis induction from ... Biological parameters of the non-target pest Aphis gossypii Glover ... for bacterial growth control · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT

  6. INDUCING RESISTANCE IN COTTON AGAINST COLLETOTRICHUM GOSSYPII VAR. CEPHALOSPORIOIDES WITH ESSENTIAL OILS

    Directory of Open Access Journals (Sweden)

    B. T. Santos

    2016-11-01

    Full Text Available This study aimed to evaluate the potential of essential oils of rosemary (Rosmarinus officinalis, baccharis (Baccharis trimera, lemon grass (Cymbopogon citratus, basil (Ocimum basilicum and eucalyptus (Corymbia citriodora in inducing resistance in cotton plants against C. gossypii var. cephalosporioides. The inductive effect of the essential oils was evaluated in plants growing in pots in the environment, which were treated with 1% essential oil at 47 days of age. 24 hours after elicitor treatment the plants were inoculated with a suspension of 1.5 x 105 conidia mL-1 of C. gossypii var. cephalosporioides. Five evaluations were performed disease and calculated the area under the disease progress curve. All essential oils showed potential for inducing resistance against cotton C. gossypii var. cephalosporioides.

  7. COMPARATIVE DEMOGRAPHICS OF A GENERALIST PREDATORY LADYBIRD ON FIVE APHID PREY: A LABORATORY STUDY

    Institute of Scientific and Technical Information of China (English)

    Omkar; AhmadPervez

    2004-01-01

    Prey driven demographic parameters of an aphidophagous ladybird, Propylea dissecta (Mulsant) were studied in attempt to answer how ladybird overcomes the problem of seasonally fluctuating food base. The ladybird reared for five generations in laboratory derived differential nutrition from five food sources (i.e. aphid species, Rhopalosiphum maidis (Fitch), Aphis craccivora Koch, Aphis gossypii Glover, Uroleucon compositae (Theobald) and Lipaphis erysimi (Kalt.)). The order of relative prey suitability was A. gossypii, A. craccivora, R. maidis, U. compositae and L.erysimi. Neonates suffered maximum mortality followed by eggs. Estimates of net reproductive rate,intrinsic rate of increase and finite rate of increase were highest (407.18, 0.2274 day-1, 1.2553 day-1) on A. gossypii and lowest (176.02, 0.1533 day-1, 1.1657 day-1) on L. erysimi. Generation time was shortest (26.43 days) on A. gossypii and longest (33.73 days) on L. erysimi. The present study thus,provides an explanation to the high incidence of P. dissecta on A. gossypii, as it experienced high intrinsic rate of increase and optimal values for related demographic parameters.

  8. The Joint Action of Destruxins and Botanical Insecticides (Rotenone, Azadirachtin and Paeonolum Against the Cotton Aphid, Aphis gossypii Glover

    Directory of Open Access Journals (Sweden)

    Meiying Hu

    2012-06-01

    Full Text Available The joint action of destruxins and three botanical insecticides, rotenone (Rot, azadirachtin (Aza and paeonolum (Pae against the cotton aphid, Aphis gossypii, was bioassayed. In laboratory experiment, several synergistic groups of destruxins with botanical insecticides were found by means of Sun’s Co-toxicity Coefficients (CTC and Finney’s Synergistic Coefficient (SC. The best synergistic effect was discovered in the ratio group Des/Rot 1/9 with the CTC or SC and LC50 values of 479.93 or 4.8 and 0.06 μg/mL, respectively. The second and third synergistic effects were recorded in the ratio groups Des/Rot 7/3 and 9/1. Although the ratio groups Des/Aza 6/4, Des/Pae 4/6, 3/7 and 2/8 indicated synergism by Sun’s CTC, they were determined as additive actions by Finney’s SC. Additive actions were also found in most of the ratio groups, but antagonism were recorded only in three ratio groups: Des/Pae 9/1, 7/3 and 6/4. In greenhouse tests, the highest mortality was 98.9% with the treatment Des/Rot 1/9 at 0.60 μg/mL, meanwhile, the treatments Des/Pae 4/6 and Des/Aza 6/4 had approximately 88% mortality.

  9. Insectes ravageurs et propriétés biocides de Jatropha curcas L. (Euphorbiaceae : synthèse bibliographique

    Directory of Open Access Journals (Sweden)

    Abdoul Habou, Z.

    2013-01-01

    Full Text Available Insect pests and biocidal properties of Jatropha curcas L. (Euphorbiaceae. A review. Jatropha curcas is a Euphorbiaceae shrub widely distributed in many tropical countries. Its seeds are rich in oil that can be used as biofuel in modified diesel engines. Several insect species, mainly belonging to Hemiptera, Coleoptera and Orthoptera, have been referenced as insect pests of J. curcas. These insects attack the plant and cause damage to fruits, inflorescences and leaves. The most frequently observed pests belong to the genus Pachycoris (Heteroptera: Scutelleridae, which are widely distributed in Mexico, Australia, United States of America, Brazil and Nicaragua. Pachycoris spp. cause significant damage to the fruits, leading to the malformation of seeds and a reduction in their oil content. Although Jatropha shrubs are subjected to insect infestations, the oil has been shown to demonstrate biocidal activity, including insecticidal effects against several insect pests, including Busseola fusca (Fuller (Lepidoptera: Noctuidae, Sesamia calamistis Hampson (Lepidoptera: Noctuidae, Aphis gossypii Glover (Homoptera: Aphididae and Callosobruchus chinensis L. (Coleoptera: Bruchidae. In the present paper, we summarize the work carried out on inventories of J. curcas insect pests as well as on the biocidal activity of its oil.

  10. The neotype barcode of the cotton aphid (Hemiptera: Aphididae: Aphis gossypii Glover, 1877) and a proposal for type barcodes

    Science.gov (United States)

    A type barcode is a DNA barcode unequivocally tied to an authoritatively identified specimen, preferably the primary type specimen. Type barcodes are analogous, albeit subordinate, to type specimens, providing a stable reference to which other barcodes can be compared. We here designate and describe...

  11. Floods of 1971 and 1972 on Glover Creek and Little River in southeastern Oklahoma

    Science.gov (United States)

    Thomas, Wilbert O.; Corley, Robert K.

    1973-01-01

    Heavy rains of December 9-10, 1971, and Oct. 30-31, 1972, caused outstanding floods on Glover Creek and Little River in McCurtain County in southeastern Oklahoma. This report presents hydrologic data that document the extent of flooding, flood profiles, and frequency of flooding on reaches of both streams. The data presented provide a technical basis for formulating effective flood-plain zoning that will minimize existing and future flood problems. The report also can be useful for locating waste-disposal and water-treatment facilities, and for the development of recreational areas. The area studied includes the reach of Little River on the Garvin and Idabel 7 1/2-minute quadrangles (sheet 1) and the reach of Glover Creek on the southwest quarter of the Golden 15-minute quadrangle (sheet 2). The flood boundaries delineated on the maps are the limits of flooding during the December 1971 and October 1972 floods. Any attempt to delineate the flood boundaries on streams in the study area other than Glover Creek and Little River was considered to be beyond the scope of this report. The general procedure used in defining the flood boundaries was to construct the flood profiles from high-water marks obtained by field surveys and by records at three stream-gaging stations (two on Little River and one on Glover Creek.). The extent of flooding was delineated on the topographic maps by using the flood profiles to define the flood elevations at various points along the channel and locating the elevations on the map by interpolating between contours (lines of equal ground elevation). In addition, flood boundaries were defined in places by field survey, aerial photographs, and information from local residents. The accuracy of the flood boundaries is consistent with the scale and contour interval of the maps (1 inch = 2,000 feet; contour interval 10 and 20 feet), which means the flood boundaries are drawn as accurately as possible on maps having 10- and 20-foot contour intervals.

  12. Leaf endophytic fungi of chili (Capsicum annuum and their role in the protection against Aphis gossypii (Homoptera: Aphididae

    Directory of Open Access Journals (Sweden)

    HENY HERNAWATI

    2011-10-01

    Full Text Available Hernawati H, Wiyono S, Santoso S (2011 Leaf endophytic fungi of chili (Capsicum annuum and their role in the protection against Aphis gossypii (Homoptera: Aphididae. Biodiversitas 12: 187-191. The objectives of the research were to study the diversity of leaf endophytic fungi of chili, and investigate its potency in protecting host plants against Aphis gossypii Glov. Endophytic fungi were isolated from chili leaves with two categories: aphid infested plants and aphid-free plants, collected from farmer’s field in Bogor, West Java. Abundance of each fungal species from leave samples was determined by calculating frequency of isolation. The isolated fungi were tested on population growth of A. gossypii. The fungal isolates showed suppressing effect in population growth test, was further tested on biology attributes i.e. life cycle, fecundity and body length. Five species of leaf endophytic fungi of chili were found i.e. Aspergillus flavus, Nigrospora sp., Coniothyrium sp., and SH1 (sterile hypha 1, SH2 (sterile hypha 2. Eventhough the number of endophytic fungi species in aphid-free and aphid-infested plant was same, the abundance of each species was different. Nigrospora sp., sterile hyphae 1 and sterile hyphae 2 was more abundant in aphid-free plants, but there was no difference in dominance of Aspergillus flavus and Coniothyrium sp. Nigrospora sp., SH1 and SH2 treatment reduced significantly fecundity of A. gossypii. Only SH2 treatment significantly prolonged life cycle and suppress body length, therefore the fungus had the strongest suppressing effect on population growth among fungi tested. The abundance and dominance of endophytic fungal species has relation with the infestation of A. gossypii in the field.

  13. Genetic variation and phylogeographic structure of the cotton aphid, Aphis gossypii, based on mitochondrial DNA and microsatellite markers.

    Science.gov (United States)

    Wang, Xing-Ya; Yang, Xian-Ming; Lu, Bin; Zhou, Li-Hong; Wu, Kong-Ming

    2017-05-15

    Aphis gossypii, one of the most important agricultural pests in the world, can cause serious economic losses in the main crop-producing areas. To clarify issues such as the genetic differentiation, genetic structure, and demographic history of A. gossypii populations, we used 10 nuclear microsatellite loci (SSR) and two mitochondrial gene sequences (COI and Cytb) to investigate genetic diversity and population structure of A. gossypii populations that were collected from 33 sampling sites in China from different climatic zones. SSR and mtDNA data suggested low to moderate levels of genetic diversity. A star-shaped network of mtDNA haplotypes indicated that the maternal ancestor of China cotton aphids likely originated in Xinjiang. The POPTREE, STRUCTURE and principal coordinate analysis (PCoA) revealed two genetic clusters: an eastern and a western region group. Isolation by distance (IBD) results showed a positive correlation between geographic distance and genetic distance in the vast eastern region but not in the western region. Neutrality testing and mismatch distribution analysis provided strong evidence for a recent rapid expansion in most populations. Genetic bottleneck was not detected in A. gossypii populations of China. The present work can help us to develop strategies for managing this pest.

  14. Variabilidade genética entre isolados de Colletotrichum gossypii do algodoeiro Genetic variability among the isolates of Colletotrichum gossypii of cotton

    Directory of Open Access Journals (Sweden)

    Yeshwant R. Mehta

    2010-03-01

    Full Text Available O algodoeiro é atacado por Colletotrichum gossypii (CG e C. gossypii var. cephalosporioides (CGC. Ambos os patógenos são transmitidos pela semente e sua distinção morfológica é extremamente difícil e inconsistente. Tentativas foram feitas no presente trabalho para verificar a variabilidade genética entre CG e CGC através de RAPD-PCR, ERIC- e REP-PCR e PCR-RFLP da região ITS rDNA. Foram utilizados 53 isolados coletados de sementes e folhas de plantas de diferentes cultivares nos estados do Paraná, São Paulo, Mato Grosso, Minas Gerais, e Paraiba, entre 1999 e 2003. Baseado em testes de patogenicidade, vinte e um isolados foram classificados como CG e 32 como CGC. Os resultados obtidos por RAPD-PCR, utilizando-se oito primers, revelaram dois grupos distintos sendo que o primeiro foi formado por 94% dos isolados de sementes e o segundo por 95% dos isolados de folhas. Na análise de ERIC- e REP-PCR, resultados semelhantes a RAPD foram obtidos, sendo que o primeiro grupo foi formado por 93% dos isolados provenientes das sementes e o segundo por 78% dos isolados provenientes das folhas. Quando o produto de amplificação da região ITS rDNA foi digerido com oito enzimas de restrição, um perfil de bandas semelhante para todos os isolados foi obtido. Resultados de RAPD, ERIC- e REP-PCR demonstraram que existem diferenças genéticas entre os isolados provenientes das sementes e aqueles provenientes de parte aérea, e esses dois grupos foram claramente distintos. Estudos futuros devem ser realizados utilizando outras técnicas moleculares para a obtenção de marcadores capazes de distinguir entre isolados de CG e CGC.Cotton is attacked by Colletotrichum gossypii (CG and C. gossypii var. cephalosporioides (CGC. Both the pathogens are transmitted by seed and their morphological distinction is extremely difficult and inconsistent. In the present study, attempts were made to verify the genetic variability among 53 isolates of CG and CGC using

  15. Electron tomography of the microtubule cytoskeleton in multinucleated hyphae of Ashbya gossypii.

    Science.gov (United States)

    Gibeaux, Romain; Lang, Claudia; Politi, Antonio Z; Jaspersen, Sue L; Philippsen, Peter; Antony, Claude

    2012-12-01

    We report the mechanistic basis guiding the migration pattern of multiple nuclei in hyphae of Ashbya gossypii. Using electron tomography, we reconstructed the cytoplasmic microtubule (cMT) cytoskeleton in three tip regions with a total of 13 nuclei and also the spindle microtubules of four mitotic nuclei. Each spindle pole body (SPB) nucleates three cMTs and most cMTs above a certain length grow according to their plus-end structure. Long cMTs closely align for several microns along the cortex, presumably marking regions where dynein generates pulling forces on nuclei. Close proximity between cMTs emanating from adjacent nuclei was not observed. The majority of nuclei carry duplicated side-by-side SPBs, which together emanate an average of six cMTs, in most cases in opposite orientation with respect to the hyphal growth axis. Such cMT arrays explain why many nuclei undergo short-range back and forth movements. Only occasionally do all six cMTs orient in one direction, a precondition for long-range nuclear bypassing. Following mitosis, daughter nuclei carry a single SPB with three cMTs. The increased probability that all three cMTs orient in one direction explains the high rate of nuclear bypassing observed in these nuclei. The A. gossypii mitotic spindle was found to be structurally similar to that of Saccharomyces cerevisiae in terms of nuclear microtubule (nMT) number, length distribution and three-dimensional organization even though the two organisms differ significantly in chromosome number. Our results suggest that two nMTs attach to each kinetochore in A. gossypii and not only one nMT like in S. cerevisiae.

  16. The APSES protein Sok2 is a positive regulator of sporulation in Ashbya gossypii.

    Science.gov (United States)

    Wasserstrom, Lisa; Dünkler, Alexander; Walther, Andrea; Wendland, Jürgen

    2017-12-01

    Ashbya gossypii is a homothallic, flavinogenic, filamentous ascomycete that starts overproduction of riboflavin and fragments its mycelium quantitatively into spore producing sporangia at the end of a growth phase. Mating is not required for sporulation and the standard homothallic laboratory strain is a MATa strain. Here we show that ectopic expression of Saccharomyces cerevisiae MATα2 in A. gossypii completely suppresses sporulation, inhibits riboflavin overproduction and downregulates among others AgSOK2. AgSok2 belongs to a fungal-specific group of (APSES) transcription factors. Deletion of AgSOK2 strongly reduces riboflavin production and blocks sporulation. The initiator of meiosis, AgIME1, is a transcription factor essential for sporulation. We characterized the AgIME1 promoter region required for complementation of the Agime1 mutant. Reporter assays with AgIME1 promoter fragments fused to lacZ showed that AgSok2 does not control AgIME1 transcription. However, global transcriptome analysis identified two other essential regulators of sporulation, AgIME2 and AgNDT80, as potential targets of AgSok2. Our data suggest that sporulation and riboflavin production in A. gossypii are under mating type locus and nutritional control. Sok2, a target of the cAMP/protein kinase A pathway, serves as a central positive regulator to promote sporulation. This contrasts Saccharomyces cerevisiae where Sok2 is a repressor of IME1 transcription. © 2017 John Wiley & Sons Ltd.

  17. Lethal and sublethal effects of neem on Aphis gossypii and Cycloneda sanguinea in watermelon

    Directory of Open Access Journals (Sweden)

    Cíntia Ribeiro Souza

    2015-05-01

    Full Text Available The objective of this study was to evaluate the impact of oil extract of neem, Azadirachta indica, on the watermelon aphid Aphis gossypii and its natural enemy Cycloneda sanguinea. Toxicity bioassays were conducted with the commercial product DalNeem (1,475 g L-1 azadirachtin at 0.0037 µg a.i. mL-1, 0.0074 µg a.i. mL-1 and 0.0148 µg a.i. mL-1, Malathion at 1 µg a.i. mL-1 and distilled water as a control treatment. The products were sprayed to watermelon leaf discs, and the insects were exposed to the product residues. The instantaneous population growth rate of A. gossypii and the survival of C. sanguinea larvae exposed to the different treatments were calculated. A decrease in the instantaneous population growth rate of A. gossypii with increasing concentrations of neem was observed, and the aphids did not reproduce on the leaf discs treated with malathion during the first 24 hours of exposure due to its rapid lethal effect on adult insects. The larvae of the predator C. sanguinea exposed to malathion survived only for 24 hours. The survival of the predator exposed to different concentrations of neem was also significantly reduced compared to the predators exposed only to water. However, laboratory experiments may overestimate the effect of neem on predators because the individuals cannot employ escape behavior caused by neem repellency.

  18. Evaluation of antifungal metabolites activity from bacillus licheniformis OE-04 against Colletotrichum gossypii.

    Science.gov (United States)

    Nawaz, Hafiz Husnain; Nelly Rajaofera, M J; He, Qiguang; Anam, Usmani; Lin, Chunhua; Miao, Weiguo

    2018-04-01

    Anthracnose disease in the cotton plant caused by fungal pathogen Colletotrichum gossypii. It is supposed to be most critical diseases in the cotton crop as it causes infection and leads to complete damaging of the cotton crop by infecting the leaves, stems, and bolls in the field. The disease control is challenging due to the absence of an effective fungicide without damaging the farmer health and environment. So the series of experiments were designed to assess the antagonistic activity of biosurfactant released by strain Bacillus licheniformis OE-04 against the anthracnose causing agent in cotton and this strain was screened out from forty eight strain of rhizobacteria. We also estimated the heat stability and pH range and toxicity of biosurfactant produced by strain 0E-04. The results showed that biosurfactant has maximum antifungal activity against C. gossypii. In vitro study concluded that the biosurfactant can reduce fungal activity by inhibiting the spore germination of C. gossypii. Moreover, the biosurfactant also has wide pH and temperature range. We observed Antifungal activity of biosurfactant at 5 to 10 pH range and temperature range was also wide from room temperature to 100 °C. We also observed the toxicity of biosurfactant produced by Bacillus licheniformis against zebra fish (Danio rerio). We were noticed that biosurfactant have least harmful effect with maximum concentration. The study confirmed that biosurfactant of Bacillus licheniformis have high pH and heat stability range with least harmful effects so it can be a good replacement of chemical pesticides for cotton anthracnose control. Copyright © 2018 Elsevier Inc. All rights reserved.

  19. Seed Treatment Combined with a Spot Application of Clothianidin Granules Prolongs the Efficacy of Controlling Piercing-Sucking Insect Pests in Cotton Fields.

    Science.gov (United States)

    Zhang, Zhengqun; Zhao, Yunhe; Wang, Yao; Li, Beixing; Lin, Jin; Zhang, Xuefeng; Mu, Wei

    2017-09-13

    Seed treatments can directly protect cotton from early season piercing-sucking insect Aphis gossypii Glover but hardly provide long-term protection against Apolygus lucorum (Meyer-Dür). Therefore, the efficacy of clothianidin seed treatments combined with spot applications of clothianidin granules at the bud stage of cotton was evaluated to control piercing-sucking pests during the entire cotton growing season. Clothianidin seed treatments (at the rate of 4 g ai/kg seed) combined with a clothianidin granular treatment (even at low rate of 0.9 kg ai/ha) at the bud stage can effectively suppress A. gossypii and A. lucorum infestations throughout the seedling and blooming stages after planting and can improve cotton yield. The spot application of clothianidin granules also reduced the population densities of Bemisia tabaci (Gennadius). The dynamic changes of clothianidin residues demonstrated that the control efficacy of clothianidin against A. gossypii and A. lucorum might be related to the residues of this neonicotinoid in cotton leaves. This pest management practice provided long-term protection against cotton piercing-sucking pests for the entire growing season of cotton plants and could supplement the short-term control efficiency of clothianidin used as a seed treatment.

  20. Organization of organelles within hyphae of Ashbya gossypii revealed by electron tomography.

    Science.gov (United States)

    Gibeaux, Romain; Hoepfner, Dominic; Schlatter, Ivan; Antony, Claude; Philippsen, Peter

    2013-11-01

    Ashbya gossypii grows as multinucleated and constantly elongating hyphae. Nuclei are in continuous forward and backward motion, also move during mitosis, and frequently bypass each other. Whereas these nuclear movements are well documented, comparatively little is known about the density and morphology of organelles which very likely influence these movements. To understand the three-dimensional subcellular organization of hyphae at high resolution, we performed large-scale electron tomography of the tip regions in A. gossypii. Here, we present a comprehensive space-filling model in which most membrane-limited organelles including nuclei, mitochondria, endosomes, multivesicular bodies, vacuoles, autophagosomes, peroxisomes, and vesicles are modeled. Nuclei revealed different morphologies and protrusions filled by the nucleolus. Mitochondria are very abundant and form a tubular network with a polarized spherical fraction. The organelles of the degradative pathways show a clustered organization. By analyzing vesicle-like bodies, we identified three size classes of electron-dense vesicles (∼200, ∼150, and ∼100 nm) homogeneously distributed in the cytoplasm which most likely represent peroxisomes. Finally, coated and uncoated vesicles with approximately 40-nm diameters show a polarized distribution toward the hyphal tip with the coated vesicles preferentially localizing at the hyphal periphery.

  1. A non-persistently transmitted-virus induces a pull-push strategy in its aphid vector to optimize transmission and spread.

    Science.gov (United States)

    Carmo-Sousa, Michele; Moreno, Aranzazu; Garzo, Elisa; Fereres, Alberto

    2014-06-24

    Plant viruses are known to modify the behaviour of their insect vectors, both directly and indirectly, generally adapting to each type of virus-vector relationship in a way that enhances transmission efficiency. Here, we report results of three different studies showing how a virus transmitted in a non-persistent (NP) manner (Cucumber mosaic virus; CMV, Cucumovirus) can induce changes in its host plant, cucumber (Cucumis sativus cv. Marumba) that modifies the behaviour of its aphid vector (Aphis gossypii Glover; Hemiptera: Aphididae) in a way that enhances virus transmission and spread non-viruliferous aphids changed their alighting, settling and probing behaviour activities over time when exposed to CMV-infected and mock-inoculated cucumber plants. Aphids exhibited no preference to migrate from CMV-infected to mock-inoculated plants at short time intervals (1, 10 and 30 min after release), but showed a clear shift in preference to migrate from CMV-infected to mock-inoculated plants 60 min after release. Our free-choice preference assays showed that A. gossypii alates preferred CMV-infected over mock-inoculated plants at an early stage (30 min), but this behaviour was reverted at a later stage and aphids preferred to settle and reproduce on mock-inoculated plants. The electrical penetration graph (EPG) technique revealed a sharp change in aphid probing behaviour over time when exposed to CMV-infected plants. At the beginning (first 15 min) aphid vectors dramatically increased the number of short superficial probes and intracellular punctures when exposed to CMV-infected plants. At a later stage (second hour of recording) aphids diminished their feeding on CMV-infected plants as indicated by much less time spent in phloem salivation and ingestion (E1 and E2). This particular probing behaviour including an early increase in the number of short superficial probes and intracellular punctures followed by a phloem feeding deterrence is known to enhance the transmission

  2. Dynamics of multiple nuclei in Ashbya gossypii hyphae depend on the control of cytoplasmic microtubules length by Bik1, Kip2, Kip3, and not on a capture/shrinkage mechanism.

    Science.gov (United States)

    Grava, Sandrine; Philippsen, Peter

    2010-11-01

    Ashbya gossypii has a budding yeast-like genome but grows exclusively as multinucleated hyphae. In contrast to budding yeast where positioning of nuclei at the bud neck is a major function of cytoplasmic microtubules (cMTs), A. gossypii nuclei are constantly in motion and positioning is not an issue. To investigate the role of cMTs in nuclear oscillation and bypassing, we constructed mutants potentially affecting cMT lengths. Hyphae lacking the plus (+)end marker Bik1 or the kinesin Kip2 cannot polymerize long cMTs and lose wild-type nuclear movements. Interestingly, hyphae lacking the kinesin Kip3 display longer cMTs concomitant with increased nuclear oscillation and bypassing. Polymerization and depolymerization rates of cMTs are 3 times higher in A. gossypii than in budding yeast and cMT catastrophes are rare. Growing cMTs slide along the hyphal cortex and exert pulling forces on nuclei. Surprisingly, a capture/shrinkage mechanism seems to be absent in A. gossypii. cMTs reaching a hyphal tip do not shrink, and cMT +ends accumulate in hyphal tips. Thus, differences in cMT dynamics and length control between budding yeast and A. gossypii are key elements in the adaptation of the cMT cytoskeleton to much longer cells and much higher degrees of nuclear mobilities.

  3. Morphometric relationship, phylogenetic correlation, and character evolution in the species-rich genus Aphis (Hemiptera: Aphididae.

    Directory of Open Access Journals (Sweden)

    Hyojoong Kim

    2010-07-01

    Full Text Available The species-rich genus Aphis consists of more than 500 species, many of them host-specific on a wide range of plants, yet very similar in general appearance due to convergence toward particular morphological types. Most species have been historically clustered into four main phenotypic groups (gossypii, craccivora, fabae, and spiraecola groups. To confirm the morphological hypotheses between these groups and to examine the characteristics that determine them, multivariate morphometric analyses were performed using 28 characters measured/counted from 40 species. To infer whether the morphological relationships are correlated with the genetic relationships, we compared the morphometric dataset with a phylogeny reconstructed from the combined dataset of three mtDNA and one nuclear DNA regions.Based on a comparison of morphological and molecular datasets, we confirmed morphological reduction or regression in the gossypii group unlike in related groups. Most morphological characteristics of the gossypii group were less variable than for the other groups. Due to these, the gossypii group could be morphologically well separated from the craccivora, fabae, and spiraecola groups. In addition, the correlation of the rates of evolution between morphological and DNA datasets was highly significant in their diversification.The morphological separation between the gossypii group and the other species-groups are congruent with their phylogenetic relationships. Analysis of trait evolution revealed that the morphological traits found to be significant based on the morphometric analyses were confidently correlated with the phylogeny. The dominant patterns of trait evolution resulting in increased rates of short branches and temporally later evolution are likely suitable for the modality of Aphis speciation because they have adapted species-specifically, rapidly, and more recently on many different host plants.

  4. Field evaluation of Bt cotton crop impact on nontarget pests: cotton aphid and boll weevil.

    Science.gov (United States)

    Sujii, E R; Togni, P H B; de A Ribeiro, P; de A Bernardes, T; Milane, P V G N; Paula, D P; Pires, C S S; Fontes, E M G

    2013-02-01

    Bt cotton plants expressing Cry1Ac protein have high specificity for the control of lepidopteran larvae. However, studies conducted in several countries have shown these plants have a differential impact on nontarget herbivores. The aim of this study was to compare the colonization rates and population abundance of the cotton aphid, Aphis gossypii Glover (Hemiptera: Aphididae) and the boll weevil, Anthonomus grandis Boheman (Coleoptera: Curculionidae), in plots of Bt (Nuopal) and non-Bt cotton (Delta Opal) in an experimental field in Brasilia, DF, Brazil. No difference was observed in the preference and colonization by winged aphids to plants from the two treatments. There was no significant difference in abundance of wingless aphids or in the production of winged aphids between treatments. Apparently, the parameters that control factors such as fecundity, survival, and dispersal were similar on both Bt and non-Bt plants. Monitoring of plants for coccinellids, a specialist predator of aphids, and ants that act on the dispersal of aphids among plants showed no significant difference between Bt and non-Bt plants, supporting the inference above. Regarding the effect on boll weevil, there was also no significant difference between treatments in the total number of fruiting structures attacked in each plot, the percentage of fruiting structures attacked per plant or on the number of weevils emerging from fruits with boll weevil damage from egg-laying, when damaged fruit samples were held in the laboratory. Based on these results, we conclude that there is no impact of Bt cotton crop expressing Cry1Ac on the nontarget herbivores tested under field conditions.

  5. Quality of different aphids as hosts of the parasitoid Lysiphlebus testaceipes (Cresson) (Hymenoptera: Braconidae, Aphidiinae); Qualidade de diferentes especies de pulgoes como hospedeiros do parasitoide Lysiphlebus testaceipes (Cresson) (Hymenoptera: Braconidae, Aphidiinae)

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Robson J.; Bueno, Vanda H.P. [Universidade Federal de Lavras, MG (Brazil). Dept. de Entomologia]. E-mail: vhpbueno@ufla.br; Sampaio, Marcus V.[Universidade Federal de Uberlandia (UFU), MG (Brazil). Inst. de Ciencias Agrarias]. E-mail: mvsampaio@iciag.ufu.br

    2008-03-15

    Lysiphlebus testaceipes (Cresson) has a broad aphid host range; however the quality of these preys may interfere in its biological feature. This study aimed to evaluate the quality of three Macrosiphini, Brevicoryne brassicae (L.), Lipaphis erysimi (Kaltenbach) and Myzus persicae (Sulzer), and three Aphidini Schizaphis graminum (Rondani) Rhopalosiphum maidis (Fitch) and Aphis gossypii Glover as hosts to L. testaceipes and to determine the relation possible of host preference, of size and quality of the host. The tests were carried out in climatic chamber at 25 {+-} 1 deg C, RH 70 {+-} 10% and 12h photophase. The parasitoid did not oviposite in B. brassicae and L. erysimi, while the other species were nutritionally suitable to the parasitoid. L. testaceipes showed preference for aphids from tribe Aphidini and these hosts presented better quality to the parasitoid when compared to Macrosiphini. Interactions among size, preference and quality between the Aphidini were found. L. testaceipes showed preference (parasitism rate 76.7%) for R. maidis, the bigger host (hind tibia with 0.281 mm). This host provided bigger size (hind tibia with 0.49 mm) and higher emergence rate (95.6%) to the parasitoid when compared to A. gossypii (parasitism rate of 55.7%). Also the smaller host A. gossypii (0.266 mm) provided smaller size hind tibia (0.45 mm) and higher mortality of the parasitoid (emergence rate 72.1%). However, the development time was shorter and the longevity was higher in A. gossypii (6.3 and 5.4 days, respectively) when compared to the host R. maidis (6.7 and 3.8 days, respectively), and not been related to host size. (author)

  6. Presencia de Diaphorina citri (Hemiptera: Psyllidae en el Noroeste Argentino (NOA Record of Diaphorina citri (Hemiptera: Psyllidae in North West Argentina

    Directory of Open Access Journals (Sweden)

    Lucrecia Augier

    2006-12-01

    Full Text Available Se amplía la distribución de Diaphorina citri Kuwayama (Hemiptera: Psyllidae para el Noroeste Argentino.The distribution of Diaphorina citri Kuwayama (Hemiptera: Psyllidae is expanded to North West Argentina.

  7. A mutant with riboflavin productivity obtained from non-riboflavin-producing ashbya gossypii by γ-induction

    International Nuclear Information System (INIS)

    Yang Suhong; Ge Zhongliang

    1993-01-01

    60 Co γ-ray was used to irradiate Ashbya gossypii, which does not produce riboflavin originally, and mutants were obtained with colonial colour changing from white into yellow. Mutant ratio was high at the absorption dose of 90 Gy. Results of reverse phase-HPLC, high performance-TLC and fluoroscopic analysis proved that riboflavin is produced by the mutant fermentation. The mutant remained after generations of culture, indicating that the induced new properties are stably inheritable

  8. Desenvolvimento larval de Chrysoperla externa alimentada com Aphis gossypii provenientes de três cultivares de algodoeiro

    Directory of Open Access Journals (Sweden)

    Eunice Cláudia Schlick-Souza

    2011-10-01

    Full Text Available O objetivo deste trabalho foi avaliar os aspectos biológicos de Chrysoperla externa alimentadas com Aphis gossypii provenientes de três cultivares de algodoeiro (FMT 701, Acala 90 e Delta Opal. O experimento foi conduzido no Laboratório de Fitossanidade da Universidade Estadual de Mato Grosso do Sul (UEMS, Unidade de Cassilândia (MS. Os adultos de C. externa foram mantidos em gaiolas de PVC, em sala climatizada. As larvas do predador foram individualizadas em placas de Petri e alimentadas diariamente com pulgões advindos das diferentes cultivares. Larvas que se alimentaram de indíviduos da cultivar FMT 701 apresentaram a viabilidade menor do que as que alimentaram dos afídeos criados nas cultivares Delta Opal e Acala 90. Observou-se redução do consumo diário nas larvas de terceiro ínstar que se alimentaram dos pulgões advindos da cultivar Acala 90. Consequentemente, larvas supridas com pulgões criados nas cultivares Delta Opal e Acala 90, tiveram menor peso, 3,60 e 3,90 mg respectivamente, diferindo significativamente da FMT 701. De modo geral, é possível a utilização de C. externa no controle de A. gossypii nas cultivares estudadas.

  9. Presence of Native Prey Does Not Divert Predation on Exotic Pests by Harmonia axyridis in Its Indigenous Range

    Science.gov (United States)

    Zhang, Gui Fen; Lövei, Gábor L; Wu, Xia; Wan, Fang Hao

    2016-01-01

    In China, two invasive pests, Bemisia tabaci MEAM1 (Gennadius) and Frankliniella occidentalis (Pergande), often co-occur with the native pest, Aphis gossypii (Glover), on plants of Malvaceae and Cucurbitaceae. All three are preyed on by the native ladybird, Harmonia axyridis (Pallas); however, the native predator might be expected to prefer native prey to the exotic ones due to a shared evolutionary past. In order to clarify whether the presence of native prey affected the consumption of these two invasive species by the native predator, field-cage experiments were conducted. A duplex qPCR was used to simultaneously detect both non-native pests within the gut of the predator. H. axyridis readily accepted both invasive prey species, but preferred B. tabaci. With all three prey species available, H. axyridis consumption of B. tabaci was 39.3±2.2% greater than consumption of F. occidentalis. The presence of A. gossypii reduced (by 59.9% on B. tabaci, and by 60.6% on F. occidentalis), but did not stop predation on the two exotic prey when all three were present. The consumption of B. tabaci was similar whether it was alone or together with A. gossypii. However, the presence of aphids reduced predation on the invasive thrips. Thus, some invasive prey may be incorporated into the prey range of a native generalist predator even in the presence of preferred native prey. PMID:27391468

  10. Gender- and species-specific characteristics of bacteriomes from three psyllid species (Hemiptera: Psylloidae)

    Science.gov (United States)

    Psyllids (Hemiptera: Pyslloidea) harbor bacterial symbionts in specialized organs called bacteriomes. Bacteriomes may be subject to manipulation to control psyllid pests including Bactericera cockerelli (Sulc) (Hemiptera: Triozidae) and Cacopsylla pyricola (Forster) (Hemiptera: Psyllidae) if the bi...

  11. Record of Diaphorina citri (Hemiptera: Psyllidae) in North West Argentina

    OpenAIRE

    Augier, Lucrecia; Gastaminza, Gerardo; Lizondo, Marcelo; Argañaraz, Manuel; Willink, Eduardo

    2006-01-01

    Se amplía la distribución de Diaphorina citri Kuwayama (Hemiptera: Psyllidae) para el Noroeste Argentino.The distribution of Diaphorina citri Kuwayama (Hemiptera: Psyllidae) is expanded to North West Argentina.

  12. A Molecular Phylogeny of Hemiptera Inferred from Mitochondrial Genome Sequences

    Science.gov (United States)

    Song, Nan; Liang, Ai-Ping; Bu, Cui-Ping

    2012-01-01

    Classically, Hemiptera is comprised of two suborders: Homoptera and Heteroptera. Homoptera includes Cicadomorpha, Fulgoromorpha and Sternorrhyncha. However, according to previous molecular phylogenetic studies based on 18S rDNA, Fulgoromorpha has a closer relationship to Heteroptera than to other hemipterans, leaving Homoptera as paraphyletic. Therefore, the position of Fulgoromorpha is important for studying phylogenetic structure of Hemiptera. We inferred the evolutionary affiliations of twenty-five superfamilies of Hemiptera using mitochondrial protein-coding genes and rRNAs. We sequenced three mitogenomes, from Pyrops candelaria, Lycorma delicatula and Ricania marginalis, representing two additional families in Fulgoromorpha. Pyrops and Lycorma are representatives of an additional major family Fulgoridae in Fulgoromorpha, whereas Ricania is a second representative of the highly derived clade Ricaniidae. The organization and size of these mitogenomes are similar to those of the sequenced fulgoroid species. Our consensus phylogeny of Hemiptera largely supported the relationships (((Fulgoromorpha,Sternorrhyncha),Cicadomorpha),Heteroptera), and thus supported the classic phylogeny of Hemiptera. Selection of optimal evolutionary models (exclusion and inclusion of two rRNA genes or of third codon positions of protein-coding genes) demonstrated that rapidly evolving and saturated sites should be removed from the analyses. PMID:23144967

  13. A molecular phylogeny of Hemiptera inferred from mitochondrial genome sequences.

    Directory of Open Access Journals (Sweden)

    Nan Song

    Full Text Available Classically, Hemiptera is comprised of two suborders: Homoptera and Heteroptera. Homoptera includes Cicadomorpha, Fulgoromorpha and Sternorrhyncha. However, according to previous molecular phylogenetic studies based on 18S rDNA, Fulgoromorpha has a closer relationship to Heteroptera than to other hemipterans, leaving Homoptera as paraphyletic. Therefore, the position of Fulgoromorpha is important for studying phylogenetic structure of Hemiptera. We inferred the evolutionary affiliations of twenty-five superfamilies of Hemiptera using mitochondrial protein-coding genes and rRNAs. We sequenced three mitogenomes, from Pyrops candelaria, Lycorma delicatula and Ricania marginalis, representing two additional families in Fulgoromorpha. Pyrops and Lycorma are representatives of an additional major family Fulgoridae in Fulgoromorpha, whereas Ricania is a second representative of the highly derived clade Ricaniidae. The organization and size of these mitogenomes are similar to those of the sequenced fulgoroid species. Our consensus phylogeny of Hemiptera largely supported the relationships (((Fulgoromorpha,Sternorrhyncha,Cicadomorpha,Heteroptera, and thus supported the classic phylogeny of Hemiptera. Selection of optimal evolutionary models (exclusion and inclusion of two rRNA genes or of third codon positions of protein-coding genes demonstrated that rapidly evolving and saturated sites should be removed from the analyses.

  14. Toxic and Repellent effecto of Harmal (Peganum harmala L. Acetonic Extract on Several Aphids and Tribolium castaneum (Herbst Efecto Tóxico y Repelente del Extracto Acetónico de Harmal (Peganum harmala L. sobre varias especies de Áfidos y Tribolium castaneum (Herbst

    Directory of Open Access Journals (Sweden)

    Elham Salari

    2012-03-01

    Full Text Available To reduce the dependence on the sometimes unwise use of synthetic pesticides in fruit and vegetable plantations, the toxicity and repellence of Peganum harmala L. (Zygophyllaceae acetonic seed extract was assayed against several insect pests. For contact toxicity, 3- to 4-d-old individuals of Aphis fabae Scopoli, A. gossypii Glover, A. nerii Boyer de Fonscolombe, and Myzus persicae (Sulzer were included, as well as 1- to 7-d-old adult Tribolium castaneum (Herbst. Repellent effect experiments were conducted on adult, 1- to 2- and 3- to 4-d old M.persicae individuals. At 60 mg mL4, the topical bioassay mortality percentage was significantly higher in A. gossypii than in A. fabae and A. nerii after 12-72 h. Mortality of the treatments on M.persicae was 87.1% and 90.0% after 24 and 48 h, respectively, and significantly higher than A. fabae and A. nerii during this period. At 60 mg mL-1, the mortality of T. castaneum was much lower than that of the aphid species. The highest repellent index (over 72% was observed on 1- to 2-d-old M. persicae individuals.Para reducir la dependencia de los pesticidas sintéticos en plantaciones frutales y hortalizas, se realizó un ensayo para medir la toxicidad y repelencia de un extracto acetónico obtenido a partir de semillas de Peganum harmala L. (Zygophyllaceae contra diferentes especies de plagas. Para evaluar la toxicidad del extracto al contacto con los insectos, se incluyeron individuos de 3-4 d de edad de Aphis fabae Scopoli, Aphis gossypii Glover, Aphis nerii Boyer de Fonscolombe, y Myzus persicae (Sulzer, así como adultos 1-7 d de edad de Tribolium castaneum (Herbst. Experimentos para medir el efecto repelente se llevaron a cabo con individuos de 1-2 y 3-4 d de edad de M. persicae. En los resultados de los bioensayos tópicos el porcentaje de mortalidad fue significativamente mayor en la especie A. gossypii que en A. fabae y A. nerii, después de 12-72 h con una concentración de 60 mg mL-1. La mortalidad

  15. Phylogenetic relationships of Hemiptera inferred from mitochondrial and nuclear genes.

    Science.gov (United States)

    Song, Nan; Li, Hu; Cai, Wanzhi; Yan, Fengming; Wang, Jianyun; Song, Fan

    2016-11-01

    Here, we reconstructed the Hemiptera phylogeny based on the expanded mitochondrial protein-coding genes and the nuclear 18S rRNA gene, separately. The differential rates of change across lineages may associate with long-branch attraction (LBA) effect and result in conflicting estimates of phylogeny from different types of data. To reduce the potential effects of systematic biases on inferences of topology, various data coding schemes, site removal method, and different algorithms were utilized in phylogenetic reconstruction. We show that the outgroups Phthiraptera, Thysanoptera, and the ingroup Sternorrhyncha share similar base composition, and exhibit "long branches" relative to other hemipterans. Thus, the long-branch attraction between these groups is suspected to cause the failure of recovering Hemiptera under the homogeneous model. In contrast, a monophyletic Hemiptera is supported when heterogeneous model is utilized in the analysis. Although higher level phylogenetic relationships within Hemiptera remain to be answered, consensus between analyses is beginning to converge on a stable phylogeny.

  16. Oxidative stress protection and glutathione metabolism in response to hydrogen peroxide and menadione in riboflavinogenic fungus Ashbya gossypii.

    Science.gov (United States)

    Kavitha, S; Chandra, T S

    2014-11-01

    Ashbya gossypii is a plant pathogen and a natural overproducer of riboflavin and is used for industrial riboflavin production. A few literature reports depict a link between riboflavin overproduction and stress in this fungus. However, the stress protection mechanisms and glutathione metabolism are not much explored in A. gossypii. In the present study, an increase in the activity of catalase and superoxide dismutase was observed in response to hydrogen peroxide and menadione. The lipid peroxide and membrane lipid peroxide levels were increased by H2O2 and menadione, indicating oxidative damage. The glutathione metabolism was altered with a significant increase in oxidized glutathione (GSSG), glutathione peroxidase (GPX), glutathione S transferase (GST), and glutathione reductase (GR) and a decrease in reduced glutathione (GSH) levels in the presence of H2O2 and menadione. Expression of the genes involved in stress mechanism was analyzed in response to the stressors by semiquantitative RT-PCR. The messenger RNA (mRNA) levels of CTT1, SOD1, GSH1, YAP1, and RIB3 were increased by H2O2 and menadione, indicating the effect of stress at the transcriptional level. A preliminary bioinformatics study for the presence of stress response elements (STRE)/Yap response elements (YRE) depicted that the glutathione metabolic genes, stress genes, and the RIB genes hosted either STRE/YRE, which may enable induction of these genes during stress.

  17. Indian Bt cotton varieties do not affect the performance of cotton aphids.

    Directory of Open Access Journals (Sweden)

    Nora C Lawo

    Full Text Available Cotton varieties expressing Cry proteins derived from the soil bacterium Bacillus thuringiensis (Bt are grown worldwide for the management of pest Lepidoptera. To prevent non-target pest outbreaks and to retain the biological control function provided by predators and parasitoids, the potential risk that Bt crops may pose to non-target arthropods is addressed prior to their commercialization. Aphids play an important role in agricultural systems since they serve as prey or host to a number of predators and parasitoids and their honeydew is an important energy source for several arthropods. To explore possible indirect effects of Bt crops we here examined the impact of Bt cotton on aphids and their honeydew. In climate chambers we assessed the performance of cotton aphids, Aphis gossypii Glover (Hemiptera: Aphididae when grown on three Indian Bt (Cry1Ac cotton varieties (MECH 12, MECH 162, MECH 184 and their non-transformed near isolines. Furthermore, we examined whether aphids pick up the Bt protein and analyzed the sugar composition of aphid honeydew to evaluate its suitability for honeydew-feeders. Plant transformation did not have any influence on aphid performance. However, some variation was observed among the three cotton varieties which might partly be explained by the variation in trichome density. None of the aphid samples contained Bt protein. As a consequence, natural enemies that feed on aphids are not exposed to the Cry protein. A significant difference in the sugar composition of aphid honeydew was detected among cotton varieties as well as between transformed and non-transformed plants. However, it is questionable if this variation is of ecological relevance, especially as honeydew is not the only sugar source parasitoids feed on in cotton fields. Our study allows the conclusion that Bt cotton poses a negligible risk for aphid antagonists and that aphids should remain under natural control in Bt cotton fields.

  18. Folic Acid Production by Engineered Ashbya gossypii.

    Science.gov (United States)

    Serrano-Amatriain, Cristina; Ledesma-Amaro, Rodrigo; López-Nicolás, Rubén; Ros, Gaspar; Jiménez, Alberto; Revuelta, José Luis

    2016-11-01

    Folic acid (vitamin B 9 ) is the common name of a number of chemically related compounds (folates), which play a central role as cofactors in one-carbon transfer reactions. Folates are involved in the biosynthesis and metabolism of nucleotides and amino acids, as well as supplying methyl groups to a broad range of substrates, such as hormones, DNA, proteins, and lipids, as part of the methyl cycle. Humans and animals cannot synthesize folic acid and, therefore, need them in the diet. Folic acid deficiency is an important and underestimated problem of micronutrient malnutrition affecting billions of people worldwide. Therefore, the addition of folic acid as food additive has become mandatory in many countries thus contributing to a growing demand of the vitamin. At present, folic acid is exclusively produced by chemical synthesis despite its associated environmental burdens. In this work, we have metabolically engineered the industrial fungus Ashbya gossypii in order to explore its potential as a natural producer of folic acid. Overexpression of FOL genes greatly enhanced the synthesis of folates and identified GTP cyclohydrolase I as the limiting step. Metabolic flux redirection from competing pathways also stimulated folic acid production. Finally, combinatorial engineering synergistically increased the production of different bioactive forms of the folic vitamin. Overall, strains were constructed which produce 146-fold (6595µg/L) more vitamin than the wild-type and by far represents the highest yield reported. Copyright © 2016 International Metabolic Engineering Society. Published by Elsevier Inc. All rights reserved.

  19. Saproxylic Hemiptera Habitat Associations

    Science.gov (United States)

    Michael D. Ulyshen; James L. Hanula; Robert L. Blinn; Gene. Kritsky

    2012-01-01

    Understanding the habitat requirements of organisms associated with dead wood is important in order to conserve them in managed forests. Unfortunately, many of the less diverse saproxylic taxa, including Hemiptera, remain largely unstudied. An effort to rear insects from dead wood taken from two forest types (an upland pine-dominated and a bottomland mixed hardwood),...

  20. The complete mitochondrial genome of a spiraling whitefly, Aleurodicus dispersus Russell (Hemiptera: Aleyrodidae).

    Science.gov (United States)

    Ming-Xing, Lu; Zhi-Teng, Chen; Wei-Wei, Yu; Yu-Zhou, Du

    2017-03-01

    We report the complete mitochondrial genome (mitogenome) of a spiraling whitefly, Aleurodicus dispersus (Hemiptera: Aleyrodidae). The 16 170 bp long genome consists of 13 protein-coding genes, 20 transfer RNAs, 2 ribosomal RNAs, and a control region. The A. dispersus mitogenome also includes a cytb-like non-coding region and shows several variations relative to the typical insect mitogenome. A phylogenetic tree has been constructed using the 13 protein-coding genes of 12 related species from Hemiptera. Our results would contribute to further study of phylogeny in Aleyrodidae and Hemiptera.

  1. Synthesis and biological activity of pyridazine amides, hydrazones and hydrazides.

    Science.gov (United States)

    Buysse, Ann M; Yap, Maurice Ch; Hunter, Ricky; Babcock, Jonathan; Huang, Xinpei

    2017-04-01

    Optimization studies on compounds initially designed to be herbicides led to the discovery of a series of [6-(3-pyridyl)pyridazin-3-yl]amides exhibiting aphicidal properties. Systematic modifications of the amide moiety as well as the pyridine and pyridazine rings were carried out to determine if these changes could improve insecticidal potency. Structure-activity relationship (SAR) studies showed that changes to the pyridine and pyridazine rings generally resulted in a significant loss of insecticidal potency against green peach aphids [Myzus persicae (Sulzer)] and cotton aphids [(Aphis gossypii (Glover)]. However, replacement of the amide moiety with hydrazines, hydrazones, or hydrazides appeared to be tolerated, with small aliphatic substituents being especially potent. A series of aphicidal [6-(3-pyridyl)pyridazin-3-yl]amides were discovered as a result of random screening of compounds that were intially investigated as herbicides. Follow-up studies of the structure-activity relationship of these [6-(3-pyridyl)pyridazin-3-yl]amides showed that biosteric replacement of the amide moiety was widely tolerated suggesting that further opportunities for exploitation may exist for this new area of insecticidal chemistry. Insecticidal efficacy from the original hit, compound 1, to the efficacy of compound 14 produced greater than 10-fold potency improvement against Aphis gossypii and greater than 14-fold potency improvement against Myzus persicae. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

  2. Intercropping System for Protection the Potato Plant from Insect Infestation

    Directory of Open Access Journals (Sweden)

    Aziza Sharaby

    2015-06-01

    Full Text Available The use of intercropping system provides an option for insect control for organic farmers that are limited in their chemical use. Additionally, intercropping systems can be attractive to conventional growers as a cost-effective insect control solution. A study was carried out for two seasons 2011-2012 and 2012-2013 to evaluate the effect of intercropping of potato (Solanum tuberosum L. with onion (Allium cepa L. on whitefly (Bemicia tabasi Gennadius and aphids’ Myzus persicae Sulz. and Aphis gossypii Glover infestation in potato fields. Results indicated that intercropping significantly reduced potato plant infestation with whitefly by 42.7, 51.3% while it was 62.69% reduction with aphids during the two successive winter seasons than when potato plants were cultivated alone. Therefore, intercropping could be recommended as a protection method of reducing pest population in the fields.

  3. Sequence and structural characterization of Trx-Grx type of monothiol glutaredoxins from Ashbya gossypii.

    Science.gov (United States)

    Yadav, Saurabh; Kumari, Pragati; Kushwaha, Hemant Ritturaj

    2013-01-01

    Glutaredoxins are enzymatic antioxidants which are small, ubiquitous, glutathione dependent and essentially classified under thioredoxin-fold superfamily. Glutaredoxins are classified into two types: dithiol and monothiol. Monothiol glutaredoxins which carry the signature "CGFS" as a redox active motif is known for its role in oxidative stress, inside the cell. In the present analysis, the 138 amino acid long monothiol glutaredoxin, AgGRX1 from Ashbya gossypii was identified and has been used for the analysis. The multiple sequence alignment of the AgGRX1 protein sequence revealed the characteristic motif of typical monothiol glutaredoxin as observed in various other organisms. The proposed structure of the AgGRX1 protein was used to analyze signature folds related to the thioredoxin superfamily. Further, the study highlighted the structural features pertaining to the complex mechanism of glutathione docking and interacting residues.

  4. Registro de Thaumastocoris peregrinus (Hemiptera, Thaumastocoridae) no Estado do Paraná

    OpenAIRE

    Barbosa, Leonardo Rodrigues; Santos, Franciele; Wilcken, Carlos F.; Soliman, Everton P.

    2010-01-01

    It is recorded the occurrence of Thaumastocoris peregrinus Carpintero & Dellapé, 2006 (Hemiptera, Thaumastocoridae) in eucalyptus trees in the State of Parana, Brazil. The insect was observed in June at 2009, in Curitiba region.

    doi: 10.4336/2010.pfb.30.61.75

    É registrada a ocorrência de Thaumastocoris peregrinus Carpintero & Dellapé, 2006 (Hemiptera, Thaumastocoridae) em árvores de eucalipto no Estado do Paraná. Infestações foram o...

  5. Evolution of multinucleated Ashbya gossypii hyphae from a budding yeast-like ancestor.

    Science.gov (United States)

    Schmitz, Hans-Peter; Philippsen, Peter

    2011-06-01

    In the filamentous ascomycete Ashbya gossypii polarity establishment at sites of germ tube and lateral branch emergence depends on homologues of Saccharomyces cerevisiae factors controlling bud site selection and bud emergence. Maintenance of polar growth involves homologues of well-known polarity factors of budding yeast. To achieve the much higher rates of sustained polar surface expansion of hyphae compared to mainly non-polarly growing yeast buds five important alterations had to evolve. Permanent presence of the polarity machinery at a confined area in the rapidly expanding hyphal tip, increased cytoplasmic space with a much enlarged ER surface for generating secretory vesicles, efficient directed transport of secretory vesicles to and accumulation at the tip, increased capacity of the exocytosis system to process these vesicles, and an efficient endocytosis system for membrane and polarity factor recycling adjacent to the zone of exocytosis. Morphological, cell biological, and molecular aspects of this evolution are discussed based on experiments performed within the past 10 y. Copyright © 2011 The British Mycological Society. Published by Elsevier Ltd. All rights reserved.

  6. Rediscovering digitules in Aphidomorpha and the question of homology among Sternorrhyncha (Insecta, Hemiptera

    Directory of Open Access Journals (Sweden)

    Mark A. Metz

    2017-07-01

    Full Text Available We explore and expand on the morphological term digitule. The term was originally proposed for toe-like setae on a species of Phylloxera Boyer de Fonscolombe, 1834 (Hemiptera, Sternorrhyncha, Aphidomorpha by Henry Shimer, an American naturalist. While it is standard terminology in scale systematics (Hemiptera, Sternorrhyncha, Coccidomorpha, the term digitule was ignored by aphid specialists despite being the original taxon for which the term was described. Similar setae occur on many arthropod groups, so the homology is poorly understood even within any superfamily of Hemiptera. We provide the etymology of the term, a proposed explanation for why it was used among scale taxonomists and not aphid taxonomists, and discuss briefly options to progress beyond the confusion between terminology for morphology and homology in Sternorrhyncha.

  7. Clustering of Nuclei in Multinucleated Hyphae Is Prevented by Dynein-Driven Bidirectional Nuclear Movements and Microtubule Growth Control in Ashbya gossypii ▿ †

    Science.gov (United States)

    Grava, Sandrine; Keller, Miyako; Voegeli, Sylvia; Seger, Shanon; Lang, Claudia; Philippsen, Peter

    2011-01-01

    During filamentous fungus development, multinucleated hyphae employ a system for long-range nuclear migration to maintain an equal nuclear density. A decade ago the microtubule motor dynein was shown to play a central role in this process. Previous studies with Ashbya gossypii revealed extensive bidirectional movements and bypassings of nuclei, an autonomous cytoplasmic microtubule (cMT) cytoskeleton emanating from each nucleus, and pulling of nuclei by sliding of cMTs along the cortex. Here, we show that dynein is the sole motor for bidirectional movements and bypassing because these movements are concomitantly decreased in mutants carrying truncations of the dynein heavy-chain DYN1 promoter. The dynactin component Jnm1, the accessory proteins Dyn2 and Ndl1, and the potential dynein cortical anchor Num1 are also involved in the dynamic distribution of nuclei. In their absence, nuclei aggregate to different degrees, whereby the mutants with dense nuclear clusters grow extremely long cMTs. As in budding yeast, we found that dynein is delivered to cMT plus ends, and its activity or processivity is probably controlled by dynactin and Num1. Together with its role in powering nuclear movements, we propose that dynein also plays (directly or indirectly) a role in the control of cMT length. Those combined dynein actions prevent nuclear clustering in A. gossypii and thus reveal a novel cellular role for dynein. PMID:21642510

  8. Application of RNA-seq for mitogenome reconstruction, and reconsideration of long-branch artifacts in Hemiptera phylogeny

    Science.gov (United States)

    Song, Nan; An, Shiheng; Yin, Xinming; Cai, Wanzhi; Li, Hu

    2016-01-01

    Hemiptera make up the largest nonholometabolan insect assemblage. Despite previous efforts to elucidate phylogeny within this group, relationships among the major sub-lineages remain uncertain. In particular, mitochondrial genome (mitogenome) data are still sparse for many important hemipteran insect groups. Recent mitogenomic analyses of Hemiptera have usually included no more than 50 species, with conflicting hypotheses presented. Here, we determined the nearly complete nucleotide sequence of the mitogenome for the aphid species of Rhopalosiphum padi using RNA-seq plus gap filling. The 15,205 bp mitogenome included all mitochondrial genes except for trnF. The mitogenome organization and size for R. padi are similar to previously reported aphid species. In addition, the phylogenetic relationships for Hemiptera were examined using a mitogenomic dataset which included sequences from 103 ingroup species and 19 outgroup species. Our results showed that the seven species representing the Aleyrodidae exhibit extremely long branches, and always cluster with long-branched outgroups. This lead to the failure of recovering a monophyletic Hemiptera in most analyses. The data treatment of Degen-coding for protein-coding genes and the site-heterogeneous CAT model show improved suppression of the long-branch effect. Under these conditions, the Sternorrhyncha was often recovered as the most basal clade in Hemiptera. PMID:27633117

  9. Ability of Aphis gossypii and Myzus persicae to Transmit Cucumber mosaic virus in Single and Mixed Infection with Two Potyviruses to Zucchini Squash Eficiência dos afídeos Aphis gossypii e Myzus persicae na transmissão do Cucumber mosaic virus em infecção simples e mista com dois Potyvirus para abobrinha de moita

    Directory of Open Access Journals (Sweden)

    Zayame Vegette Pinto

    2008-06-01

    Full Text Available The main objective of this work was to investigate the ability of Aphis gossypii and Myzus persicae to transmit Cucumber mosaic virus (CMV singly and mixed with two potyviruses (Papaya ringspot virus - type W, PRSV-W and Zucchini yellow mosaic virus, ZYMV, to zucchini squash plants (Cucurbita pepo. The results showed that the potyviruses in general were more efficiently transmitted by both species of aphids as compared to CMV. The transmission of PRSV-W, ZYMV and CMV separately was more efficient than in mixture.O objetivo desse trabalho foi estudar a eficiência de Aphis gossypii e Myzus persicae na transmissão do vírus do mosaico do pepino (Cucumber mosaic virus, CMV, isoladamente e em mistura com duas espécies de potyvirus (Vírus do mosaico do mamoeiro = Papaya ringspot virus - type W, PRSV-W e Vírus do mosaico amarelo da abobrinha = Zucchini yellow mosaic virus, ZYMV, para planta-testes de abobrinha de moita (Cucurbita pepo. Os dois potyvirus em geral foram transmitidos com mais eficiência pelas duas espécies de afídeos do que o CMV. A transmissão do PRSV-W, ZYMV e CMV, separadamente, foi mais eficiente do que em mistura.

  10. Preliminary Observations on Zelus obscuridorsis (Stål (Hemiptera: Reduviidae as Predator of the Corn Leafhopper (Hemiptera: Cicadellidae in Argentina

    Directory of Open Access Journals (Sweden)

    Eduardo G. Virla

    2015-06-01

    Full Text Available The corn leafhopper Dalbulus maidis (Hemiptera: Cicadellidae, is an important corn pest in most of tropical and subtropical America. This leafhopper has a rich natural enemy complex of which parasitoids and pathogens are the most studied; knowledge on its predators is limited. We noted the presence of the native assassin bug Zelus obscuridorsis (Hemiptera: Reduviidae predating diverse motile insects, including the corn leafhopper, on corn plants cultivated in household vegetable gardens in San Miguel de Tucumán (Argentina; in order to verify its predatory actions, we exposed lab-bred individuals of D. maidis to adults of Z. obscuridorsis. The predators were starved for 24 h before trials in which the corn leafhopper in different developmental stages were exposed. Zelus obscuridorsis is highly skilled in catching specimens in motion, but it was not able to prey on eggs. The predator was capable to catch and prey on nymphs and adults.

  11. BIOLOGY OF CHRYSOPA PHYLLOCHROMA WESMAEL (NEUROPTERA: CHRYSOPIDAE). Ⅱ: INTRASPECIFIC INTERFERENCE AND SEARCHING CAPACITY

    Institute of Scientific and Technical Information of China (English)

    Jian-weiSu; Xiang-huiLiu; Neng-wenXiao; FengGe

    2004-01-01

    The present study examined intraspecific interference and searching behavior of Chrysopa phyllochroma Wesmael (Neuroptera: Chrysopidae) for Aphis gossypii Glover (Homoptera: Aphididae) nymphs under laboratory and greenhouse conditions. The results were shown as follow: 1) In four different arenas (i.e. Petri dish, glass vessel, glass vessel with barriers in it, and cage with potted cotton plant), the predaceous efficiency of C. phyllochroma larvae varied with the predator density, the hunt constant (Q) and the intraspecific interference (m)increased with the prey density but decreased with the space heterogeneity; 2) In cage with potted cotton plant, the first- and second-instar green lacewing larvae consumed 13.6 and 29.4 cotton aphids/day respectively. The number of cotton aphids consumed by C. phyllochroma on lower leaves was significantly less than that on upper leaves; and 3) In cage with potted cotton plant, the percentage of the first- and second-instar green lacewing larvae located on upper leaves was significant less than that on lower leaves.

  12. Essential oils as fumigants for bed bugs (Hemiptera: Cimicidae)

    Science.gov (United States)

    In Petri dish assays, fumigation of a pyrethroid-susceptible strain of bed bugs Cimex lectularius L. (Hemiptera: Cimicidae) with various essential oils resulted in mortality that approached or equaled 100%, after 5 days. However, when bed bugs were exposed to the same essential oils in sealed, comme...

  13. SEPARATION OF THE MINOR FLAVONOLS FROM FLOS GOSSYPII BY HIGH-SPEED COUNTERCURRENT CHROMATOGRAPHY

    Science.gov (United States)

    Yang, Yi; Zhao, Yongxin; Gu, Dongyu; Ayupbek, Amatjan; Huang, Yun; Dou, Jun; Ito, Yoichiro; Zhang, Tianyou; Aisa, Haji Akber

    2010-01-01

    An effective high-speed countercurrent chromatography (HSCCC) method was established for further separation and purification of four minor flavonols in addition to five major flavonols which were reported by our previous study from extracts of Flos Gossypii. HSCCC was performed with three two-phase solvent systems composed of n-hexane-ethyl acetate-methanol-water (7.5:15:6:7, v/v), (2.5:15:2:7, v/v) and (0:1:0:1, v/v). The separation was repeated 3 times, and 3.8 mg of 8-methoxyl-kaempferol-7-O-β-D-rhamnoside (HPLC purity 98.27%), 6.7 mg of astragalin (HPLC purity 94.18%), 3.3 mg of 4′-methoxyl-quercetin-7-O-β-D-glucoside (HPLC purity 94.30%) and 8.2 mg of hyperoside (HPLC purity 93.48%) were separated from 150 mg of the crude sample. The chemical structures of the flavonols were confirmed by MS, 1H NMR and 13C NMR. Meanwhile, the results indicated that the target compound with smaller K value (<0.5) can be separated by increasing column length of HSCCC. And four separation rules of flavonols according to the present study and references were summarized, which can be used as a useful guide for separation of flavonols by HSCCC. PMID:21494318

  14. COMPORTAMENTO DO FUNGO Colletotrichum gossypii South. var. cephalosporoides Costa EM SUBSTRATO COM DIFERENTES FONTES DE NITROGÊNIO THE BEHAVIOR OF THE FUNGUS Colletotrichum gossypii South Var. cephalosporoides Costa IN SUBSTRATE CONTAINING DIFFERENT SOURCES OF NITROGEN

    Directory of Open Access Journals (Sweden)

    Yvo de Carvalho

    2007-09-01

    Full Text Available

    Nesse trabalho procurou-se observar o efeito de diversas substâncias nitrogenadas sobre o crescimento miceliano, esporulação e aspectos morfológicos das colônias do fungo Colletotrichum gossypii South. var. cephalosporoides Costa em substrato sólido. Usou-se um substrato sintético como meio-básico e a este se adicionou peptona, metionina, asparagina, nitrato de sódio ou salicilato de amônia, conforme o tratamento. A testemunha não recebeu qualquer fonte de nitrogênio. Concluiu-se que a peptona foi o melhor tratamento para esporulação e crescimento miceliano, seguindo-se a asparagina que foi eficiente na indução da esporulação. O salicilato de amônia exerceu efeito inibidor do crescimento vegetativo e da esporulação do fungo. Para produção de inóculo, a curto prazo, recomenda-se o uso da peptona como fonte de nitrogênio. Foram observadas diferenças na pigmentação, bordos e densidade das colônias. A esporulação, embora abundante em substratos contendo peptona e asparagina, ocorreu em forma de verdadeiras massas localizadas de conídios na primeira, e como conídios dispersos na segunda.

    In this experiment, the effect of different nitrogenous substances on the mycelium growth, sporulation and morphological aspects of the colonies of the fungus Colletotrichum gossypii  South Var. cephalosporoides Costa planted in a solid substrate were observed. A synthetic substrate was used as a basic medium, and to this was added peptone metionine, asparagine, sodium nitrate or ammonium salicylate, according to the treatment. The control (group received no nitrogen whatsover. It was concluded that peptone was the best treatment for sporulation and mycelium growth, and that the next best was asparagine which was helpfull in inducing sporulation. Ammonium salicylate inhibited the vegetative growth

  15. Verde plant bug, Creontiades signatus (Hemiptera: Miridae) effects of insect density and bloom period of infestation on cotton damage and yield

    Science.gov (United States)

    The verde plant bug, Creontiades signatus Distant (Hemiptera: Miridae), has emerged as a threat to cotton in South Texas, causing boll damage similar to boll-feeding stink bugs (Hemiptera: Pentatomidae). Verde plant bugs were released into caged cotton for a one-week period to characterize the effec...

  16. Development of DNA barcodes of genus Lygus Hahn (Hemiptera: Miridae)

    Science.gov (United States)

    The genus Lygus (Hemiptera: Miridae) is an important group of insects that contains 43 known species worldwide. Some species within this genus are important agricultural pests in North America. Annual economic impacts in cotton, Gossypium hirsutum L., from Lygus spp. due to yield losses and control ...

  17. Preparing soft-bodied arthropods for microscope examination: Whiteflies (Insecta: Hemiptera: Alyrodidae)

    Science.gov (United States)

    Proper identification of whiteflies (Hemiptera:Alyrodidae) requires preparation of the specimen on a microscope slide. This training video provides visual instruction on how to prepare whitefly specimens on microscope slides for examination and identification. Steps ranging from collection, specimen...

  18. Preparing soft-bodied arthropods for microscope examination: Aphids (Insecta: Hemiptera: Aphididae)

    Science.gov (United States)

    Proper identification of aphids (Hemiptera: Aphididae) require preparation of the specimen on a microscope slide. This training video provides visual instruction on how to prepare aphid specimens on microscope slides for examination and indentification. Steps ranging from collection, specimen clear...

  19. Catalog of the adelgids of the world (Hemiptera, Adelgidae)

    Science.gov (United States)

    Colin Favret; Nathan P. Havill; Gary L. Miller; Masakazu Sano; Benjamin Victor

    2015-01-01

    A taxonomic and nomenclatural Catalogue of the adelgids (Hemiptera: Adelgidae) is presented. Six family-group names are listed, five being synonyms of Adelgidae. Twenty-two genus-group names, of which nine are subjectively valid and in use, are presented with their type species, etymology, and grammatical gender. One hundred and six species-group names are listed, of...

  20. The complete mitochondrial genome sequence of Diaphorina citri (Hemiptera: Psyllidae)

    Science.gov (United States)

    The first complete mitochondrial genome (mitogenome) sequence of Asian citrus psyllid, Diaphorina citri (Hemiptera: Psyllidae), from Guangzhou, China is presented. The circular mitogenome is 14,996 bp in length with an A+T content of 74.5%, and contains 13 protein-coding genes (PCGs), 22 tRNA genes ...

  1. Increased riboflavin production from activated bleaching earth by a mutant strain of Ashbya gossypii.

    Science.gov (United States)

    Tajima, Satoshi; Itoh, Yoko; Sugimoto, Takashi; Kato, Tatsuya; Park, Enoch Y

    2009-10-01

    The production of riboflavin from vegetable oil was increased using a mutant strain of Ashbya gossypii. This mutant was generated by treating the wild-type strain with N-methyl-N'-nitro-N-nitrosoguanidine (MNNG). Riboflavin production was 10-fold higher in the mutant compared to the wild-type strain. The specific intracellular catalase activity after 3 d of culture was 6-fold higher in the mutant than in the wild-type strain. For the mutant, riboflavin production in the presence of 40 mM hydrogen peroxide was 16% less than that in the absence of hydrogen peroxide, whereas it was 56% less for the wild-type strain. The isocitrate lyase (ICL) activity of the mutant was 0.26 mU/mg of protein during the active riboflavin production phase, which was 2.6-fold higher than the wild-type strain. These data indicate that the mutant utilizes the carbon flux from the TCA cycle to the glyoxylate cycle more efficiently than the wild-type strain, resulting in enhanced riboflavin production. This novel mutant has the potential to be of use for industrial-scale riboflavin production from waste-activated bleaching earth (ABE), thereby transforming a useless material into a valuable bioproduct.

  2. “Candidatus Phytoplasma pyri” affects behavior of Cacopsylla pyricola (Hemiptera: Psyllidae)

    Science.gov (United States)

    Pear psylla, Cacopsylla pyricola (Hemiptera: Psyllidae), is a key pest of pear and is a vector of "Candidatus Phytoplasma pyri", the pathogen associated with pear decline disease. Although commercial pear trees are grafted to Phytoplasma-resistant rootstock, a recent report indicated that many C. p...

  3. Observations on some species of the genus Lyramorpha Westw. (Hemiptera Heteroptera)

    NARCIS (Netherlands)

    Schouteden, H.

    1908-01-01

    1. Lyramorpha pallida Westwood and L. rosea Westwood. In his »Catalogue of Hemiptera in the Collection of the Rev. W. F. Hope”, part I, London 1837, Westwood founded the genus Lyramorpha, with two species, L. rosea and L. pallida, both from New Holland.

  4. First report and morphological redescription of Teleonemia morio (Stål (Hemiptera, Tingidae in Annona squamosa L. (Annonaceae in Brazil

    Directory of Open Access Journals (Sweden)

    Sônia M. F. Broglio

    2012-03-01

    Full Text Available First report and morphological redescription of Teleonemia morio (Stål (Hemiptera, Tingidae in Annona squamosa L. (Annonaceae in Brazil. This is the first report of a severe attack of Teleonemia morio (Stål, 1855 (Hemiptera, Heteroptera, Tingidae on Annona squamosa L. (custard apple, causing up to 80% of losses of infested trees. In order to facilitate the identification of this insect pest, the adult female of T. morio is redescribed based on specimens collected in Palmeira dos Índios, Alagoas, Brazil.Primeiro registro e redescrição morfológica de Teleonemia morio (Stål (Hemiptera, Tingidae em Annona squamosa L. (Annonaceae no Brazil. Este é o primeiro registro de um ataque severo de Teleonemia morio (Stål, 1855 (Hemiptera, Heteroptera, Tingidae em árvores de Annona squamosa L. (pinheira ou fruta-do-conde, resultando em perdas de aproximadamente 80% das plantas infestadas. Com o objetivo de facilitar a identificação deste inseto-praga, foi feita a redescrição da fêmea adulta de T. morio com base em espécimes coletados em Palmeira dos Índios, Alagoas, Brasil.

  5. Spruce aphid (Elatobium abietinum Walker) (Hemiptera: Aphididae) [Chapter XXIV

    Science.gov (United States)

    Ann M. Lynch

    2014-01-01

    Elatobium abietinum Walker is a spruce-feeding aphid that in Europe is referred to as the green spruce aphid (Day et al., 1998a) (Fig. 1). However, in North America E. abietinum is known simply as the spruce aphid, while the common name "green spruce aphid" refers to a different species, Cinara fornacula Hottes (Hemiptera: Aphididae) (http://www.entsoc.org/...

  6. Rhizoecus colombiensis Ramos & Caballero, a new species of hypogeal mealybug (Hemiptera: Coccomor.

    Science.gov (United States)

    Ramos-Portilla, Andrea Amalia; Caballero, Alejandro

    2016-03-14

    A new species belonging to Rhizoecus Künckel d'Herculais (Hemiptera: Coccomorpha: Rhizoecidae) is described, with hosts and distribution data in the New World. A dichotomous and illustrated key for the twelve species of Rhizoecus recorded from Colombia is presented.

  7. Preparing soft-bodied arthropods for microscope examination: Soft Scales (Insecta: Hemiptera: Coccidae)

    Science.gov (United States)

    Proper identification of soft scales (Hemiptera:Coccidae) requires preparation of the specimen on a microscope slide. This training video provides visual instruction on how to prepare soft scale specimens on microscope slides for examination and identification. Steps ranging from collection, speci...

  8. Instar- and stage-specific photoperiodic diapause response of Lygus hesperus (Hemiptera: Miridae)

    Science.gov (United States)

    The western tarnished plant bug (Lygus hesperus Knight)(Hemiptera:Miridae) is a polyphagous pest of numerous western crops. This pest overwinters in a relatively short duration adult diapause, but many details regarding diapause induction and maintenance remain unstudied. Instar-specific responses t...

  9. Preparing sternorrhynchous insects (Insecta: Hemiptera: Sternorrhyncha) for microscope examination: Hoyer’s mounting medium

    Science.gov (United States)

    Proper identification of aphids, scale insects, psyllids, and whitefles (Hemiptera: Sternorrhyncha) require preparation of the specimen on a microscope slide. This training video provides visual instruction on how to prepare sternorrhynchous specimens on microscope slides for examination and identi...

  10. Preparing soft-bodied arthropods for arthropods for microscope examination: Mealybugs (Insects: Hemiptera: Pseudococcidae)

    Science.gov (United States)

    Proper identification of mealybugs (Hemiptera: Pseudococcidae) require preparation of the specimen on a microscope slide. This training video provides visual instruction on how to prepare mealybug specimens on microscope slides for examination and identification. Steps ranging from collection, spec...

  11. Hemiptera Mitochondrial Control Region: New Sights into the Structural Organization, Phylogenetic Utility, and Roles of Tandem Repetitions of the Noncoding Segment

    Directory of Open Access Journals (Sweden)

    Kui Li

    2018-04-01

    Full Text Available As a major noncoding fragment, the control region (CR of mtDNA is responsible for the initiation of mitogenome transcription and replication. Several structural features of CR sequences have been reported in many insects. However, comprehensive analyses on the structural organization and phylogenetic utility, as well as the role of tandem replications (TRs on length variation, high A+T content, and shift of base skew of CR sequences are poorly investigated in hemipteran insects. In this study, we conducted a series of comparative analyses, using 116 samples covering all 11 infraorders of the five currently recognized monophyletic groups in the Hemiptera. Several structural elements (mononucleotide stretches containing conserved sequence blocks (CSBs, TRs, and GA-rich region were identified in the mitochondrial control region in hemipteran insects, without showing a consistent location. The presence and absence of certain specific structural elements in CR sequences show the various structural organizations of that segment among the five monophyletic groups, which indicates the diversification of the control region’s structural organization in Hemiptera. Among the many groups within Hemiptera, eight monophyletic groups and three consistent phylogenetic trees were recovered, using CSBs datasets by maximum likelihood and Bayesian methods, which suggests the possible utility of CR sequences for phylogenetic reconstruction in certain groups of Hemiptera. Statistical analyses showed that TRs may contribute to the length variation, high AT content, and the shift of base skewing of CR sequences toward high AT content in the Hemiptera. Our findings enrich the knowledge of structural organization, phylogenetic utility, and roles of tandem replication of hemipteran CR, and provide a possible framework for mitochondrial control region analyses in hemimetabolous insects.

  12. Scymnus camptodromus (Coleoptera: Coccinellidae) larval development and predation of hemlock woolly adelgid (Hemiptera: Adelgidae)

    Science.gov (United States)

    Samita Limbu; Melody A. Keena; David Long; Nancy Ostiguy; Kelli. Hoover

    2015-01-01

    Development time and prey consumption of Scymnus (Neopullus) camptodromus Yu and Liu (Coleoptera: Coccinellidae) larvae by instar, strain, and temperature were evaluated. S. camptodromus, a specialist predator of hemlock woolly adelgid Adelges tsugae (Annand) (Hemiptera:...

  13. New species of Braggia (Hemiptera: Aphididae) on buckwheat in western North America

    Science.gov (United States)

    K. S. Pike; G. Graf; R. G. Foottit; H. E. L. Maw; P. Stary; R. Hammon; D. G. Miller

    2009-01-01

    Species of Braggia Gillette and Palmer (Hemiptera: Aphididae: Aphidinae: Aphidini) feed on various buckwheat, Eriogonum Michx. (Polygonaceae), species in western North America. Two new species, Braggia columbiana Pike n. sp. from Washington and Oregon and Braggia longicauda Pike n. sp. from Washington, Oregon, and northern California, are proposed. Descriptions,...

  14. Gut content analysis of a phloem-feeding insect, Bactericera cockerelli (Sulc) (Hemiptera: Triozidae)

    Science.gov (United States)

    Potato psyllid, Bactericera cockerelli (Šulc) (Hemiptera: Triozidae) is a key pest of potato (Solanum tuberosum L., Solanales: Solanaceae) and a vector of "Candidatus Liberibacter solanacearum," the pathogen associated with zebra chip disease. In addition to its presence on cultivated crops, the p...

  15. Distribution and Abundance of Adelges tsugae (Hemiptera: Adelgidae) Within Hemlock Trees

    Science.gov (United States)

    S.V. Joseph; J.L. Hanula; S.K. Braman

    2011-01-01

    We studied the distribution of hemlock woolly adelgid, Adelges tsugae Annand (Hemiptera: Adelgidae), within hemlock trees for three summer (progrediens) and two winter (sistens) generations in northern Georgia. Eastern hemlock, Tsuga canadensis (L.) Carrie` re, trees were treated with 0, 10, or 25% of 1.5 g of imidacloprid per 2.5 cm of tree diameter at breast height...

  16. Effects of fertilizer and low rates of Imidacloprid on Adelges tsugae (Hemiptera: Adelgidae).

    Science.gov (United States)

    S. V. Joseph; James Hanula; S. K. Braman; F. J. Byrne

    2011-01-01

    Healthy hemlock trees, Tsuga canadensis (L.) Carriere, and hemlock woolly adelgid, Adelges tsugae Annand (Hemiptera: Adelgidae), populations should favor retention and population growth of adelgid predators such as Laricobius nigrinus Fender (Coleoptera: Derodontidae) and Sasajiscymnus tsugae (Sasaji&McClure) (Coleoptera: Coccinellidae). Eastern hemlock trees...

  17. Revisional notes on the genus Melucha (Hemiptera, Heteroptera, Coreidae

    Directory of Open Access Journals (Sweden)

    Harry Brailovsky

    2014-05-01

    Full Text Available Melucha grandicula sp. n. and M. perampla sp. n., (Hemiptera: Heteroptera: Coreidae: Coreinae: Nematopodini are described from Bolivia, Colombia, Paraguay and Peru. Melucha quadrivittis Stål, 1862, stat. restit., is resurrected from synonymy under M. phyllocnemis (Burmeister, 1835. Melucha ruficornis Breddin, 1903, syn. n., is synonymized under M. lineatella (Fabricius, 1803. An identification key for the known species of Melucha Amyot & Serville, 1843 is given. New distributional records for some previously known species are added.

  18. First report and morphological redescription of Teleonemia morio (Stål (Hemiptera, Tingidae in Annona squamosa L. (Annonaceae in Brazil

    Directory of Open Access Journals (Sweden)

    Sônia M. F. Broglio

    2012-03-01

    Full Text Available First report and morphological redescription of Teleonemia morio (Stål (Hemiptera, Tingidae in Annona squamosa L. (Annonaceae in Brazil. This is the first report of a severe attack of Teleonemia morio (Stål, 1855 (Hemiptera, Heteroptera, Tingidae on Annona squamosa L. (custard apple, causing up to 80% of losses of infested trees. In order to facilitate the identification of this insect pest, the adult female of T. morio is redescribed based on specimens collected in Palmeira dos Índios, Alagoas, Brazil.

  19. Identification of a new species of Aphis (Hemiptera: Aphididae) based on distinct morphology

    Science.gov (United States)

    Aphis elena Lagos-Kutz and Voegtlin, sp. nov. (Hemiptera: Aphididae), is described from specimens collected in Illinois, USA, on the North American native plant, Pycnanthemum virginianum (L.) T. Dur. & B.D. Jacks. ex B.L. Rob. & Fernald (Family: Lamiaceae). Both apterous and alate viviparae are desc...

  20. Descriptions of two new species of Sphenorhina (Hemiptera, Cercopidae, Tomaspidinae from the Neotropical region

    Directory of Open Access Journals (Sweden)

    Andressa Paladini

    2013-06-01

    Full Text Available Description of two new species of Sphenorhina (Hemiptera, Cercopidae, Tomaspidinae from the Neotropical region. Two new species of Sphenorhina Amyot & Serville, S. pseudoboliviana SP. NOV: from Bolivia and S. plata SP. NOV: from Argentina are described and illustrated.

  1. Preparing soft-bodied arthropods for arthropods for microscope examination: Armored Scales (Insects: Hemiptera: Diaspididae)

    Science.gov (United States)

    Proper identification of armored scales (Hemiptera: Diaspididae) requires preparation of the specimen on a microscope slide. This training video provides visual instruction on how to prepare armored scales specimens on microscope slides for examination and identification. Steps ranging from collect...

  2. Mitochondrial phylogenomics of Hemiptera reveals adaptive innovations driving the diversification of true bugs

    Science.gov (United States)

    Li, Hu; Leavengood, John M.; Chapman, Eric G.; Burkhardt, Daniel; Song, Fan; Jiang, Pei; Liu, Jinpeng; Cai, Wanzhi

    2017-01-01

    Hemiptera, the largest non-holometabolous order of insects, represents approximately 7% of metazoan diversity. With extraordinary life histories and highly specialized morphological adaptations, hemipterans have exploited diverse habitats and food sources through approximately 300 Myr of evolution. To elucidate the phylogeny and evolutionary history of Hemiptera, we carried out the most comprehensive mitogenomics analysis on the richest taxon sampling to date covering all the suborders and infraorders, including 34 newly sequenced and 94 published mitogenomes. With optimized branch length and sequence heterogeneity, Bayesian analyses using a site-heterogeneous mixture model resolved the higher-level hemipteran phylogeny as (Sternorrhyncha, (Auchenorrhyncha, (Coleorrhyncha, Heteroptera))). Ancestral character state reconstruction and divergence time estimation suggest that the success of true bugs (Heteroptera) is probably due to angiosperm coevolution, but key adaptive innovations (e.g. prognathous mouthpart, predatory behaviour, and haemelytron) facilitated multiple independent shifts among diverse feeding habits and multiple independent colonizations of aquatic habitats. PMID:28878063

  3. Synthesis and biological activity of a new class of insecticides: the N-(5-aryl-1,3,4-thiadiazol-2-yl)amides.

    Science.gov (United States)

    Eckelbarger, Joseph D; Parker, Marshall H; Yap, Maurice Ch; Buysse, Ann M; Babcock, Jonathan M; Hunter, Ricky; Adelfinskaya, Yelena; Samaritoni, Jack G; Garizi, Negar; Trullinger, Tony K

    2017-04-01

    Optimization studies on a high-throughput screening (HTS) hit led to the discovery of a series of N-(6-arylpyridazin-3-yl)amides with insecticidal activity. It was hypothesized that the isosteric replacement of the pyridazine ring with a 1,3,4-thiadiazole ring could lead to more potent biological activity and/or a broader sap-feeding pest spectrum. The resulting N-(5-aryl-1,3,4-thiadiazol-2-yl)amides were explored as a new class of insecticides. Several methods for 2-amino-1,3,4-thiadiazole synthesis were used for the preparation of key synthetic intermediates. Subsequent coupling to variously substituted carboxylic acid building blocks furnished the final targets, which were tested for insecticidal activity against susceptible strains of Aphis gossypii (Glover) (cotton aphid), Myzus persicae (Sulzer) (green peach aphid) and Bemisia tabaci (Gennadius) (sweetpotato whitefly). Structure-activity relationship (SAR) studies on both the amide tail and the aryl A-ring of novel N-(5-aryl-1,3,4-thiadiazol-2-yl)amides led to a new class of insecticidal molecules active against sap-feeding insect pests. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

  4. Hemiptera community and species responses to grassland sward islets

    OpenAIRE

    Helden, Alvin J.; Dittrich, Alex D. K.

    2016-01-01

    Sward islet is a term that has been used to describe a patch of longer vegetation in a pasture produced by a reduction in cattle grazing around their dung. They are known to affect the abundance and distribution of grassland arthropods. Hemiptera, like other groups, are found in higher densities within islets than the surrounding sward. Does this modify the community composition or is there just a density effect? Evidence from a paired (islets, non-islets) study at an Irish cattle-grazed site...

  5. Morphometrics of the Southern Green Stink Bug [Nezara viridula (L.) (Hemiptera: Pentatomidae)] Stylet Bundle

    Science.gov (United States)

    The southern green stink bug, Nezara viridula (L.) (Hemiptera: Pentatomidae), is a cosmopolitan pest of high-value cash crops, including cotton (Gossypium hirsutum L.; Malvales: Malvaceae). The pest can ingest and transmit disease-causing bacterial and fungal pathogens of cotton. We hypothesized t...

  6. Fooling the harlequin bug (Hemiptera: Pentatomidae) using synthetic volatiles to alter host plant choice

    Science.gov (United States)

    Harlequin bug, Murgantia histrionica (Hahn) (Hemiptera: Pentatomidae), is a widespread invasive pest that feeds on a variety of brassicaceous crops and other plants. To understand olfactory cues which mediate host-finding, and possible utility in pest management, we deployed aggregation pheromone (m...

  7. Attraction of stink bug (Hemiptera: Pentatomidae) nymphs to Euschistus aggregation pheromone in the field

    Science.gov (United States)

    Phytophagous stink bugs (Hemiptera: Pentatomidae) are primary pests in most fruit, vegetable, grain, and row crops worldwide. Pheromones have been identified and synthesized for several species of economically important stink bug pests. When yellow pyramid traps are baited with lures containing thes...

  8. Phylogenetic divergences of the true bugs (Insecta: Hemiptera: Heteroptera), with emphasis on the aquatic lineages

    DEFF Research Database (Denmark)

    Wang, Yan-hui; Cui, Ying; Rédei, Dávid

    2016-01-01

    Heteroptera are among the most diverse hemimetabolous insects. Seven infraorders have been recognized within this suborder of Hemiptera. Apart from the well-established sister-group relationship between Cimicomorpha and Pentatomomorpha (= Terheteroptera), the two terminal lineages, the relationsh...

  9. Association of Verde plant bug, Creontiades signatus (Hemiptera: Miridae), with cotton boll rot

    Science.gov (United States)

    Cotton along the Gulf Coast of south Texas has experienced loss from cotton boll rot especially during the last 10 to 15 years, and stink bugs and plant bugs (Hemiptera: Pentatomidae and Miridae) that feed on cotton bolls have been suspected in introducing the disease. A replicated grower field surv...

  10. Stylet bundle morphology and trophically related enzymes of the hemlock woolly adelgid (Hemiptera: Adelgidae)

    Science.gov (United States)

    Kelly L.F. Oten; Allen C. Cohen; Fred P. Hain

    2014-01-01

    The hemlock woolly adelgid, Adelges tsugae Annand (Hemiptera: Adelgidae), is a pest of eastern and Carolina hemlocks (Tsuga canadensis (L.) Carriere and Tsuga caroliniana Engelmann, respectively) in the eastern United States and has already caused catastrophic changes to eastern forests. As one of the significant...

  11. An overview on the ecology of Triatominae (Hemiptera:Reduviidae).

    Science.gov (United States)

    Galvão, Cleber; Justi, Silvia A

    2015-11-01

    Chagas disease, the American trypanosomiasis, is an important neglected tropical illness caused by the flagellate protozoan Trypanosoma cruzi (Kinetoplastida, Trypanosomatidae) and transmitted by insects of the subfamily Triatominae (Hemiptera: Reduviidae). Here we provide an overview on the current knowledge about Triatominae ecology, its association with human, T. cruzi infection and the immediate consequences of habitat fragmentation. We also discuss the geographic distribution of the species and the importance of predicting their distributions to control programs. Copyright © 2015 Elsevier B.V. All rights reserved.

  12. Relative Abundance of Carsonella ruddii (Gamma Proteobacterium) in Females and Males of Cacopsylla pyricola (Hemiptera: Psyllidae) and Bactericera cockerelli (Hemiptera: Triozidae)

    Science.gov (United States)

    Cooper, W. Rodney; Garczynski, Stephen F.; Horton, David R.

    2015-01-01

    Carsonella ruddii (Gamma Proteobacterium) is an obligate bacterial endosymbiont of psyllids that produces essential amino acids that are lacking in the insect’s diet. Accurate estimations of Carsonella populations are important to studies of Carsonella-psyllid interactions and to developing ways to target Carsonella for control of psyllid pests including pear psylla, Cacopsylla pyricola (Förster) (Hemiptera: Psyllidae) and potato psyllid, Bactericera cockerelli (Šulc) (Hemiptera: Triozidae). We used two methods, namely fluorescence in situ hybridization and quantitative polymerase chain reaction (qPCR), to estimate relative abundance of Carsonella in bacteriocytes and whole bodies of psyllids, respectively. Using these two methods, we compared Carsonella populations between female and male insects. Estimations using fluorescence in situ hybridization indicated that Carsonella was more abundant in bacteriocytes of female C. pyricola than in those of males, but Carsonella abundance in bacteriocytes did not differ between sexes of B. cockerelli. Analyses by qPCR using whole-body specimens indicated Carsonella was more abundant in females than in males of both psyllids. Neither fluorescence in situ hybridization nor qPCR indicated that Carsonella populations differed in abundance among adults of different ages (0–3 wk after adult eclosion). Using fluorescence in situ hybridization, Carsonella was observed in ovarioles of newly emerged females and formed an aggregation in the posterior end of mature oocytes. Results of our study indicate that female psyllids harbor greater populations of Carsonella than do males and that sex should be controlled for in studies which require estimations of Carsonella populations. PMID:26056318

  13. Allozyme Variation in Hemlock Woolly Adelgid (Hemiptera: Adelgidae) from the United States and China

    Science.gov (United States)

    V. S& #225; nchez; M.A. Keena; M.A. Keena

    2009-01-01

    The hemlock woolly adelgid, Adelges tsugae Annand (Hemiptera: Adelgidae), is a major introduced pest of eastern hemlock, Tsuga canadensis (L.) Carriere. Hemlock woolly adelgid in the United States is anholocyclic and an obligate parthenogen, because no suitable primary host (on which sexual reproduction occurs in Asia) is...

  14. First record of Acizzia jamatonica (Hemiptera: Psyllidae) in North America: friend or foe?

    Science.gov (United States)

    Michael D. Ulyshen; Douglass Miller

    2007-01-01

    Acizzia jamatonica (Kuwayama) (Hemiptera: Sternorrhyncha: Psyllidae) is reported for the first time in North America. Because the species is thought to feed exclusively on Albizia, it may prove to be an effective biocontrol agent against the invasive Albizia julibrissin Durazzini in the southeastern United States. Because A. julibrissin is also an ornamental plant of...

  15. Effects of founder population size on the performance of Orius laevigatus (Hemiptera: Anthocoridae) colonies

    NARCIS (Netherlands)

    Castañe, C.; Bueno, V.H.P.; Carvalho, L.M.; Lenteren, van J.C.

    2014-01-01

    Orius laevigatus (Hemiptera: Anthocoridae) is a key predator of thrips and is mass reared in large numbers for use in biological control. The aim of this study was to evaluate the effect of founder population size on the biological and behavioral performance of O. laevigatus over time. Laboratory

  16. The genus Alphocoris in the Indomalaya (Hemiptera: Heteroptera: Scutelleridae).

    Science.gov (United States)

    RÉdei, DÁvid; Tsai, Jing-Fu; Jindra, ZdenĚk

    2018-02-21

    The Indomalayan species of the genus Alphocoris Germar, 1839 (Hemiptera: Heteroptera: Scutelleridae: Odontotarsinae: Odontotarsini) are revised. Three species, A. caudatus Rédei, Tsai Jindra, sp. nov. (India: Maharashtra), A. naso Rédei Tsai, sp. nov. (India: Goa), and A. asper Rédei, Tsai Jindra, sp. nov. (India: Goa and Maharashtra), are recognized. The type material of A. lixoides Germar, 1839 (type locality: Senegal) is documented; previous records of this species from India and Pakistan are considered as based on misidentifications, the species is restricted to the Afrotropical Region.

  17. Diaspididae (Hemiptera, Coccoidea in sori of two fern species

    Directory of Open Access Journals (Sweden)

    Marcelo Santos

    2015-12-01

    Duas Espécies de Cochonilhas (Hemiptera: Diaspididae Associadas com Soros de Samambaias Resumo. A presente comunicação relata a presença de duas espécies de cochonilhas Hemiberlesia palmae (Cockerell e Pinnaspis strachani (Cooley (Coccoidea, Diaspididae, associadas respectivamente com Asplenium serratum L. (Aspleniaceae e Niphidium crassifolium (L. Lellinger (Polypodiaceae. É o primeiro registro de uma samambaia como planta hospedeira de Hemiberlesia palmae.  Nas duas espécies de samambaias, os diaspidídeos encontravam-se concentrados principalmente ao redor dos soros.

  18. Mating disruption of Homalodisca vitripennis (Germar) (Hemiptera: Cicadellidae) by playback of vibrational signals in vineyard trellis

    Science.gov (United States)

    BACKGROUND: Glassy-winged sharpshooter (GWSS), Homalodisca vitripennis (Germar) (Hemiptera: Cicadellidae), is an important vector of the bacterium Xylella fastidiosa, the causal agent of Pierce’s disease of grapevine. Area-wide applications of neonicotinoid insecticides have suppressed GWSS populati...

  19. The cicada genus Karenia Distant, 1888 (Hemiptera: Cicadidae), with description of a new species.

    Science.gov (United States)

    Pham, Hong-Thai; Constant, Jerome

    2014-08-19

    The cicadas of the genus Karenia are reviewed, and Karenia tibetensis sp.nov. (Hemiptera: Cicadidae) is described from Tibet, China. Pictures of the male adult and illustrations of the male genitalia are provided. A key to the species of Karenia is presented and the distribution of the Karenia species is discussed.

  20. Relationships between benthic cover, current strength, herbivory, and a fisheries closure in Glovers Reef Atoll, Belize

    Science.gov (United States)

    McClanahan, T.; Karnauskas, M.

    2011-03-01

    Benthic cover, current strengths, and fish abundance and diversity were examined on 150 lagoonal patch reefs and mapped to determine their distribution, inter-relationships, and relationship to the fisheries closure in Glovers Reef Atoll. Current strength was highest at both the northern and southern ends of the atoll and largely controlled by local wind and weakly by tidal forcing. Benthic functional group distributions varied throughout the atoll and had distinct areas of dominance. In contrast, dominance of coral species was weaker, reflecting the lost cover and zonation of Acropora, Porites, and Montastraea that were reported in the 1970s. Hard and soft corals dominated the windward rim, while the central and leeward lagoon had lower current strengths and sea grass and fleshy green algae were relatively more abundant. Brown erect algae were relatively more common in the north and calcifying green and red algae the southern ends of the atoll. Only Montastraea- Agaricia agaricites distributions were similar to reports from the 1970s with high relative dominance in the southern and northeast atoll. The central-northern zone, which was described as an Acropora zone in the 1970s, was not recognizable, and Porites porites, P. astreoides, Millepora alcicornis, and Favia fragum were the most abundant species during this survey . Hard and soft coral cover abundance declined away from the reef rim and tidal channels and was associated with fast seawater turnover and high surgeonfish abundance. Consequently, the windward rim area has retained the most original and persistent hard-soft coral and surgeonfish community and is considered a priority for future management, if the goal is to protect coral from fishing impacts.

  1. Field evaluation of potential pheromone lures for Lygus lineolaris (Hemiptera: Miridae) in the Mid-South

    Science.gov (United States)

    Plant bugs (Hemiptera: Miridae) are phytophagous pests of cultivated plants around the world. In the mid-South region of the United States, Lygus lineolaris is a primary pest of cotton, and causes economic damage. Previously published research about the volatiles produced by members of the genus Lyg...

  2. Two pests overlap: Drosophila suzukii (Diptera: Drosophilidae) use of fruit exposed to Halyomorpha halys (Hemiptera: Pentatomidae)

    Science.gov (United States)

    Spotted wing drosophila, Drosophila suzukii (Matsumura) (Diptera: Drosophilidae), and brown marmorated stink bug, Halyomorpha halys (Stål) (Hemiptera: Pentatomidae) are global economic pests. Both pests may co-occur on small fruits, and we investigated whether fruit recently exposed to H. halys woul...

  3. Molecular and morphological identification of the mealybug pest species, Phenacoccus solani Ferris (Hemiptera: Pseudococcidae), in Egypt

    Science.gov (United States)

    During the summer and autumn of 2016, heavy infestations of the mealybug, Phenacoccus solani Ferris (Hemiptera: Pseudococcidae), were observed on pumpkins, Cucurbita spp. (Cucurbitaceae). This was the first record of the species in Egypt. Several populations have been collected in various pumpkin fr...

  4. Effects of atmospheric pressure trends on calling, mate-seeking, and phototaxis of Diaphorina citri (Hemiptera: Liviidae)

    Science.gov (United States)

    Insects and other animals sometimes modify behavior in response to changes in atmospheric pressure, an environmental cue that can provide warning of potentially injurious windy and rainy weather. To determine if Diaphorina citri (Hemiptera: Liviidae) calling, mate-seeking, and phototaxis behaviors w...

  5. Two new planthopper species (Hemiptera, Fulgoroidea, Caliscelidae) collected in pitfall traps in Zambia.

    Science.gov (United States)

    Chmurova, Lucia; Webb, Michael D

    2016-08-22

    Two new species of planthoppers in the family Caliscelidae (Hemiptera: Fulgoroidea) are described from Zambia, i.e., Afronaso spinosa sp. n. and Calampocus zambiaensis sp. n. All specimens are flightless males and nearly all were collected from baited pitfall traps (except for one specimen collected from a yellow pan trap), suggesting that they live near to or on the ground.

  6. Complete DNA sequence of the mitochondrial genome of the treehopper Leptobelus gazella (Membracoidea: Hemiptera).

    Science.gov (United States)

    Zhao, Xing; Liang, Ai-Ping

    2016-09-01

    The first complete DNA sequence of the mitochondrial genome (mitogenome) of Leptobelus gazelle (Membracoidea: Hemiptera) is determined in this study. The circular molecule is 16,007 bp in its full length, which encodes a set of 37 genes, including 13 proteins, 2 ribosomal RNAs, 22 transfer RNAs, and contains an A + T-rich region (CR). The gene numbers, content, and organization of L. gazelle are similar to other typical metazoan mitogenomes. Twelve of the 13 PCGs are initiated with ATR methionine or ATT isoleucine codons, except the atp8 gene that uses the ATC isoleucine as start signal. Ten of the 13 PCGs have complete termination codons, either TAA (nine genes) or TAG (cytb). The remaining 3 PCGs (cox1, cox2 and nad5) have incomplete termination codons T (AA). All of the 22 tRNAs can be folded in the form of a typical clover-leaf structure. The complete mitogenome sequence data of L. gazelle is useful for the phylogenetic and biogeographic studies of the Membracoidea and Hemiptera.

  7. Time course study of feeding damage to pin head cotton squares by Lygus hesperus (Hemiptera: Miridae)

    Science.gov (United States)

    Lygus hesperus (Hemiptera: Miridae) is an economically important pest affecting cotton crops in California. Lygus feeding causes abscission of cotton squares, with damage severity dependent on size of the square and life stage of the insect. Fifth instar nymphs are the most damaging stage; however, ...

  8. Biology of Leptoypha hospita (Hemiptera: Tingidae), a Potential Biological Control Agent of Chinese Privet

    Science.gov (United States)

    Yanzhuo Zhang; James L. Hanula; Scott Horn; Kristine Braman; Jianghua Sun

    2011-01-01

    The biology of Leptoypha hospita Drake et Poor (Hemiptera: Tingidae), a potential biological control agent from China for Chinese privet, Ligustrum sinense Lour., was studied in quarantine in the United States. Both nymphs and adults feed on Chinese privet mesophyll cells that lead to a bleached appearance of leaves and dieback of branch tips. L. hospita has five...

  9. Contributions to the knowledge of Banasa Stål (Hemiptera, Heteroptera, Pentatomidae: Banasa chaca Thomas

    Directory of Open Access Journals (Sweden)

    Thereza de Almeida Garbelotto

    2011-09-01

    Full Text Available Contributions to the knowledge of Banasa Stål (Hemiptera, Heteroptera, Pentatomidae: Banasa chaca Thomas. The male of Banasa chaca Thomas is described with emphasis on external and internal genitalia and the female internal genitalia is described. Banasa chaca is newly recorded from Buenos Aires Province (Argentina.

  10. EFEITOS DA TEMPERATURA DE INCUBAÇÃO SOBRE O FUNGO colletotrichum gossypii South. var. cephalosporioides EFFECT OF TEMPERATURE INCUBATION ON THE FUNGUS Colletotrichum gossypi SOUTH. Var. cephalosporioides COSTA

    Directory of Open Access Journals (Sweden)

    Yvo de Carvalho

    2007-09-01

    Full Text Available

    Estudou-se o efeito da temperatura de incubação sobre o crescimento vegetativo, esporulação e morfologia da colônia do fungo Colletotrichum gossypii South. var. cephalosporioides Costa, em substrato de batata + dextrose + agar, pH 5,6. O delineamento experimental usado foi o de blocos casualizados e as temperaturas variaram de 12 a 33°C, a intervalos de 3° C. Concluiu-se que a temperatura de incubação afeta notavelmente o crescimento vegetativo, a esporulação e a morfologia da colônia do fungo. Temperaturas acima da faixa ótima provocaram modificações mais acentuadas sobre o crescimento miceliano, esporulação e aspecto morfológico, do que temperaturas baixas. Conídios produzidos em temperaturas extremas, 12 a 33°C, mostraram-se mais curtos que os dos demais tratamentos. A incubação à temperatura de 27°C é a mais recomendável para produção de inóculos em quantidade.

    In this work, the effect of temperature of incubation on the vegetative growth, sporulation and morphology of the colony of the fungus colletotrichum gossypii South. var. cephalosporioides Costa in substrate containing potato + dextrose + agar pH 5.6, was studied. The experimental design used was that of randomized blocks, with temperatures varying from 12 to 33 degrees centigrades, at intervals of 3°C. It was concluded that the temperature of incubation notably affects the vegetative growth, sporulation and morphology of the colony of this fungus. Temperatures above the optimum range caused greater changes in mycelial, sporulation an morphology of the colony than temperatures below this range. Conidia produced at l2 and 33°C were shown to be shorter than those in other treatments. The temperature of incubation recommended for inocule production was 27°C.

  11. A NEW SPECIES OF BEAMERANA YOUNG, 1952 (HEMIPTERA: CICADELLIDAE: TYPHLOCYBINAE FROM SOUTHEASTERN BRAZIL

    Directory of Open Access Journals (Sweden)

    Luci Boa Nova Coelho

    2014-05-01

    Full Text Available A new species of the Neotropical leafhopper genus Beamerana Young, 1952 (Hemiptera: Cicadellidae: Typhlocybinae is described and illustrated based on the specimens from Minas Gerais, southeastern Brazil. Beamerana boomerang sp. nov. differs from its congeners by the fore wing venation and the male genitalia. A key to the species of Beamerana is provided. The genus is recorded for Brazil for the first time.

  12. Primeiro registro de ocorrência do parasitóide Brasema sp. (hymenoptera: eupelmidae em ovos de Leptoglossus zonatus (Dallas, 1852 (hemiptera: coreidae no Brasil First record of occurrence of the parasitoid Brasema sp. (hymenoptera: eupelmidae in eggs of Leptoglossus zonatus (Dallas, 1852 (hemiptera: coreidae in Brazil

    Directory of Open Access Journals (Sweden)

    Carlos Henrique Marchiori

    2002-12-01

    Full Text Available Este trabalho registra a primeira ocorrência do parasitóide Brasema sp. (Hymenoptera: Eupelmidae parasitando ovos de Leptoglossus zonatus (Hemiptera: Coreidae em cultivar de milho em Itumbiara, GO. A porcentagem de parasitismo foi de 4,8%. Brasema sp. constitue-se em ectoparasitóide de larvas de coleópteros e de outros hospedeiros no interior de tecidos de plantas.This work reports, for the first time, of parasitoid Brasema sp. (Hymenoptera: Eupelmidae parasitizinf eggs of Leptoglossus zonatus (Hemiptera: Coreidae in maize cultivate in Itumbiara, GO, Brazil. The percentage of parasitizing was 4,8%. Brasema sp. constitutes ectoparasitoid of beetle larvae and other hosts concealed in plant tissue.

  13. First record in Argentina of Drepanosiphum oregonense Granovsky (Hemiptera: Aphididae) found on maples (Sapindaceae)

    OpenAIRE

    Ortego, Jaime; Olave, Anabel; Mier Durante, Milagros Pilar

    2014-01-01

    Se informa del hallazgo del áfido Drepanosiphum oregonense Granovsky (Hemiptera: Aphididae) sobre árboles de Acer pseudoplatanus y A. campestre (Sapindaceae) en Argentina lo que constituye el primer registro de la especie y del género Drepanosiphum Koch en Argentina y el segundo en Sudamérica. The finding in Argentina of the aphid Drepanosiphum oregonense on "maple tree" Acer pseudoplatanus ...

  14. Occurrence of lace bug Vatiga illudens and Vatiga manihotae (Hemiptera: Tingidae in Mato Grosso do Sul, midwestern Brazil

    Directory of Open Access Journals (Sweden)

    Patrícia P. Bellon

    2012-09-01

    Full Text Available Nymphs and adults of the lace bug (Hemiptera: Tingidae have been found in cassava crops (Manihot esculenta in Mato Grosso do Sul State, Brazil. The insects were collected in the field and taken to the laboratory where they were identified based on some morphological traits of the species Vatiga manihotae (Drake and V. illudens (Drake, which are first reported in the aforementioned state.Ninfas e adultos do percevejo-de-renda (Hemiptera: Tingidae foram encontrados em lavouras de mandioca (Manihot esculenta no Estado do Mato Grosso do Sul, Brasil. Os insetos foram coletados em campo e levados ao laboratório, onde foram identificados com base em algumas características morfológicas nas espécies Vatiga manihotae (Drake e V. illudens (Drake, os quais são registrados pela primeira vez no Estado mencionado.

  15. Predation of Apiomerus pilipes (Fabricius (Hemiptera, Reduviidae, Harpactorinae, Apiomerini over Meliponinae bees (Hymenoptera, Apidae, in the State of Amazonas, Brazil

    Directory of Open Access Journals (Sweden)

    Alexandre Coletto da Silva

    2004-12-01

    Full Text Available The present work shows the occurrence of an intense predatory activity on adults working Meliponinae bees (Hymenoptera, Apidae, by Apiomerus pilipes (Fabricius, 1787 (Hemiptera, Reduviidae, Harpactorinae, Apiomerini at a meliponary in the Instituto Nacional de Pesquisas da Amazônia (INPA, Manaus, Amazonas State, Brazil.O presente trabalho registra a ocorrência de intensa atividade predatória de Apiomerus pilipes (Fabricius, 1787 (Hemiptera, Reduviidae, Harpactorini, Apiomerini sobre operárias adultas de meliponíneos (Hymenoptera, Apidae, no meliponário experimental do Instituto Nacional de Pesquisas da Amazônia (INPA, Manaus, Estado do Amazonas, Brasil. O meliponário se encontra num fragmento de vegetação secundária no próprio INPA.

  16. Evaluation of hemlock (Tsuga) species and hybrids for resistance to Adelges tsugae (Hemiptera: Adelgidae) using artificial infestation

    Science.gov (United States)

    Michael E. Montgomery; S.E. Bentz; Richard T. Olsen

    2009-01-01

    Hemlock (Tsuga) species and hybrids were evaluated for resistance to the hemlock woolly adelgid, Adelges tsugae Annand (Hemiptera: Adelgidae). The adelgid was accidentally introduced from Asia to the eastern United States, where it is causing widespread mortality of the native hemlocks, Tsuga canadensis (L.)...

  17. Pheromone of the banana-spotting bug, amblypelta lutescens lutescens Distant (Hemiptera: Coreidae): identification, synthesis and field bioassay

    Science.gov (United States)

    The banana spotting bug Amblypelta lutescens lutescens Distant (Hemiptera: Coreidae) is one of the principal pests of tree fruits and nuts across northern and eastern Australia. Apart from damage assessments in orchards, there are currently no other methods for monitoring bug activity to aid manage...

  18. Potential transmission of Pantoea spp. and Serratia marcescens (Enterobacteriales: Enterobacteriaceae) to plants by Lygus hesperus (Hemiptera: Miridae)

    Science.gov (United States)

    Lygus hesperus Knight (Hemiptera: Miridae) is a key agricultural pest in the western United States. In a recent study, proteins from Pantoea ananatis and Serratia marcescens (Enterobacteriales: Enterobacteriaceae) were identified in diet that was stylet-probed and fed upon by L. hesperus adults. P...

  19. First record of Sesbania punicea (Fabales: Fabaceae) as a host plant for Chinavia hilaris (Hemiptera: Pentatomidae)

    Science.gov (United States)

    The green stink bug, Chinavia hilaris (Say) (Hemiptera: Pentatomidae), is an economic pest of cotton, Gossypium hirsutum L. Numerous known non-crop hosts of C. hilaris that exist in field edges bordering cotton are sources of this stink bug in this crop. Sesbania punicea plants in a field border su...

  20. Populations of predators and parasitoids of Bemisia tabaci (Hemiptera: Aleyrodidae) after the application of eight biorational insecticides in vegetable crops.

    Science.gov (United States)

    Simmons, Alvin M; Shaaban, Abd-Rabou

    2011-08-01

    The sweetpotato whitefly, Bemisia tabaci (Gennadius) (Hemiptera: Aleyrodidae), is an important pest of vegetables and many other crops worldwide. Eight biorational insecticides (based on oil, plant derivatives, insect growth regulator and fungus) were evaluated in the field for their influence on populations of six natural enemies of B. tabaci. Natural populations of two predators [Chrysoperla carnea Stephen (Neuroptera: Chrysopidae) and Orius spp. (Hemiptera: Anthocoridae)] and two genera of parasitoids [Encarsia spp. and Eretmocerus spp. (Hymenoptera: Aphelinidae)] were evaluated in eggplant (Solanum melongena L.). Also, augmented field populations of three predators [C. carnea, Coccinella undecimpunctata L. (Coleoptera: Coccinellidae) and Macrolophus caliginosus (Wagner) (Hemiptera: Miridae)] were evaluated in cabbage (Brassica oleracea var. capitata L.), cucumber (Cucumis sativus L.) and squash (Cucurbita pepo L.). Regardless of natural enemy or crop, jojoba oil, Biovar and Neemix had the least effect on abundance of the natural enemies in comparison with the other insecticides during a 14 day evaluation period. Conversely, Admiral, KZ oil, Mesrona oil, Mesrona oil + sulfur and natural oil had a high detrimental effect on abundance of the natural enemies. These results demonstrate the differential effects of biorational insecticides for whitefly control on predators and parasitoids in the field. This article is a US Government work and is in the public domain in the USA. Published 2011 by John Wiley & Sons, Ltd.

  1. Comparison of fecundity and survival of hemlock woolly adelgid (Hemiptera: Adelgidae) in northern and southern populations

    Science.gov (United States)

    Artemis Roehrig; Joseph. Elkinton

    2011-01-01

    The hemlock woolly adelgid (HWA), Adelges tsugae Annand (Hemiptera: Adelgidae), is an introduced species first reported in the eastern United States in 1951. The infestation has since spread in all directions from its initial sighting in Virginia, to its current range from northern Georgia, to southern Maine, and westward into Tennessee, causing...

  2. Mitigating trans-boundary movement of Bemisia tabaci (Hemiptera: Aleyrodidae) on Mentha sp. by pre-shipping treaments of biopesticides

    Science.gov (United States)

    Bemisia tabaci (Gennadius) (Hemiptera: Aleyrodidae) is a major pest of several important crops including vegetables, cereals, fruits, and ornamentals grown worldwide. One important mode of its dispersal is through the trans-boundary movement of infested plant materials. In order to prevent the sprea...

  3. CHEMICAL COMPOSITION AND TOXICITY OF CITRUS ESSENTIAL OILS ON Dysmicoccus brevipes (HEMIPTERA: PSEUDOCOCCIDAE)

    OpenAIRE

    MARTINS, GISELE DOS SANTOS OLIVEIRA; ZAGO, HUGO BOLSONI; COSTA, ADILSON VIDAL; ARAUJO JUNIOR, LUIS MOREIRA DE; CARVALHO, JOSÉ ROMÁRIO DE

    2017-01-01

    ABSTRACT The insect Dysmicoccus brevipes (Hemiptera: Pseudococcidae) has been reported as an important pest for several crops, especially coffee. The citrus essential oils can be obtained as by-products of the citrus-processing industry and have been tested as an alternative to control different insect groups. Therefore, the objective of this work was to determine the chemical composition and evaluate the toxicity of commercial sweet orange (Citrus sinensis), bitter orange (Citrus aurantium) ...

  4. Description of a new coccid (Hemiptera, Coccidae on avocado (Persea americana Mill. from Colombia, South America

    Directory of Open Access Journals (Sweden)

    Takumasa Kondo

    2010-04-01

    Full Text Available A new soft scale insect, Bombacoccus aguacatae Kondo, gen. n. and sp. n. (Hemiptera: Coccidae collected on the branches and twigs of avocado, Persea americana Mill. (Lauraceae in Colombia, is described and illustrated based on the adult female. An updated taxonomic key to closely related genera of the Toumeyella-group is provided.

  5. Asociaciones áfido-parasitoide (Hemiptera: Aphididae; Hymenoptera: Braconidae, Aphidiinae en cultivos hortícolas orgánicos en Los Cardales, Buenos Aires, Argentina Aphid-parasitoid associations (Hemiptera: Aphididae; Hymenoptera: Braconidae, Aphidiinae on organic vegetable crops in Los Cardales, Buenos Aires, Argentina

    Directory of Open Access Journals (Sweden)

    Andrea V. Andorno

    2007-07-01

    Full Text Available Diez especies de áfidos (Hemiptera: Aphididae se hallaron parasitados por siete especies de parasitoides (Hymenoptera: Braconidae, Aphidiinae en cultivos hortícolas orgánicos. Myzus persicae (Sulzer fue el áfido más frecuentemente encontrado sobre una amplia variedad de cultivos, y con mayor diversidad de parasitoides asociados. Aphidius colemani Viereck fue el afidiino más usual, que ataca varias especies de áfidos. Ocho asociaciones tritróficas, involucrando Aphidius matricariae Haliday, han sido registradas por primera vez para la Argentina.Ten aphid species (Hemiptera: Aphididae were found parasitized by seven aphid parasitoid species (Hymenoptera: Braconidae, Aphidiinae on organic vegetable crops. Myzus persicae (Sulzer was the most frequent aphid found on a wide variety of crops, with the largest parasitoid diversity associated. Aphidius colemani Viereck was the most frequent aphidiine attacking several species of aphids. Eight tritrophic associations involving Aphidius matricariae Haliday are reported for the first time for Argentina.

  6. Influence of trap color on collection of the recently introduced Bean Plataspid, Megacopta cribraria (Hemiptera: Plataspidae).

    Science.gov (United States)

    Scott Horn; James Hanula

    2011-01-01

    Large numbers of the exotic bean plataspid, Megacopta cribraria (F.) (Hemiptera: Plataspidae). were first collected from several northeast Georgia counties beginning in October 2009 (Suiter and Ames 2009, Statewide Pest Alert). How this insect arrived in the United States and where it came from is still not known. The native range of M. cribraria is reported to be...

  7. Spotted alfalfa aphid, Therioaphis trifolii (Monell) (Hemiptera: Aphididae): Pest on alfalfa in Serbia

    OpenAIRE

    Jovičić, Ivana; Radonjić, Anđa; Petrović-Obradović, Olivera

    2017-01-01

    Spotted alfalfa aphid Therioaphis trifolii (Monell) (Hemiptera, Aphididae) is one of the most important alfalfa pest on the world. Also, it is the most abundant alfalfa aphid in Serbia. This aphid cause damage to alfalfa directly by feeding and indirectly by vectoring plant-pathogenic viruses. Some notes of morphology, host plants, damage, biology, vector role and distribution of spotted alfalfa aphid are given. Abundance of this aphid on alfalfa, influence of climates changes on its abundanc...

  8. Pengaruh Jenis Mangsa dan Suhu pada Perkembangan Menochilus sexmaculatus Fabricius (Coleoptera: Coccinellidae dan Peranannya dalam Pengendalian Diaphorina citri Kuwayama (Hemiptera: Psyllidae

    Directory of Open Access Journals (Sweden)

    Tris Haris Ramadhan

    2008-07-01

    Full Text Available Diaphorina citri Kuwayama (Hemiptera: Psyllidae is the vector of citrus greening (Huanglongbing bacterium and the most serious impediment to citrus culture. Classical biological control of this psyllid vector should contribute to suppress their population. This research was conducted to determine the performance of Menochilus sexmaculatus Fabricius (Coleoptera: Coccinellidae when they were fed with D. citri. The larval performance index of M. sexmaculatus on D. citri compared with Aphis craccivora Koch (Hemiptera: Aphididae diet was 1.3.M. sexmaculatus fed with D. citri had lower fitness than those fed with A. craccivora as shown by longer larval stadium, lower adult dry weight, less number of egg produced and lower percentage of egg hatched. M. sexmaculatus grew best at the temperature of 27oC. Employing the exclusion procedure under field condition,M. sexmaculatus could reduce the population of D. citri up to 90%. These findings showed that theM. sexmaculatus could be a potential predator in reducing D. citri, particularly when the more preferred prey A. craccivora was not present.   Diaphorina citri Kuwayama (Hemiptera: Psyllidae merupakan kelompok Psyllid yang menularkan penyebab penyakit Huanglongbing yang sangat berbahaya pada tanaman jeruk. Pengendalian hayati klasik telah banyak memberikan kontribusi dalam pengendalian di lapangan. Penelitian ini dilakukan untuk melihat penampilan Menochilus sexmaculatus Fabricius (Coleoptera: Coccinellidae dengan pakan D. citri. Indeks penampilan larva M. sexmaculatus dengan pakan D. citri dibandingkan dengan Aphis craccivora Koch (Hemiptera: Aphididae adalah 1,3. M. sexmaculatus yang diberi pakan D. citri menunjukkan penurunan kebugaran dibandingkan jika diberi pakan A. craccivora seperti yang ditunjukkan dengan stadium larva lebih lama, penurunan berat kering serangga dewasa, telur yang dihasilkan lebih sedikit, dan penurunan jumlah telur yang menetas. Menggunakan metode eksklusi pada kondisi

  9. Host range of the exotic brown marmorated stink bug, Halyomorpha halys, (Hemiptera: Pentatomidae), implications for future distribution

    Science.gov (United States)

    Gary Bernon; Karen M. Bernhard; Anne L. Nielsen; James F. Stimmel; E. Richard Hoebeke; Maureen E. Carter

    2007-01-01

    Halyomorpha halys, (Hemiptera: Pentatomidae), is a pest in eastern Asia on soybeans and woody plants, including broadleaved trees and fruit trees. A population was discovered in Allentown, PA in 2001. H. halys is also a nuisance pest as it overwinters in homes and other buildings. Based on earlier reports to the Lehigh County...

  10. Population Dynamics of Empoasca fabae (Hemiptera: Cicadellidae) in Central Iowa Alfalfa Fields

    Science.gov (United States)

    Weiser Erlandson, L. A.; Obrycki, J. J.

    2015-01-01

    Adults and nymphs of Empoasca fabae Harris (Hemiptera: Cicadellidae) and adults of predatory species in the families Coccinellidae, Anthocoridae, Nabidae, Chrysopidae, and Hemerobiidae were sampled in Iowa alfalfa fields from June to September in 1999 and 2000. The relationship between each predatory taxa and E. fabae was examined using regression analysis. In 2000, all predators were found to be positively correlated with the presence of E. fabae during all periods sampled and most likely contributed to mortality. Orius insidiosus (Say) (Hemiptera: Anthoridae) was the most numerous insect predatory species; population numbers ranged from 0 to 1 and 0.1 to 3.7 adults per 0.25 m2 in 1999 and 2000, respectively. Partial life tables were constructed for E. fabae nymphs for two alfalfa-growing periods. Nymphs were grouped into three age intervals: first and second, third and fourth, and fifth instars. For the first alfalfa growing period examined, E. fabae nymphal mortality was 70% in 1999 and 49% in 2000. During the last growing period of each season (August–September), total nymphal mortality was relatively low (<25%). Adult E. fabae density ranged from 5.4 to 25.6 and 1.4–9.2 per 0.25 m2 in 1999 and 2000, respectively. E. fabae population peaks were similar for each age interval in all growing periods. This study provides further information on the population dynamics of E. fabae and its relationship with select predatory species in Iowa alfalfa fields. PMID:26320260

  11. Prey suitability and phenology of Leucopis spp. (Diptera: Chamaemyiidae) associated with hemlock woolly adelgid (Hemiptera: Adelgidae) in the Pacific Northwest

    Science.gov (United States)

    Sarah M. Grubin; Darrell W. Ross; Kimberly F. Wallin

    2011-01-01

    Leucopis spp. (Diptera: Chamaemyiidae) from the Pacific Northwest previously were identified as potential biological control agents for the hemlock woolly adelgid, Adelges tsugae Annand (Hemiptera: Adelgidae), in the eastern United States. We collected Leucopis spp. larvae from A. tsugae...

  12. Monitoring of brown stink bug (Hemiptera: Pentatomidae) population dynamics in corn to predict its abundance using weather data

    Science.gov (United States)

    The brown stink bug (BSB), Euschistus servus (Say) (Hemiptera: Pentatomidae), is a serious economic pest of corn production in the Southeastern U. S. The BSB population dynamics was monitored for 17 wks from tasseling to pre-harvest of corn plants (i.e., late May to mid-September) using pheromone ...

  13. Identification of a sex pheromone of the chrysanthemum lace bug Corythucha marmorata (Hemiptera: Tingidae)

    OpenAIRE

    Watanabe, Kisaki; Shimizu, Nobuhiro

    2017-01-01

    Although the nymphs of Corythucha marmorata form clusters on the undersides of host plant leaves, as frequently observed for Hemiptera, the adults are scattered in the vicinity of the nymph population. By investigating the biological activities of volatile secretions from the adult, we found that the secretions activated male mounting behaviour. A chemical analysis revealed that borneol was a common component of the secretions from both sexes. The absolute configuration of the natural product...

  14. Biological parameters and thermal requirements of the parasitoid Praon volucre (Hymenoptera: Braconidae) with Macrosiphum euphorbiae (Hemiptera: Aphididae) as host

    NARCIS (Netherlands)

    Conti, De B.F.; Bueno, V.H.P.; Sampaio, M.V.; Lenteren, van J.C.

    2011-01-01

    The effect of temperature on the biology of Praon volucre (Haliday, 1833) (Hymenoptera: Braconidae) in Macrosiphum euphorbiae (Thomas, 1878) (Hemiptera: Aphididae) hosts was studied and the thermal requirements of the parasitoid were determined. Experiments were carried out at 16, 19, 22, 25, and 28

  15. Brochosome influence on parasitisation efficiency of Homalodisca coagulata (Say) (Hemiptera: Cicadellidae) egg masses by Gonatocerus ashmeadi Girault (Hymenoptera : Mymaridae)

    NARCIS (Netherlands)

    Velema, H.P.; Hemerik, L.; Hoddle, M.S.; Luck, R.F.

    2005-01-01

    1. Many cicadellid females in the tribe Proconiini (Hemiptera: Cicadellidae) cover their egg masses with specialised, usually rod-shaped, brochosomes as the eggs are being laid. The brochosomes are produced in Golgi complexes in the Malpighian tubules of Cicadellidae. In contrast to the gravid

  16. Occurrence of the Tamarix Leafhopper, Opsius stactogalus Fieber (Hemiptera: Cicadellidae), in Argentina.

    Science.gov (United States)

    Virla, Eduardo G; Logarzo, Guillermo A; Paradell, Susana L

    2010-01-01

    The paleartic tamarix leafhopper, Opsius stactogalus Fieber (Hemiptera: Cicadellidae), can reduce the growth of tamarisk due to the aggregate feeding imposed by their populations. The species was mentioned for Argentina in Metcalf's catalogue (1967) without locality or region reference, and the contributions on Cicadellidae published by many authors after Metcalf omitted this distributional data. Populations of O. stactogalus on Tamarix sp. were found in 12 sites between 28 degrees 48' to 39 degrees 17' S and 64 degrees 06' to 70 degrees 04' W, located in both the Neotropical and Andean biogeographic regions.

  17. A review of Chinese tribe Achilini (Hemiptera: Fulgoromorpha: Achilidae), with descriptions of Paracatonidia webbeda gen. & sp. nov.

    Science.gov (United States)

    Long, Jian-Kun; Yang, Lin; Chen, Xiang-Sheng

    2015-12-02

    Planthoppers of the tribe Achilini (Hemiptera: Fulgoromorpha: Achilidae) from China, are reviewed. A key to the three genera of Chinese Achilini is given. A new genus and species of the tribe from southwestern China: Paracatonidia webbeda gen. & sp. nov., is described. A new genus and species record for China, Cixidia kasparyani Anufriev, is also given.

  18. Complex of primary and secondary parasitoids (Hymenoptera: Encyrtidae and Signiphoridae) of Hypogeoccoccus spp. mealybugs (Hemiptera: Pseudococcidae) in the New World

    Science.gov (United States)

    Parasitoids, both primary and secondary (hyperparasitoids), of Hypogeococcus spp. mealybugs (Hemiptera: Pseudococcidae) are reviewed to report results of the surveys in the New World conducted during 2009–2017 for perspective natural enemies of the Harrisia cactus mealybug, Hypogeococcus sp., which ...

  19. Population fluctuation of Empoasca sp. (Hemiptera: Cicadellidae in a physic nut crop in Mato Grosso do Sul

    Directory of Open Access Journals (Sweden)

    Denisar Paggioli de Carvalho

    2016-01-01

    Full Text Available Physic nut (Jatropha curcas L. is an oilseed, semi-evergreen shrub or small tree of the Euphorbiaceae family, whose seeds contain oil that can be processed into a high quality biofuel. However, there have been reports of arthropods feeding from its leaves, including the green leafhopper Empoasca sp. (Hemiptera: Cicadellidae. The large numbers of this insect, observed in certain periods of the year in many regions of Brazil, are causing damage to the oilseed crops. This study aims at evaluating the fluctuation in green leafhopper population in a physic nut crop in Dourados, Mato Grosso do Sul, to assess possible correlations with rainfall, maximum, average and minimum temperatures. This evaluation was conducted between March 2011 and July 2012. The largest Empoasca sp. populations were recorded in May and June, 2011, and between February and May, 2012. No significant correlation was observed between the weather parameters analyzed and the fluctuation in the Hemiptera population, but there was a trend toward higher population density during the warmer and rainier months.

  20. Effects of fertilization of four hemlock species on Adelges tsugae (Hemiptera: Adelgidae) growth and feeding preference of predators.

    Science.gov (United States)

    S.V. Joseph; James Hanula

    2011-01-01

    Understanding how fertilization affects host resistance to hemlock woolly adelgid, Adelges tsugae Annand (Hemiptera:Adelgidae), is important because fertilizers are often used to grow resistant selections to a suitable size for testing. We evaluated four hemlock species (Tsuga) under three different fertilizer regimes to assess whether fertility affected resistance to...

  1. A new species of Tamarixia Mercet (Hymenoptera, Eulophidae, parasitoid of Trioza aguacate Hollis & Martin (Hemiptera, Triozidae in Mexico

    Directory of Open Access Journals (Sweden)

    Zoya Yefremova

    2014-01-01

    Full Text Available Tamarixia aguacatensis Yefremova, sp. n. (Hymenoptera: Eulophidae: Tetrastichinae is described from Mexico as a parasitoid of the avocado psyllid, Trioza aguacate Hollis & Martin (Hemiptera: Triozidae. Trioza aguacate is a serious pest of avocado, Persea americana Miller. A key to the species of Tamarixia Mercet in Mexico is given.

  2. Limited predation potential by adult and larval lady beetles (Coleoptera: Coccinellidae) on Nezara viridula (Hemiptera: Pentatomidae) eggs and nymphs

    Science.gov (United States)

    The Coccinellidae (Coleoptera) co-occur in many habitats with many arthropods that are of suitable size as prey. The Pentatomidae (Hemiptera) are one such group of insects with eggs and early instars that could be susceptible to predation by Coccinellidae. The objective of this laboratory study wa...

  3. Rapid Communication. Tamarixia monesus (Walker (Hym.: Eulophidae parasitoid of Bactericera tremblayi (Wagner, 1961 (Hemiptera: Triozidae in Iran

    Directory of Open Access Journals (Sweden)

    Lotfalizadeh Hossein

    2016-08-01

    Full Text Available Bactericera tremblayi (Wagner, 1961 (Hemiptera: Triozidae is reported on Brassica oleracea var. capitata (Brassicaceae in northwestern Iran. Tamarixia monesus (Walker (Hymenoptera: Chalcidoidea, Eulophidae was reared for the first time on B. tremblayi, and compared with Tamarixia tremblayi, another parasitoid of B. tremblayi. This is a new record of T. monesus from the Middle East.

  4. An unusual new species of Hallodapomimus Herczek, 2000 from the Eocene Baltic amber (Hemiptera, Heteroptera, Miridae, Phylinae

    Directory of Open Access Journals (Sweden)

    Aleksander Herczek

    2015-03-01

    Full Text Available Hallodapomimus antennatus sp. n. (Hemiptera: Heteroptera, Miridae, Phylinae, Hallodapini is described from a macropterous female found in Eocene Baltic amber. The new species can be recognized readily from the other species of the genus, mainly due to its unusual second antennal segment. A key for the identification of all known fossil Hallodapini is presented.

  5. Portanus Ball: descrição de uma espécie nova (Hemiptera, Cicadellidae, Xestocephalinae

    Directory of Open Access Journals (Sweden)

    Adenomar Neves de Carvalho

    2004-01-01

    Full Text Available Portanus dubius sp. nov. é descrita e ilustrada a partir de espécimens que foram coletados com armadilha Malaise durante um levantamento entomológico no Estado do Paraná, Brasil (PROFAUPAR.Portanus Ball: description of a new species (Hemiptera, Cicadellidae, Xestocephalinae. Portanus dubius sp. nov. is described and illustrated. The specimens were collected with Malaise trap during an entomological inventory in Paraná State, Brazil (PROFAUPAR.

  6. Scale insects (Hemiptera: Coccomorpha) on sugarcane in Colombia, with description of a new species of Tillancoccus Ben-Dov (Coccidae).

    Science.gov (United States)

    Caballero, Alejandro; Ramos-Portilla, Andrea Amalia; Kondo, Takumasa

    2017-05-02

    Herein we describe a new species, Tillancoccus koreguajae Caballero & Ramos, sp. n. (Hemiptera: Coccidae) from Colombia collected on sugarcane. Pinnaspis strachani (Cooley) is also recorded on sugarcane for the first time worldwide. An updated list of seven species of Coccomorpha on sugarcane in Colombia is provided, including information on its distribution, biology, and mutualistic ants for each species. Seven species of scale insects (Hemiptera: Coccomorpha) have been recorded previously on sugarcane, Saccharum officinarum L. (Poaceae) in Colombia: Pseudococcidae: Dysmicoccus boninsis (Kuwana), D. brevipes (Cockerell), Pseudococcus calceolariae (Maskell), Saccharicoccus sacchari (Cockerell); Coccidae: Pulvinaria elongata Newstead; Diaspididae: Duplachionaspis divergens (Green) and Serenaspis minima (Maskell). However, the record of S. minima in Colombia is considered doubtful as there are no voucher specimens from Colombia and because the distribution of this species is currently limited to the Australasian region. Pseudococcus calceolariae is present in Colombia but its record on sugarcane is also doubtful. A taxonomic key for the identification of scale insects on sugarcane in Colombia is provided.

  7. Thlastocoris laetus Mayr, 1866 (hemiptera: coreidae: acanthocerini) nueva plaga de la piña

    OpenAIRE

    Couturier,G.; Brailovsky,H.; Zucchi,R.A.

    1993-01-01

    Thlastocoris laetus (Hemiptera: Coreidae) es por primera vez señalado como plaga de la piña para la Amazonia brasileña y peruana comentando los daños que ocasiona. Se presenta la caracterización morfológica de esta especie, comparandola con Lybindus dichrous que también es reconocido como plaga de la piña en el Brasil. La distribución geográfica de ambas especies es citada.

  8. First report of Idiopterus nephrelepidis Davis, 1909 (Hemiptera: Aphididae from Bulgaria

    Directory of Open Access Journals (Sweden)

    Elena Tasheva-Terzieva

    2011-11-01

    Full Text Available Idiopterus nephrelepidis (Hemiptera: Aphididae is reported for the first time in Bulgaria on ornamental ferns in four greenhouses in Sofia and Varna. Dense colonies of apterous viviparous females and larvae were observed. The established host plants are Nephrolepis exaltata, Asplenium nidus and Pteris cretica. Infested ferns exhibit leaf deformation. The aphids were reared in laboratory conditions for four months. A morphometric study of apterae was carried out. Taking into account the presence of host plants of I. nephrelepidis in Bulgaria which are native to the local flora and the reports of the aphid from the Balkan area, it may spread in the country outdoors.

  9. Flight Muscle Dimorphism and Heterogeneity in Flight Initiation of Field-Collected Triatoma infestans (Hemiptera: Reduviidae)

    OpenAIRE

    Gurevitz, Juan M.; Kitron, Uriel; Gürtler, Ricardo E.

    2007-01-01

    Recent experiments demonstrated that most field-collected Triatoma infestans (Klug) (Hemiptera: Reduviidae) adults from northern Argentina either never initiated flight or did so repeatedly in both sexes. This pattern could not be explained by sex, adult age, weight, weight-to-length ratio (W/L), or chance. We examined whether bugs that never initiated flight possessed developed flight muscles, and whether flight muscle mass relative to total body mass (FMR) was related to the probability of ...

  10. A new species in the genus Crisicoccus Ferris (Hemiptera: Coccomorpha: Pseudococcidae), with a key to Chinese species.

    Science.gov (United States)

    Zhang, Jiang-Tao; Wu, San-An

    2016-06-01

    A new mealybug, Crisicoccus ziziphus sp. nov. (Hemiptera: Coccomorpha: Pseudococcidae), collected on the leaves and twigs of Ziziphus jujuba (Rhamnaceae), is described from China. All the female developmental stages (adult, third-instar, second-instar and first-instar nymphs) are described and illustrated. Keys are provided to separate the female instars and to identify adult females of Crisicoccus species from China.

  11. Review of the genus Neotetricodes Zhang et Chen (Hemiptera: Fulgoromorpha: Issidae) with description of two new species.

    Science.gov (United States)

    Chang, Zhi-Min; Yang, Lin; Zhang, Zheng-Guang; Chen, Xiang-Sheng

    2015-12-11

    Two new species of the issid genus Neotetricodes Zhang et Chen (Hemiptera: Fulgoromorpha: Issidae): Neotetricodes longispinus Chang et Chen sp. nov. (China: Yunnan) and Neotetricodes xiphoideus Chang et Chen sp. nov. (China: Yunnan) are described and illustrated. The generic characteristic is redefined. A checklist and key to the species of the genus are provided. The female genitalia of the genus are firstly described.

  12. Rearing and Release of Megamelus scutellaris Berg (Hemiptera: Delphacidae) for Biological Control of Water hyacinth in 2015

    Science.gov (United States)

    2017-06-01

    Hemiptera: Delphacidae) for Biological Control of Waterhyacinth in 2015 by Jan Freedman and Nathan Harms PURPOSE: Waterhyacinth biological control ... control agents. Three insects were released in the United States for biological control of waterhyacinth during the 1970s; two weevils, Neochetina...content) and competitive interactions with other biological control agents (e.g., Neochetina spp.), though their consideration in other biological

  13. Occurrence of the Tamarix Leafhopper, Opsius stactogalus Fieber (Hemiptera: Cicadellidae), in Argentina

    Science.gov (United States)

    Virla, Eduardo G.; Logarzo, Guillermo A.; Paradell, Susana L.

    2010-01-01

    The paleartic tamarix leafhopper, Opsius stactogalus Fieber (Hemiptera: Cicadellidae), can reduce the growth of tamarisk due to the aggregate feeding imposed by their populations. The species was mentioned for Argentina in Metcalf's catalogue (1967) without locality or region reference, and the contributions on Cicadellidae published by many authors after Metcalf omitted this distributional data. Populations of O. stactogalus on Tamarix sp. were found in 12 sites between 28° 48′ to 39° 17′ S and 64° 06′ to 70° 04′ W, located in both the Neotropical and Andean biogeographic regions. PMID:20578887

  14. PRIMER REPORTE DE LA PRESENCIA DE Diaphorina citri (HEMIPTERA: LIVIIDAE EN MANABÍ

    Directory of Open Access Journals (Sweden)

    José Bernardo Navarrete Cedeño

    2016-12-01

    Full Text Available Diaphorina citri (Hemiptera: Liviidae, conocido como el psílido asiático de los cítricos, es considerada una plaga clave de la citricultura mundial, debido a que es vector de la bacteria “Candidatus Liberibacter”, agente causal de la enfermedad “Huanglongbing”, que tiene efectos letales sobre vegetales dentro de la familia Rutaceae. En este documento se reporta la presencia de D. citri infestando Murraya spp., un arbusto de la familia Rutaceae, en la zona urbana del cantón Portoviejo. Este es el primer reporte de la plaga en la provincia de Manabí-Ecuador

  15. Dopluise (Hemiptera: Coccoidea geassosieer met die wipstertmier, Crematogaster peringueyi Emery (Hymenoptera: Formicidae

    Directory of Open Access Journals (Sweden)

    Johannes H. Giliomee

    2015-02-01

    Full Text Available Neste van die wipstertmier, Crematogaster peringueyi (Hymenoptera: Formicidae, is op verskeie plekke langs die kus van die Wes-Kaap versamel. Die doel was om vas te stel watter dopluisagtiges (Hemiptera: Coccoidea in die neste in assosiasie met hierdie miere leef. Dopluise van drie families, naamlik die Pseudococcidae (witluise, Coccidae (sagtedopluise en Kerriidae (lakdopluise is in die neste gevind, almal bekend daarvoor dat hulle heuningdou afskei. Hierdie mutualistiese verhouding tussen die miere en dopluise, bekend as mirmekofilie, is fakultatief van aard. Die wipstertmier blyk ook nie spesifiek te wees wat betref die plant waarop hulle nes maak nie.

  16. Description of a new genus, Galgoria gen. nov. (Hemiptera: Cicadidae: Cicadinae: Leptopsaltriini: Leptopsaltriina).

    Science.gov (United States)

    Lee, Young June

    2016-05-10

    A new cicada genus, Galgoria gen. nov., is described with Tanna herzbergi Schmidt, 1932 (from southern China) as its type species, which is placed in the subtribe Leptopsaltriina Moulton, 1923 of the tribe Leptopsaltriini Moulton, 1923 in the subfamily Cicadinae Latreille, 1802 (Hemiptera: Cicadidae). Tanna herzbergi Schmidt, 1932 is transferred from Tanna Distant, 1905 to Galgoria gen. nov. to become Galgoria herzbergi (Schmidt, 1932) comb. nov. Tanna apicalis Chen, 1940 syn. nov. and Tanna pseudocalis Lei & Chou, 1997 syn. nov. are synonymized here with Galgoria herzbergi (Schmidt, 1932) comb. nov.

  17. Fungal flora of the digestive tract of Triatoma infestans (Hemiptera: Reduviidae from Argentina Flora fúngica de tractos digestivos en Triatoma infestans (Hemiptera: Reduviidae en Argentina

    Directory of Open Access Journals (Sweden)

    G. A. Marti

    Full Text Available A survey of the fungal microbiota of the digestive tract of Triatoma infestans (Klug (Hemiptera: Reduviidae adults was carried out. Insects captured in the field from different provinces in Argentina, as well as individuals reared in artificial colonies, were used for dissection. Axenic cultures of the fungal species were identified and were deposited with mycological collections at La Plata , Argentina. A total of 33 fungal species, with the exception of three that were mycelia sterilia, belonging to 11 genera were identified. Thirty two species belonged to Ascomycota (Eurotiomycetes and Sordariomycetes and one to Zygomycota (Zygomycetes. The genera with the greatest number of species were Penicillium (15, Aspergillus (5, and Cladosporium (2. Among the isolated fungi, some of the species were entomopathogenic or pathogens of humans and other animals.En el presente estudio se realizó un relevamiento de la flora fúngica microbiana en tractos digestivos de adultos de Triatoma infestans (Klug (Hemiptera: Reduviidae. Se disecaron insectos capturados del campo en diferentes provincias Argentinas, así como también se utilizaron individuos de una colonia artificial. Fueron realizados cultivos axénicos de las especies fúngicas aisladas, los que fueron identificados y luego depositados en las colecciones de hongos entomopatógenos del CEPAVE La Plata , Argentina. Fueron identificadas 33 especies fúngicas perteneciente a 11 géneros. Treinta y dos especies pertenecen a Ascomycota (Eurotiomycetes y Sordariomycetes y una a Zygomycota (Zygomycetes. Los géneros con mayor número de especies fueron Penicillium (15, Aspergillus (5, y Cladosporium (2. Entre los aislamientos fúngicos, algunas de las especies encontradas son entomopatogénicas o patógenas de humanos y otros animales.

  18. The identity and distribution of Fiorinia phantasma (Cockerell & Robinson) (Hemiptera: Coccomorpha: Diaspididae), with a new synonym.

    Science.gov (United States)

    Watson, Gillian W; Williams, Douglas J; Miller, Douglass R

    2015-11-25

    The morphologies of Fiorinia phantasma (Cockerell & Robinson) (Hemiptera: Coccomorpha: Diaspididae) and F. coronata Williams & Watson are reviewed, and the name F. coronata is placed as a junior synonym of the name F. phantasma syn. n. The known geographical distribution and host range of F. phantasma is documented and discussed. An identification key to 12 of the 16 species of Fiorinia known from the Australasian, Nearctic and Neotropical Regions is provided.

  19. Scale Insects (Hemiptera: Coccoidea) on Myrciaria dubia (Myrtaceae) in Brazil.

    Science.gov (United States)

    Wolff, V R S; Kondo, T; Peronti, A L B G; Noronha, A C S

    2016-06-01

    Commercial cultivation of the fruit tree Myrciaria dubia (Myrtaceae) is being developed in Brazil but phytophagous insects, including scale insects (Hemiptera: Coccoidea), can become pests in plantations. The coccids Ceroplastes jamaicensis White, Coccus viridis (Green), Parasaissetia nigra (Nietner), Pseudokermes vitreus (Cockerell) (Coccidae), and the diaspidid Pseudaonidia trilobitiformis (Green) were collected on M. dubia in the municipality of Belém and Tomé-Açu, state of Pará (PA), metropolitan and Northeast Pará mesoregions, Brazil. A key to species of Coccoidea recorded on M. dubia, based on adult females, is provided. Photographs for all scale insects reported on M. dubia are provided. Ceroplastes jamaicensis is recorded for the first time for Brazil and is herein reported for the first time associated with this host.

  20. New corological and biological data of the Red Gum Lerp Psyllid, Glycaspis brimblecombei Moore, 1964 in Italy (Hemiptera, Psyllidae

    Directory of Open Access Journals (Sweden)

    Ricardo Jiménez-Peydró

    2011-03-01

    Full Text Available Glycaspis brimblecombei Moore, 1964 is a psyllid (Hemiptera: Psyllidae pest of Eucalyptus, native toAustralia and first recorded in Europe: Spain in 2008 and more recently (2010 in Italy. The present paper dealswith recent research, carried out in central Italy, with new data on the distribution and biology of this species.

  1. Characterization of a recombinant Cathepsin B-Like cysteine peptidase from Diaphorina citri Kuwayama (Hemiptera: Liviidae): A putative target control of citrus huanglongbing

    Science.gov (United States)

    Huanglongbing (HLB) is one of the most destructive disease affecting citrus plants. The causal agent is associated with the phloem-limited bacterium Candidatus Liberibacter asiaticus (CLas) spread by the Asian citrus psyllid, Diaphorina citri (Hemiptera: Liviidae). Among the control strategies for H...

  2. Occurrence of lace bug Vatiga illudens and Vatiga manihotae (Hemiptera: Tingidae) in Mato Grosso do Sul, midwestern Brazil.

    Science.gov (United States)

    Bellon, Patrícia P; Wengrat, Ana P G S; Kassab, Samir O; Pietrowski, Vanda; Loureiro, Elisângela S

    2012-09-01

    Nymphs and adults of the lace bug (Hemiptera: Tingidae) have been found in cassava crops (Manihot esculenta) in Mato Grosso do Sul State, Brazil. The insects were collected in the field and taken to the laboratory where they were identified based on some morphological traits of the species Vatiga manihotae (Drake) and V. illudens (Drake), which are first reported in the aforementioned state.

  3. Rodolia cardinalis (Mulsant) (Coleoptera: Coccinellidae), a new predator of Crypticerya multicicatrices Kondo and Unruh (Hemiptera: Monophlebidae)

    OpenAIRE

    Pinchao, Ever Camilo; Kondo, Takumasa; González F., Guillermo

    2016-01-01

    The Colombian fluted scale (CFS), Crypticerya multicicatrices Kondo & Unruh (Hemiptera: Monophlebidae) is a polyphagous scale insect which affects about 100 species of plants. Between 2010–2013, the species was reported as an invasive pest on the islands of San Andres and Old Providence, Colombian territory in the Caribbean sea. Currently, populations of the CFS also have increased in the city of Cali, Valle del Cauca State, mainland Colombia, affecting different host plants, especially l...

  4. Alterações anatômicas em algodoeiro infectado pelo vírus da doença azul Anatomical alterations in blue disease infected cotton plant

    Directory of Open Access Journals (Sweden)

    Juliana K. Takimoto

    2009-01-01

    Full Text Available A doença azul do algodoeiro está associada a um vírus ainda pouco conhecido em suas características morfológicas e moleculares, tanto quanto a sua patologia e epidemiologia. O tipo de transmissão circulativa pelo afídeo vetor Aphis gossypii Glover, associado a recentes relatos de estudos moleculares, sustentam ser o agente etiológico uma espécie membro da família Luteoviridae. No presente trabalho, estudos anatômicos comparativos em plantas sadias e infectadas foram realizados com a finalidade de conhecer aspectos estruturais da interação vírus-espécie hospedeira, com potencial aplicação na área de diagnose e melhoramento genético. Os estudos anatômicos foram realizados em folhas de plantas infectadas, com área foliar reduzida, nervuras cloróticas e margem foliar voltada para baixo. O encurtamento dos entrenós, que resultam em um agrupamento de folhas, flores e frutos, e conseqüente redução da altura da planta, do número e tamanho dos frutos, são expressões fenotípicas da planta de algodão infectada, a qual serviu para o presente estudo. Nas plantas infectadas com o agente da doença azul havia maior acúmulo de calose e de cristais de oxalato de cálcio, cloroplastos íntegros distribuídos na região periférica das células do mesofilo e aparente alteração química no interior das células do parênquima paliçádico. Inclusões nos vasos do floema e, ocasionalmente no xilema, também foram observadas. O acúmulo de calose e a presença de inclusões no floema podem indicar uma relação ou preferência do vírus por esse tecido.Cotton blue disease is caused by a virus whose morphological and molecular characteristics is not well known and so demanding information its phytosanitary and epidemiological characteristics. Evidences of an aphid borne (Aphis gossypii Glover circulative (persistent type of transmission, associated with a recent molecular report, sustain for a virus species belonging to the

  5. PCR-based gut content analysis to detect predation of Eriococcus ironsidei (Hemiptera: Eriococcidae) by Coccinellidae species in macadamia nut orchards in Hawaii

    Science.gov (United States)

    Macadamia felted coccid, Eriococcus ironsidei (Williams) (Hemiptera: Eriococcidae) was first found infesting macadamia trees in the island of Hawaii in 2005. Macadamia felted coccid infests all above-ground parts of trees to feed and reproduce. Their feeding activity distorts and stunts new growth w...

  6. A new species of Dysmicoccus damaging lavender in French Provence (Hemiptera, Sternorrhyncha, Pseudococcidae).

    Science.gov (United States)

    Germain, J-F; Matile-Ferrero, D; Kaydan, M B; Malausa, T; Williams, D J

    2015-07-01

    Une nouvelle espèce de Dysmicoccus nuisible à la lavande en Provence (France) (Hemiptera, Sternorrhyncha, Pseudococcidae). Dysmicoccus lavandulae Germain, Matile-Ferrero & Williams n. sp. est décrite et illustrée. Ses séquences ADN sont présentées. L'espèce vit sur Lavandula x intermedia cultivée pour la production d'essence de lavande en Provence. La liste des espèces de pseudococcines vivant sur les lavandes spontanées en France est dressée. Le statut des 2 genres voisins Trionymus Berg et Dysmicoccus Ferris est discuté.

  7. ORF Alignment: NC_005788 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available uery: 286 ESYQTKRQRLMKQLKENYAGHTAFCVTALDEICWFLNIRGSDVEYNPVFYAYFVIHQDSS 345 ... ESYQTKRQRLMKQLKENYAGHT...AFCVTALDEICWFLNIRGSDVEYNPVFYAYFVIHQDSS Sbjct: 1 ... ESYQTKRQRLMKQLKENYAGHTAFCVTALDE...gossypii ATCC 10895] ref|NP_986634.1| AGL032Cp ... [Eremothecium gossypii] ... Length = 385 ... Q

  8. ORF Alignment: NC_005788 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available gossypii ATCC 10895] ref|NP_986570.1| AGL097Cp ... [Eremothecium gossypii] ... Length = 198 ... Query: 449 NPRKFESWL...HTATLANIATVFKDSDSKEWRAHGDPTEIAIQVFATRMDHPHHALTTXXXX 508 ... NPRKFESWLHTATLANIATVF...KDSDSKEWRAHGDPTEIAIQVFATRMDHPHHALTT ... Sbjct: 1 ... NPRKFESWLHTATLANIATVFKDSDSKEWR

  9. ORF Alignment: NC_005788 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available gossypii ATCC 10895] ref|NP_986381.1| AGL286Cp ... [Eremothecium gossypii] ... Length = 122 ... Query: 201 ALNGFENTDPHTST...AFALGPEGPTQRNLDTHGXXXXXXXXXXXXXXXXXXXXLGLYSDMG 260 ... ALNGFENTDPHTSTAFALGPE...GPTQRNLDTHG ... LGLYSDMG Sbjct: 1 ... ALNGFENTDPHTSTAFALGPEGPTQRNLDT

  10. Primer registro de Triatoma infestans (Klug (Hemiptera: Reduviidae asociado a nidos de loros barranqueros (Cyanoliseus patagonus (Aves: Psittacidae

    Directory of Open Access Journals (Sweden)

    María L. HERNÁNDEZ

    2015-01-01

    Full Text Available Triatoma infestans es el vector más importante de la enfermedad de Chagas de la Argentina. Se cita por primera vez la presencia de T. infestans (Klug (Hemiptera: Reduviidae asociado a nidos de loro barranquero Cyanoliseus patagonus (Psittasiformes: Psittacidae construidos en viviendas de adobe abandonadas. Se discuten las posibles implicancias de este hallazgo para la vigilancia entomológica del vector.

  11. Population growth and within-plant distribution of the striped mealybug Ferrisia virgata (Cockerell (Hemiptera, Pseudococcidae on cotton

    Directory of Open Access Journals (Sweden)

    Martin D. Oliveira

    2014-03-01

    Full Text Available Population growth and within-plant distribution of the striped mealybug Ferrisia virgata (Cockerell (Hemiptera, Pseudococcidae on cotton. The striped mealybug, Ferrisia virgata (Cockerell (Hemiptera, Pseudococcidae, is a widely distributed and polyphagous pest species, which naturally occurs on cotton plants in Brazil. This study evaluated the establishment and population growth as well as the within-plant distribution of F. virgata on four cotton cultivars: CNPA 7H (white fibers, BRS Verde, BRS Safira, and BRS Rubi (colored fibers. The experiment was conducted in a complete randomized design with four treatments (cultivars and 18 replications of each. Thus, cotton plants of each cultivar were infested with 100 newly hatched nymphs of F. virgata. The number of adult female mealybugs and the total number of mealybugs per plant were quantified, respectively, at 25 and 50 days after infestation. The developmental and pre-reproductive periods were also determined. Furthermore, we verified the distribution of F. virgata on the plant parts at 25 and 50 days after infestation. Ferrisia virgata showed similar growth of 412-fold in the four cotton cultivars studied. Also, the nymphs were spread on infested leaves; the secondgeneration nymphs were spread and established in all plant parts. Our results characterize F. virgata as having much potential as an important cotton pest in Brazil.

  12. Description of the immature stages of the planthopper Lacertinella australis (Hemiptera: Delphacidae)

    Science.gov (United States)

    Batiz, M. F. Rossi; Marino de Remes Lenicov, A. M.; Hagedorn, Henry

    2014-01-01

    Abstract The five immature stages of the planthopper Lacertinella australis (Remes Lenicov and Rossi Batiz) (Hemiptera: Delphacidae: Saccharosydnini) are described and illustrated. The main characters that allowed us to distinguish the various stages were body size, number of tarsomeres and metatibial spines, and number of teeth on the spur. New biological data based on laboratory rearing and field observations showed that L. australis can carry out its biological cycle successfully on the graminaceous pampas grass ( Cortaderia spp. Stapf (Poales: Poaceae)). In addition, the efficient rearing in captivity, the high survivorship registered, and overwintering only on this host plant suggests that L. australis is a potential biocontrol agent of this invasive graminaceous weed. This study provides information about the immature stages , including a key for their identification, based on laboratory reared specimens and field observations. Resumen Se describen e ilustran las cinco etapas inmaduras de la especie de Saccharisydnini Lacertinella australis (Remes Lenicov and Rossi Batiz) (Hemiptera: Delphacidae). Los principales caracteres que permitieron distinguir las diferentes etapas fueron: tamaño corporal, número de espinas en los tarsómeros y metatibia y número de dientes en el espolón tibial. Nuevos datos biológicos, basados en la cría de laboratorio y observaciones de campo, mostraron que L. australis puede realizar su ciclo biológico exitosamente en la graminácea cortadera ( Cortaderia spp. Stapf (Poales: Poaceae)). Además, la eficiente crianza en cautive-rio y la alta supervivencia registrada en esta planta hospedera, sugieren que L. australis podría ser usada como un potencial agente de control biológico de esta maleza invasora. Este estudio proporciona informa-ción sobre las etapas inmaduras, incluyendo una clave para su identificación, basada en individuos provenientes de la cría de laboratorio y de campo. PMID:25199992

  13. A severity rating system for evaluating stand-level balsam woolly adelgid (Hemiptera: Adelgidae) damage in two Abies species in western North America

    Science.gov (United States)

    Kathryn H. Hrinkevich; Robert A. Progar; David C. Shaw

    2016-01-01

    Severity rating systems are fundamental to understanding the impacts of disturbance agents in forest stands. The balsam woolly adelgid (BWA), Adelges piceae (Ratzeburg) (Hemiptera: Adelgidae), is an invasive forest pest in North America that infests and causes mortality in true fir, Abies spp. There is currently no single...

  14. Four new species of the genus Mongoliana Distant (Hemiptera: Fulgoromorpha: Issidae) from southern China.

    Science.gov (United States)

    Meng, Rui; Wang, Yinglun; Qin, Daozheng

    2016-01-05

    Four new species in the planthopper genus Mongoliana Distant from southern China (Hemiptera: Fulgoromorpha: Issidae) are reported. Three of them, M. bistriata sp. nov., M. latistriata sp. nov. and M. albimaculata sp. nov., are described and illustrated; the fourth new one, M. arcuata sp. nov., is briefly described for M. triangularis Chen, Zhang & Chang which was a misidentification of M. triangularis Che, Wang & Chou. M. recurrens (Butler, 1875) is re-described and remarks for its current status is given. A key to all known species of Mongoliana is provided. The distribution and morphological peculiarities of the genus are briefly discussed.

  15. Studies on idiocerine leafhoppers with descriptions of Chinaocerus gen. nov. and three new species from China (Hemiptera: Cicadomorpha: Cicadellidae).

    Science.gov (United States)

    Dang, Li-Hong; Zhang, Bin; Li, Zi-Zhong

    2016-03-08

    A new leafhopper genus of the tribe Idiocerini (Hemiptera: Cicadomorpha: Cicadellidae), Chinaocerus, is described from the southwest China together with three new species, C. kangdingensis Zhang & Li sp. nov. (Sichuan Province), C. bispinatus Zhang & Li sp. nov. (Yunnan Province) and C. shii Zhang & Li sp. nov. (Sichuan Province). Descriptions and illustrations of these three new species are provided, and a key for their separation is also given.

  16. Do Scaphoideus titanus (Hemiptera: Cicadellidae) nymphs use vibrational communication?

    Science.gov (United States)

    Chuche, Julien; Thiéry, Denis; Mazzoni, Valerio

    2011-07-01

    Small Auchenorrhyncha use substrate-borne vibrations to communicate. Although this behaviour is well known in adult leafhoppers, so far no studies have been published on nymphs. Here we checked the occurrence of vibrational communication in Scaphoideus titanus (Hemiptera: Cicadellidae) nymphs as a possible explanation of their aggregative distributions on host plants. We studied possible vibratory emissions of isolated and grouped nymphs, as well as their behavioural responses to vibration stimuli that simulated presence of conspecifics, to disturbance noise, white noise and predator spiders. None of our synthetic stimuli or pre-recorded substrate vibrations from nymphs elicited specific vibration responses and only those due to grooming or mechanical contacts of the insect with the leaf were recorded. Thus, S. titanus nymphs showed to not use species-specific vibrations neither for intra- nor interspecific communication and also did not produce alarm vibrations when facing potential predators. We conclude that their aggregative behaviour is independent from a vibrational communication.

  17. Inheritance of sterility in Dysdercus koenigii F. (Hemiptera: Pyrrhocoridae)

    International Nuclear Information System (INIS)

    Harwalkar, M.R.; Rahalkar, G.W.

    1979-01-01

    It has been suggested that for the control of Lepidopterous populations, release of fully competitive partially sterile males would be more advantageous than the release of completely sterile males. This suggestion is based on the fact, elucidated in many studies, that partially sterilized males mated to normal females produce totally sterile or partially sterile progeny. In Hemiptera too, F 1 progeny of partially sterile males has been shown to inherit sterility. Individual impact of sterility inherited by either sex of the F 1 progeny on population growth has been studied in an hemipteran insect Dysdercus koenigii. A dose of 7 krad induces near-complete sterility in males. When males irradiated with substerilizing doses of 1,2 and 3 krad were crossed with normal females, F 1 progeny of both sexes was partially sterile : the female being more sterile than the males. When the F 1 progeny was intercrossed, there was enhanced reduction in progeny production. (auth.)

  18. A new species of Klabonosa Bouček (Hymenoptera: Pteromalidae) reared from eggs of Endochus sp. (Hemiptera: Reduviidae) from India.

    Science.gov (United States)

    Gupta, Ankita; Yeshwanth, H M; Sureshan, P M

    2018-04-23

    The genus Klabonosa Bouček (Hymenoptera: Pteromalidae) is recorded for the first time from the Oriental region, with both sexes of K. indica Gupta, Sureshan Yeshwanth sp. n. reared from eggs of the assassin bug Endochus sp. (Hemiptera: Reduviidae) on Artocarpus heterophyllus Lam. (Moraceae). The male is formally described and illustrated for the first time for the genus.

  19. Use of the entomopathogenic fungi Metarhizium anisopliae, Cordyceps bassiana and Isaria fumosorosea to control Diaphorina citri (Hemiptera: Psylidae) in Persian lime under field conditions

    Science.gov (United States)

    The Asian citrus psyllid, Diaphorina citri Kuwayama (Hemiptera: Psyllidae), is a destructive insect pest in the citriculture, because it is an efficient vector of the proteobacteria, ‘Candidatus Liberibacter asiaticus’ (Las), ‘Ca. L. Africanus’ (Laf), and ‘Ca. L. Americanus’ (Lam). These bacteria c...

  20. A new species in the indigenous New Zealand soft scale insect genus Kalasiris Henderson & Hodgson (Hemiptera: Sternorrhyncha: Coccomorpha: Coccidae) on Gahnia setifolia (Cyperaceae).

    Science.gov (United States)

    Hodgson, Chris J; Gunawardana, D N; Richmond, J E

    2016-03-14

    The genus Kalasiris Henderson & Hodgson (Hemiptera: Sternorrhyncha: Coccomorpha: Coccidae) is currently only known from New Zealand. The adult female and pupa of a new species, K. martini Hodgson & Richmond are described and illustrated below and the possible taxonomic relationships of the genus to other New Zealand genera are discussed.

  1. Potential use of the fungus Beauveria bassiana against the western flower thrips Frankliniella occidentalis without reducing the effectiveness of its natural predator Orius sauteri (Hemiptera: Anthocoridae)

    Science.gov (United States)

    Orius sauteri (Poppius) (Hemiptera: Anthocoridae) is an important predator of western flower thrips, Frankliniella occidentalis (Pergande) (Thysanoptera: Thripidae). Orius sauteri would be directly exposed to the entomopathogenic fungus Beauveria bassiana (Bals.) Vuillemin in the field should the fu...

  2. Assessment of Feeding Acceptance and Injury of Kerman Pistachios, Pistacia vera, by Brown Marmorated Stink Bug (Hemiptera: Pentatomidae)

    OpenAIRE

    Lara, Jesús R; Kamiyama, Matthew T; Hernandez, Gabriel; Nay, Justin; Hoddle, Mark S

    2017-01-01

    Abstract In the United States, California (CA) is the primary commercial producer of pistachio nuts, Pistacia vera L. (Anacardiaceae). The brown marmorated stink bug (BMSB), Halyomorpha halys (Stål) (Hemiptera: Pentatomidae), an invasive and polyphagous insect pest from Asia, has established in urban areas in several pistachio-growing counties in CA. Breeding BMSB populations have not been detected in commercial pistachio acreage. However, the detection of BMSB in Kern and Fresno counties, ma...

  3. Incidence of pests and viral disease on pepino (Solanum muricatum Ait.) in Kanagawa Prefecture, Japan.

    Science.gov (United States)

    Kim, Ok-Kyung; Ishikawa, Tadashi; Yamada, Yoshihiro; Sato, Takuma; Shinohara, Hirosuke; Takahata, Ken

    2017-01-01

    The solanaceous fruit crop pepino ( Solanum muricatum Ait.), originating in the Andes, is grown commercially in South American countries and New Zealand. In these areas, pests and diseases of pepino have been identified well; however, to date, these have seldom been investigated in detail in Japan. Herein, we attempt to reconstruct an agricultural production system for commercial pepino crops in Japan, and evaluate the incidence of pests and viral diseases on pepino. The findings of this study will facilitate in developing a better crop system for the commercial cultivation of healthy pepino fruits. A total of 11 species, comprising nine insects and two mites, were recognized as pests of pepino plants in our experimental fields in Kanagawa Prefecture, central Honshu, Japan. Of these pest species, the two-spotted spider mite Tetranychus urticae Koch, 1836 and the cotton aphid Aphis gossypii Glover, 1877, were remarkably abundant than the other pest species. Eventually, 13 species, including two previously recorded, are currently recognized as the pests of pepino in Japan. With regard to viruses, we tested two species Alfalfa mosaic virus (AMV) and Cucumber mosaic virus (CMV), as well as three genera Carlavirus , Potexvirus , and Potyvirus . No virus was detected in symptomatic pepino leaves collected in our experimental fields. This is a first report on the identification of pests on pepino plants in Kanagawa Prefecture, Japan and elucidates the relationship between currently occurring pests of pepino plants and potential viral pathogens that they can transmit.

  4. Spatial Distribution and Sampling Plans With Fixed Level of Precision for Citrus Aphids (Hom., Aphididae) on Two Orange Species.

    Science.gov (United States)

    Kafeshani, Farzaneh Alizadeh; Rajabpour, Ali; Aghajanzadeh, Sirous; Gholamian, Esmaeil; Farkhari, Mohammad

    2018-04-02

    Aphis spiraecola Patch, Aphis gossypii Glover, and Toxoptera aurantii Boyer de Fonscolombe are three important aphid pests of citrus orchards. In this study, spatial distributions of the aphids on two orange species, Satsuma mandarin and Thomson navel, were evaluated using Taylor's power law and Iwao's patchiness. In addition, a fixed-precision sequential sampling plant was developed for each species on the host plant by Green's model at precision levels of 0.25 and 0.1. The results revealed that spatial distribution parameters and therefore the sampling plan were significantly different according to aphid and host plant species. Taylor's power law provides a better fit for the data than Iwao's patchiness regression. Except T. aurantii on Thomson navel orange, spatial distribution patterns of the aphids were aggregative on both citrus. T. aurantii had regular dispersion pattern on Thomson navel orange. Optimum sample size of the aphids varied from 30-2061 and 1-1622 shoots on Satsuma mandarin and Thomson navel orange based on aphid species and desired precision level. Calculated stop lines of the aphid species on Satsuma mandarin and Thomson navel orange ranged from 0.48 to 19 and 0.19 to 80.4 aphids per 24 shoots according to aphid species and desired precision level. The performance of the sampling plan was validated by resampling analysis using resampling for validation of sampling plans (RVSP) software. This sampling program is useful for IPM program of the aphids in citrus orchards.

  5. Dicty_cDB: Contig-U15920-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available t... 44 10.0 1 ( EU019869 ) Aphis gossypii from Hibiscus elongation factor 1 ... ...44 10.0 1 ( EU019868 ) Aphis gossypii from Hibiscus mutabilis elongation... 44 10.0 1 ( EF660855 ) Myzus per

  6. Algal growth and species composition under experimental control of herbivory, phosphorus and coral abundance in Glovers Reef, Belize.

    Science.gov (United States)

    McClanahan, T R; Cokos, B A; Sala, E

    2002-06-01

    The proliferation of algae on disturbed coral reefs has often been attributed to (1) a loss of large-bodied herbivorous fishes, (2) increases in sea water nutrient concentrations, particularly phosphorus, and (3) a loss of hard coral cover or a combination of these and other factors. We performed replicated small-scale caging experiments in the offshore lagoon of Glovers Reef atoll, Belize where three treatments had closed-top (no large-bodied herbivores) and one treatment had open-top cages (grazing by large-bodied herbivores). Closed-top treatments simulated a reduced-herbivory situation, excluding large fishes but including small herbivorous fishes such as damselfishes and small parrotfishes. Treatments in the closed-top cages included the addition of high phosphorus fertilizer, live branches of Acropora cervicornis and a third unmanipulated control treatment. Colonization, algal biomass and species composition on dead A. palmata "plates" were studied weekly for 50 days in each of the four treatments. Fertilization doubled the concentration of phosphorus from 0.35 to 0.77 microM. Closed-top cages, particularly the fertilizer and A. cervicornis additions, attracted more small-bodied parrotfish and damselfish than the open-top cages such that there was moderate levels of herbivory in closed-top cages. The open-top cages did, however, have a higher abundance of the chemically and morphologically defended erect algal species including Caulerpa cupressoides, Laurencia obtusa, Dictyota menstrualis and Lobophora variegata. The most herbivore-resistant calcareous green algae (i.e. Halimeda) were, however, uncommon in all treatments. Algal biomass increased and fluctuated simultaneously in all treatments over time, but algal biomass, as measured by wet, dry and decalcified weight, did not differ greatly between the treatments with only marginally higher biomass (p reefs except for creating space. In contrast, A. cervicornis appears to attract aggressive damselfish that

  7. Mealybugs (Hemiptera: Coccomorpha: Pseudococcidae) attacking Hibiscus rosa-sinensis L. in Malaysia, with two new country records

    Science.gov (United States)

    Sartiami, Dewi; Watson, Gillian W.; Mohamad Roff, M. N.; Idris, A. B.

    2016-11-01

    A survey of mealybugs (Hemiptera: Coccomorpha: Pseudococcidae) attacking the national flower of Malaysia, Hibiscus rosa-sisnensis L. and Hibiscus spp. (Malvaceae) was conducted in Selangor and Kuala Lumpur, Malaysia, from January to March 2016. Adult females were mounted on microscope slides in Canada balsam. The five species identified were Ferrisia dasylirii (Cockerell), Maconellicoccus hirsutus (Green), Paracoccus marginatus Williams and Granara de Willink, Phenacoccus solenopsis (Tinsley) and Pseudococcus jackbeardsleyi Gimpel & Miller. Two of these, the invasive species Ferrisia dasylirii and P. solenopsis were introduced and first recorded in Malaysia.

  8. Influence of Different Diets on Two-sex Life Table Parameters of Oenopia conglobata contaminata (Menteries

    Directory of Open Access Journals (Sweden)

    H. Zohdi

    2017-08-01

    Full Text Available Introduction: The common pistachio psylla (CPP, Agonoscena pistaciae Burckhardt and Lauterer, 1989 (Hem.: Psylloidea: Rhinocolinae is an important pest of pistachio trees. The presence of a large population of psyllid causes severe problems such as falling buds and leaves and therefore this pest causes heavy economic damage to farmers. Predators are the largest and the most diverse natural enemies of the CPP. They are offered as biological control agents against pistachio pests, especially CPP, although they are mostly general predators. Oenopia conglobata contaminata (Menteries is one of the common psylla predators of pistachio orchard that have a significant role in biological control of Agonoscena pistaciae population. Despite the importance of this efficient predator, the limited study has been done on the effect of different hosts on the biological parameters of this lady beetle. In this study, the demographic parameters of this lady beetle by feeding on 4 different prey species, A. pistaciae , Aphis fabae Scopoli (Hem.:Aphididae, Aphis gossypii Glover (Hem.:Aphididae and eggs of Ephestia kuehniella (Zell.(Lep.:Pyralidae were studied in the laboratory conditions (25 ± 2°C, relative humidity of %65 ±5 and photoperiod of 16 hours light and 8 hours of darkness. Materials and Methods: Nymphs of CPP (A.pistaciae and adults of O. conglobata contaminata beetles were collected on the pistachio leaves from a pistachio orchard. Aphids (A. fabae and A. gossypii were reared on the bean and the cotton plants planted in a greenhouse. Eggs of E. kuehniella were prepared from insectarium of Kerman Plant protection management and rearing of E. kuehniella was done in the laboratory conditions in Kerman Agricultural and Natural Resoarce Research Center. Before starting the experiment, one generation of O. conglobata contaminata was reared in the laboratory on the different host separately. One hundred eggs of O. conglobata contaminata were used to

  9. Mealybugs (Hemiptera: Coccomorpha: Pseudococcidae) with oral rim ducts; description of a new genus and species from Turkey, and discussion of their higher classification within the Pseudococcidae.

    Science.gov (United States)

    Kaydan, Mehmet Bora; Szita, Éva

    2017-02-03

    A new monotypic mealybug genus with oral rim ducts, Bromusicoccus Kaydan gen. n. (Hemiptera: Pseudococcidae: Pseudococcinae), is described from Turkey. The higher classification of mealybug genera with oral rim tubular ducts worldwide is discussed and a key is provided to separate them.

  10. Stylet biogenesis in Bactericera cockerelli (Hemiptera: Triozidae).

    Science.gov (United States)

    Cicero, Joseph M

    2017-07-01

    The discovery of 'Ca. Liberibacter solanacearum', causal agent of certain solanaceous and apiaceous crop diseases, inside the functional (intrastadial) and pharate stylet anatomy of the potato psyllid prompted elucidation of the mechanism of stylet replacement as a novel exit portal in the transmission pathway. In Hemiptera, presumptive (formative) stylets, secreted during consecutive pharate instars, replace functional stylets lost with the exuviae. In potato psyllids, each functional stylet has a hollow core filled with a cytology that extends out of the core to form a hemispherical aggregate of cells, the 'end-cap', somewhat resembling a golf ball on a tee. A tightly folded mass of extremely thin cells, the 'matrix', occurs inside the end-cap. Micrograph interpretations indicate that during the pharate stage, the end-cap apolyses from the core and 'deconstructs' to release and expand the matrix into a long, coiled tube, the 'atrium'. Cells that were in contact with the inner walls of the functional stylet core maintain their position at the apex of the tube, and secrete a new stylet, apex first, the growing length of which descends into the tube until completed. They then despool from the coils into their functional position as the exuviae is shed. Copyright © 2016 Elsevier Ltd. All rights reserved.

  11. Responses of Neomegalotomus parvus (Hemiptera: Alydidae to color and male-lured traps

    Directory of Open Access Journals (Sweden)

    Maurício Ursi Ventura

    2004-08-01

    Full Text Available In 1998, the relative responses of Neomegalotomus parvus (Westwood (Hemiptera: Alydidae to colors in traps were assessed in the field. Colors were printed in white alkaline paper and covered with transparent plastic. Printed colors were black, green, yellow, red and blue. Treatments also included white paper and aluminum foil. Green traps captured more bugs than the other traps (except yellow. Yellow traps caught significantly more N. parvus males than blue, black and aluminum traps. White, red and blue traps captured significantly more N. parvus males than black traps. In 1999, the same treatments were used and additionally included the factor presence (X absence of males in cages in the traps. Four males were confined in the cages together with pigeon pea seeds and water. Control traps received only pigeon pea seeds and water. No responses were found for color comparisons. Male-lured traps captured significantly more males than control traps.Em 1998, as respostas relativas de Neomegalotomus parvus (Westwood (Hemiptera: Alydidae a cores em armadilhas foram avaliadas no campo. As cores foram impressas (preto, verde, amarelo, vermelho e azul, em papel alcalino branco e coberto com plástico transparente. Também se incluiu papel branco e folha de alumínio, como tratamentos. Armadilhas verdes capturaram mais insetos que outras armadilhas (exceto amarelo. Armadilhas amarelas capturaram significativamente mais machos de N. parvus do que armadilhas azuis, pretas e alumínio. Armadilhas brancas, vermelhas e azuis capturaram significativamente mais machos de N. parvus do que armadilhas pretas. Em 1999, os mesmos tratamentos foram usados e também se incluiu fator presença (X ausência de machos em gaiolas nas armadilhas. Quatro machos foram confinados nas gaiolas junto com sementes de guandu e água. Testemunhas receberam somente sementes de guandu e água. Não foram obtidas respostas significativas à cores. Armadilhas com machos capturaram

  12. Biology of Maconellicoccus hirsutus (Hemiptera: Pseudococcidae on Hibiscus rosa-sinensis = Biologia de Maconellicoccus hirsutus (Hemiptera: Pseudococcidae em Hibiscus rosa-sinensis

    Directory of Open Access Journals (Sweden)

    Marcelo Negrini

    2017-10-01

    Full Text Available Maconellicoccus hirsutus Green, 1908 (Hemiptera: Pseudococcidae is an introduced pest that threatens fruit and ornamental plant production in Brazil. Reported in Brazil for the first time in 2010, in the state of Roraima, M. hirsutus, has spread rapidly to other regions of the country. The objective of this study was to investigate the biology of M. hirsutus on Hibiscus rosa-sinensis L. (Malvaceae leaves in laboratory conditions with climatic parameters similar to those of the Brazilian North and Northeast (27 ± 1 °C, 60 ± 10% relative humidity and 12 hours light and 12 hours dark. Eighty M. hirsutus nymphs were individualized on rooted H. rosa-sinensis leaves and their survival, mortality, sex ratio, and egg numbers per female emerged were recorded. Maconellicoccus hirsutus can have up to nine generations per year, taking 6.5 days to double its population size. The female numbers of this pest are about three times higher than those for its male counterparts, with 98 eggs per female and 97% viability. The survival curve of the species is type I, that is, mortality rates are higher in adulthood. Maconellicoccus hirsutus, especially, a pest of fruit trees and ornamental plants, presents great potential for population growth in Brazilian tropical conditions. = Maconellicoccus hirsutus Green, 1908 (Hemiptera: Pseudococcidae é uma praga introduzida que ameaça a produção de frutas e plantas ornamentais no Brasil. Registrada no Brasil pela primeira vez em 2010, no estado de Roraima, M. hirsutus se espalhou rapidamente para outras regiões do país. O objetivo deste estudo foi investigar a biologia de M. hirsutus em folhas de Hibiscus rosa-sinensis L. (Malvaceae, em condições de laboratório com parâmetros climáticos semelhantes aos das regiões Norte e Nordeste do Brasil (27 ± 1 °C, 60 ± 10 % de umidade relativa e 12 h de luz e 12 h de escuro. Oitenta ninfas de M. hirsutus foram individualizadas em folhas enraizadas de H. rosa-sinensis e

  13. Hosting Capacity of Horticultural Plants for Insect Pests in Brazil Capacidad de Alojamiento de Plantas Hortícolas para Plagas de Insectos en Brasil

    Directory of Open Access Journals (Sweden)

    Germano L.D Leite

    2011-09-01

    Full Text Available Factors such as fertilization, allelochemicals, trichomes, weather, and natural enemies can influence pest populations. Thus, it is necessary to understand the factors that predispose vegetable species to pests and the role of polyculture, crop rotation, and neighboring plants. The objective of this research was to study the hosting capacity for pests of Abelmoschus esculentus (L., Brassica oleracea L. vars. acephala and capitata, Capsicum annuum L., Cucurbita moschata (Duchesne, Cucurbita maxima Duchesne and Cucumis sativus L., Lycopersicon esculentum Mill., Solanum gilo Raddi and Solanum melongena L., and Phaseolus vulgaris L. The higher density of Bemisia tabaci (Genn. adults on C. sativus can be due to the higher amount of pentacosane and octacosane in this plant. The occurrence of Brevicoryne brassicae (L. only in Brassica spp. can be accounted for by the nonacosane of these plants. The low trichome density and greater palmitic acid level can explain the greatest damage by Aphis gossypii Glover in A. esculentum. Empoasca sp. was more frequent in P. vulgaris followed by A. esculentum, which are plants with lower K content. Solanum melongena was attacked more by Hydrangea similis (Walker and Epitrix sp. perhaps because of higher palmitic acid and 11,14,17-eicosatrienoic methyl ester concentrations in their leaves. Frankliniella sp. exhibited more damage in C. sativus probably owing to higher pentacosane and octacosane in its leaves. Sistena sp. was more frequent in C. maxima and had higher octadecane levels and trichome density. The presence of ¥-humulene and hexacosane can explain the damage by Tuta absoluta (Meyrick on L. esculentum.Factores tales como la fertilización, aleloquímicos, tricomas, el clima y los enemigos naturales pueden influir en las poblaciones de plagas. Por lo tanto, es necesario comprender los factores que predisponen a las especies vegetales a las plagas y el papel de policultivos, rotación de cultivos y las plantas

  14. Description of a new species of Hemiberlesia Cockerell (Hemiptera: Coccomorpha: Diaspididae) from China, with a key to Hemiberlesia species known from China.

    Science.gov (United States)

    Liu, Di; Feng, Jinian

    2018-03-06

    The diagnostic characters of the genus Hemiberlesia Cockerell (Hemiptera: Coccoidea: Diaspididae) are reviewed. The adult female, adult male and all immature stages (except the male prepupa and pupa) of a new species, H. serrulata Liu Feng sp. n., collected from Henan Province, China, are described and illustrated. A key is provided to identify the Hemiberlesia species known to occur in China.

  15. Does the aggressiveness of the prey modify the attack behavior of the predator Supputius cincticeps (Stål (Hemiptera, Pentatomidae? A agressividade da presa altera o comportamento de ataque do predador Supputius cincticeps (Stål (Hemiptera, Pentatomidae?

    Directory of Open Access Journals (Sweden)

    Rafael Braga da Silva

    2012-06-01

    Full Text Available Does the aggressiveness of the prey modify the attack behavior of the predator Supputius cincticeps (Stål (Hemiptera, Pentatomidae? The stink bug Supputius cincticeps (Stål (Hemiptera, Pentatomidae is a predator found in several Brazilian regions, which possesses desirable attributes as a natural control agent and in biological control programs. The aim of this study was to test if the attack behavior and predation success of S. cincticeps were affected by prey species. Larvae of Tenebrio molitor (L. (Coleoptera, Tenebrionidae, Spodoptera frugiperda (J. E. Smith (Lepidoptera, Noctuidae, and Thyrinteina arnobia (Stoll (Lepidoptera, Geometridae were offered to S. cincticeps in laboratory bioassays where predatory attack and prey defensive behaviors were observed for 2-hour periods. The attack behavior of S. cincticeps changed with the prey species offered. More than 25% of T. molitor and S. frugiperda larvae were immediately attacked, but T. arnobia was not immediately attacked by S. cincticeps. Successful attack (i.e., successful insertion of the predator stylets into the prey depends on the region of the body attacked, with a greater proportion of successful attacks in the anterior than in the median or posterior regions. Larvae of T. arnobia and S. frugiperda displayed a sequence of abrupt head and body movements in response to S. cincticeps attack. Attempts of predation were more successful on T. molitor and S. frugiperda than on T. arnobia. Information about the differential attack behavior of S. cincticeps on different prey species is important for designing successful biological control programs using this hemipteran predator.A agressividade da presa altera o comportamento de ataque do predador Supputius cincticeps (Stål (Hemiptera, Pentatomidae? O percevejo Supputius cincticeps (Stål (Hemiptera, Pentatomidae é um predador encontrado em várias regiões brasileiras, que possui atributos desejáveis como agente de controle natural ou em

  16. Ultrastructure of compatible and incompatible interactions in phloem sieve elements during the stylet penetration by cotton aphids in melon

    NARCIS (Netherlands)

    Garzo, E.; Fernández-Pascual, Mercedes; Morcillo, Cesar; Fereres, Alberto; Gómez-Guillamón, M.L.; Tjallingii, W.F.

    2017-01-01

    Resistance of the melon line TGR-1551 to the aphid Aphis gossypii is based on preventing aphids from ingesting phloem sap. In electrical penetration graphs (EPGs), this resistance has been characterized with A. gossypii showing unusually long phloem salivation periods (waveform E1) mostly

  17. Pre shipping dip treatments using soap, natural oils, and Isaria fumosorosea: potential biopesticides for mitigating the spread of whitefly Bemisia tabaci (Hemiptera: Aleyrodidae) invasive insects on ornamental plants

    Science.gov (United States)

    The whitefly Bemisia tabaci (Hemiptera: Aleyodidae) is an invasive insect pest affecting different crops including vegetables, fruits, cereals, and ornamentals. The efficacy of some products such as commercial soap, natural oils and Preferal® (based on the entomopathogenic fungus Isaria fumosorosea ...

  18. Identification of defensive compounds in metathoracic glands of adults of the stink bug Dichelops melacanthus (Hemiptera: Pentatomidae)

    Energy Technology Data Exchange (ETDEWEB)

    Marques, Francisco A.; Wendler, Edison P.; Maia, Beatriz Helena L.N. Sales [Universidade Federal do Parana (UFPR), Curitiba, PR (Brazil). Dept. de Quimica]. E-mail: francisco.marques@pesquisador.cnpq.br; Ventura, Mauricio U.; Arruda-Gatti, Iara Cintra [Universidade Estadual de Londrina (UEL), PR (Brazil). Centro de Ciencias Agrarias. Dept. de Agronomia

    2007-07-01

    The contents of metathoracic glands of adults of the stink bug Dichelops melacanthus (Hemiptera: Pentatomidae) were analyzed. Compounds were identified by gas chromatography (GC), coupled GC-mass spectrometry and matching retention indices and mass spectra with those of authentic samples. Tridecane was the major component followed by lesser and approximately equal amounts of (E)-4-oxo-2-hexenal and (E)-2-octenal. Other compounds identified include (E)-2-hexenal, decane, (E)-2-hexenyl acetate, undecane, (E)-4-oxo-2-octenal, dodecane, (E)-2-octenyl acetate, 1-tridecene, tetradecane and pentadecane. (author)

  19. Identification of defensive compounds in metathoracic glands of adults of the stink bug Dichelops melacanthus (Hemiptera: Pentatomidae)

    International Nuclear Information System (INIS)

    Marques, Francisco A.; Wendler, Edison P.; Maia, Beatriz Helena L.N. Sales; Ventura, Mauricio U.; Arruda-Gatti, Iara Cintra

    2007-01-01

    The contents of metathoracic glands of adults of the stink bug Dichelops melacanthus (Hemiptera: Pentatomidae) were analyzed. Compounds were identified by gas chromatography (GC), coupled GC-mass spectrometry and matching retention indices and mass spectra with those of authentic samples. Tridecane was the major component followed by lesser and approximately equal amounts of (E)-4-oxo-2-hexenal and (E)-2-octenal. Other compounds identified include (E)-2-hexenal, decane, (E)-2-hexenyl acetate, undecane, (E)-4-oxo-2-octenal, dodecane, (E)-2-octenyl acetate, 1-tridecene, tetradecane and pentadecane. (author)

  20. First occurrence of Alcaeorrhynchus grandis (Dallas) (Hemiptera: Pentatomidae) preying on defoliating caterpillars of oil palm in the state of Para, Brazil; Primeira ocorrencia de Alcaeorrhynchus grandis (Dallas) (Hemiptera: Pentatomidae) predando lagartas desfolhadoras do dendezeiro no estado do Para, Brasil

    Energy Technology Data Exchange (ETDEWEB)

    Ribeiro, Rafael C.; Lemos, Walkymario P.; Muller, Antonio A. [EMBRAPA Amazonia Oriental, Belem, PA (Brazil). Lab. de Entomologia], e-mail: rafaufra@yahoo.com.br, e-mail: wplemos@cpatu.embrapa.br; Muller, Antonio A. [Embrapa Amazonia Oriental, Belem, PA (Brazil). Lab. de Entomologia; Bernardino, Aline S.; Buecke, Joel [Grupo Agropalma S/A., Tailandia, PA (Brazil)

    2010-01-15

    The oil palm Elaeis guineensis is usually attacked by pests, particularly, defoliating caterpillars. Between 2004 and 2006 a stinkbug predator (Asopinae) was registered preying on caterpillars of Brassolis sophorae L., Opsiphanes invirae Hubner (Lepidoptera: Nymphalidae) and Sibine spp. (Lepidoptera: Limacodidae), reducing their populations in commercial oil palm plantations in the State of Para, Brazil. Specimens of the natural enemy were collected, mounted, and identified as Alcaeorrhynchus grandis (Dallas) (Hemiptera: Pentatomidae), corresponding to the first report of the occurrence of this stinkbug attacking defoliating caterpillars of oil palm in Brazil. (author)

  1. First Record of Diaphorina citri (Hemiptera: Psyllidae) in Ecuador Infesting Urban Citrus and Orange Jasmine Trees

    Science.gov (United States)

    Cornejo, J.F.; Chica, E.J.

    2014-01-01

    Abstract Adults and nymphs of the Asian citrus psyllid, Diaphorina citri Kuwayama (Hemiptera: Psyllidae), were collected in the Guayaquil, Samborondón, and Durán cantons in coastal Ecuador. Psyllids were found in high numbers in citrus ( Citrus spp., Sapindales: Rutaceae) and orange jasmine ( Murraya exotica [L.] Jack, Sapindales: Rutaceae) trees within the Guayaquil-Samborondon-Duran conurbation; however, none was found during scoutings in the main citrus producing areas in coastal Ecuador. To the best of our knowledge, this is the first report of D. citri in Ecuador and the Pacific coastal plain of South America. PMID:25527601

  2. Data on the scale insect (Hemiptera: Coccomorpha) fauna of Greece, with description of two new species.

    Science.gov (United States)

    Szita, Éva; Fetykó, Kinga Gabriela; Benedicty, Zsuzsanna Konczné; Kozár, Ferenc; Partsinevelos, Georgios; Milonas, Panagiotis; Kaydan, Mehmet Bora

    2017-10-09

    Surveys of the scale insect (Hemiptera: Coccomorpha) fauna of Greece were carried out in 2013 and 2014. Altogether 93 scale insect species were collected, belonging to 11 families. Thirty-eight species (41%) proved to be new to the Greek fauna, including two species new to science (Anophococcus hellenicus Kaydan & Szita sp. n. (Acanthococcidae) and Iberococcus attikus Szita & Fetykó sp. n. (Pseudococcidae)), and two introduced invasive species (Phenacoccus graminicola Leonardi and Pseudococcus comstocki (Kuwana), both Pseudococcidae). The rest of the species seem to be native to the Greek fauna. The total number of scale insect species recorded from Greece is increased to 253.

  3. Especies de miridae (hemiptera) registradas en algunos cultivos tropicales en Chanchamayo y Satipo. Junín - Perú

    OpenAIRE

    Arellano, Germán; Vergara, Clorinda

    2016-01-01

    El presente estudio tuvo como objetivo identificar las especies de insectos Miridae(Hemiptera) presentes en seis cultivos tropicales en la selva del Departamento de Junín, Perú. Se considera como base las recolecciones realizadas entre los años 1983 a 1987. El muestreo se basó en colectas periódicas semanales de insectos en las plantaciones de cafeto (Coffea arabica L.), papayo (Carica papaya L.), piña (Ananas comosus var. comosus (L.) Merr., Coppens & Leal), palto (Persea americana Mill), cí...

  4. Ocorrência de Tuthillia cognata Hodkinson, Brown & Burckhardt, 1986(Hemiptera: Homoptera, Psyllidae em plantios experimentais de camu-camu Myrciaria dubia (H.B.K. Mc Vaugh em Manaus (Amazonas, Brasil Occurrence of Tuthillia cognata Hodkinson, Brown & Burckhardt, 1986 (Hemiptera: Homoptera, Psyllidae in experimental plantations of camu-camu Myrciaria dubia (H.B.K. Mc Vaugh in Manaus (Amazonas, Brazil

    Directory of Open Access Journals (Sweden)

    Márcio Luís Leitão Barbosa

    2004-01-01

    Full Text Available O cultivo de camu-camu Myrciaria dubia (H.B.K. Mc Vaugh tem apresentado inúmeros problemas fitossanitários, dentre os quais, Tuthillia cognata Hodkinson et al. (Hemiptera: Homoptera, Psyllidae, que constantemente é citada como praga secundária. Os objetivos deste estudo foram determinar o nível e a intensidade de infestação (% por T. cognata e estudar aspectos do ciclo biológico e do comportamento de T. cognata, em plantios experimentais de camu-camu. Foram selecionados, de forma aleatória, 17 e 14 exemplares nos plantios I e II, respectivamente. Para cada uma das variáveis estudadas, foram calculados a média aritmética, o desviopadrão, a variância e a amplitude de variação. Foi verificado um nível de infestação de 82% (plantio I e 57% (plantio II, uma intensidade de infestação de 94% (plantio I e 75% (plantio II e uma média de seis ninfas/folha em cada plantio, o que indica que T. cognata representa uma das pragas-chave dessa cultura. Foram observados adultos de Chrysoperla sp. (Neuroptera: Chrysopidae e ninfas de Reduviidae (Hemiptera: Heteroptera, que podem atuar como prováveis agentes de controle biológico de T. cognata.The cultivation of camu-camu Myrciaria dubia (H.B.K. Mc Vaugh has presented countless phytosanitary problems, among them, Tuthillia cognata Hodkinson et al. (Hemiptera: Homoptera, Psyllidae, which often is noticed as a secondary pest. This study aimed to determine the level and the intensity of infestation (% for T. cognata, as well as to study the biological cycle and behavioural aspects of T. cognata, in experimental plantation of camu-camu. 17 and 14 specimens from plantation I and II, respectively, were randomly selected. The arithmetic average, the standard deviation, the variance and the total amplitude were calculated for each studied variable. A level of infestation of 82% (plantation I and 57% (plantation II, an intensity of infestation of 94% (plantation I and 75% (plantation II and an

  5. DNA Barcodes for Nearctic Auchenorrhyncha (Insecta: Hemiptera)

    Science.gov (United States)

    Foottit, Robert G.; Maw, Eric; Hebert, P. D. N.

    2014-01-01

    Background Many studies have shown the suitability of sequence variation in the 5′ region of the mitochondrial cytochrome c oxidase I (COI) gene as a DNA barcode for the identification of species in a wide range of animal groups. We examined 471 species in 147 genera of Hemiptera: Auchenorrhyncha drawn from specimens in the Canadian National Collection of Insects to assess the effectiveness of DNA barcoding in this group. Methodology/Principal Findings Analysis of the COI gene revealed less than 2% intra-specific divergence in 93% of the taxa examined, while minimum interspecific distances exceeded 2% in 70% of congeneric species pairs. Although most species are characterized by a distinct sequence cluster, sequences for members of many groups of closely related species either shared sequences or showed close similarity, with 25% of species separated from their nearest neighbor by less than 1%. Conclusions/Significance This study, although preliminary, provides DNA barcodes for about 8% of the species of this hemipteran suborder found in North America north of Mexico. Barcodes can enable the identification of many species of Auchenorrhyncha, but members of some species groups cannot be discriminated. Future use of DNA barcodes in regulatory, pest management, and environmental applications will be possible as the barcode library for Auchenorrhyncha expands to include more species and broader geographic coverage. PMID:25004106

  6. Morphology of the mouthparts of the spittlebug Philagra albinotata Uhler (Hemiptera: Cercopoidea: Aphrophoridae).

    Science.gov (United States)

    Wang, Tingting; Pan, Liuxing; Zhang, Yalin; Dai, Wu

    2015-03-01

    Mouthparts associated with feeding behavior and feeding habits are important sensory and feeding structures in insects. To obtain a better understanding of feeding in Cercopoidea, the morphology of mouthparts of the spittlebug, Philagra albinotata Uhler was examined using scanning electron microscopy. The mouthparts of P. albinotata are of the typical piercing-sucking type found in Hemiptera, comprising a cone-shaped labrum, a tube-like, three-segmented labium with a deep groove on the anterior side, and a stylet fascicle consisting of two mandibular and two maxillary stylets. The mandibles consist of a dorsal smooth region and a ventral serrate region near the apical half of the external convex region, and bear five nodules or teeth on the dorsal external convex region on the distal extremity; these are regarded as unique features that distinguish spittlebugs from other groups of Hemiptera. The externally smooth maxillary stylets, interlocked to form a larger food canal and a smaller salivary canal, are asymmetrical only in the internal position of longitudinal carinae and grooves. One dendritic canal is found in each maxilla and one in each mandible. Two types of sensilla trichodea, three types of sensilla basiconica and groups of multi-peg structures occur in different locations on the labium, specifically the labial tip with two lateral lobes divided into anterior sensory fields with ten small peg sensilla arranged in a 5+4+1 pattern and one big peg sensillum, and posterior sensory fields with four sensilla trichodea. Compared with those of previously studied Auchenorrhyncha, the mouthparts of P. albinotata may be distinguished by the shape of the mandibles, the multi-peg structures and a tooth between the salivary canal and the food canal on the extreme end of the stylets. The mouthpart morphology is illustrated using scanning electron micrographs, and the taxonomic and putative functional significance of the different structures is briefly discussed

  7. Planthopper (Hemiptera: Flatidae) Parasitized by Larval Erythraeid Mite (Trombidiformes: Erythraeidae)—A Description of Two New Species From Western Madagascar

    Science.gov (United States)

    Mąkol, Joanna; Moniuszko, Hanna; Świerczewski, Dariusz; Stroiński, Adam

    2014-01-01

    Abstract Descriptions of Dambullaeus adonis Mąkol et Moniuszko sp. nov. (Trombidiformes: Erythraeidae, Callidosomatinae) and Latois nigrolineata Świerczewski et Stroiński sp. nov. (Hemiptera: Fulgoromorpha, Flatidae) from Madagascar are provided. The first host record for ectoparasitic larvae of Dambullaeus Haitlinger, 2001 and the first evidence on host–parasite association between flatid adult and erythraeid larvae are given. Genus Dambullaeus , known exclusively from larvae and now comprising two species of Gondwanan distribution, is critically reappraised. PMID:25434029

  8. Toxicities of Selected Essential Oils, Silicone Oils, and Paraffin Oil against the Common Bed Bug (Hemiptera: Cimicidae).

    Science.gov (United States)

    Zha, Chen; Wang, Changlu; Li, Andrew

    2018-02-09

    The common bed bug [Cimex lectularius L. (Hemiptera: Cimicidae)] and tropical bed bug [Cimex hemipterus F. (Hemiptera: Cimicidae)] resurged in the United States and many other countries over the past decades. The need for safe and effective bed bug control products propelled the development of numerous 'green insecticides', mostly with essential oils listed as active ingredients. Various inorganic and organic oils also were used for bed bug management. However, there are no published studies on their toxicities against bed bugs. In this study, we screened 18 essential oils, three silicone oils, and paraffin oil (C5-20 paraffins) for their toxicities against bed bugs. All the oils exhibited insecticidal activity in topical assays. Their toxicities varied significantly; all of the evaluated essential oils were less effective than silicone oils and paraffin oil. The LD50 values of the most effective essential oil (blood orange), paraffin oil, and the most effective silicone oil (dodecamethylpentasiloxane) are 0.184 ± 0.018, 0.069 ± 0.012, and 0.036 ± 0.005 mg per bug, respectively. Direct spray of 1% water solution of 3-[hydroxy (polyethyleneoxy) propyl] heptamethyltrisiloxane, the only silicone oil that mixes well with water, resulted in 92% bed bug mortality after 1 d. Results of this study indicate silicone oils and paraffin oil have the potential to be used as safer alternative bed bug control materials. © The Author(s) 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  9. Identifikasi kutukebul (Hemiptera: Aleyrodidae dari beberapa tanaman inang dan perkembangan populasinya

    Directory of Open Access Journals (Sweden)

    Purnama Hidayat

    2017-02-01

    Full Text Available Whiteflies (Hemiptera: Aleyrodidae can cause direct and indirect damages on plants, especially vegetables. There is only limited information regarding taxonomy and population dynamic of whiteflies attacking vegetables in Indonesia. This research is conducted to identify species of whitefly collected from chili pepper, tomato, and soybean, and to study their population dynamic. The information gathered from these studies will be useful to support whitefly management in the field. Based on morphology identification of the puparium collected directly from the host plants, there were four species of whitefly identified from chili pepper, tomato, and soybean in Bogor, Cianjur, and Sukabumi, i.e. Bemisia tabaci, Aleurodicus dispersus, Trialeurodes vaporariorum, and Dialeurodes sp. The presence of B. tabaci on chili pepper and tomato was associated with virus infection that causes yellowing and leaf curl disease. This population of B. tabaci tended to increase along with plant growth and generally reached the highest population when the plant was 60-70 days after planting.

  10. A two-in-one superhydrophobic and anti-reflective nanodevice in the grey cicada Cicada orni (Hemiptera)

    Energy Technology Data Exchange (ETDEWEB)

    Dellieu, Louis, E-mail: louis.dellieu@unamur.be; Sarrazin, Michaël, E-mail: michael.sarrazin@unamur.be; Simonis, Priscilla; Deparis, Olivier; Vigneron, Jean Pol [Research Center in Physics of Matter and Radiation (PMR), Department of Physics, University of Namur (FUNDP), 61 rue de Bruxelles, B-5000 Namur (Belgium)

    2014-07-14

    Two separated levels of functionality are identified in the nanostructure which covers the wings of the grey cicada Cicada orni (Hemiptera). The upper level is responsible for superhydrophobic character of the wing, while the lower level enhances its anti-reflective behavior. Extensive wetting experiments with various chemical species and optical measurements were performed in order to assess the bi-functionality. Scanning electron microscopy imaging was used to identify the nanostructure morphology. Numerical optical simulations and analytical wetting models were used to prove the roles of both levels of the nanostructure. In addition, the complex refractive index of the chitinous material of the wing was determined from measurements.

  11. A two-in-one superhydrophobic and anti-reflective nanodevice in the grey cicada Cicada orni (Hemiptera)

    Science.gov (United States)

    Dellieu, Louis; Sarrazin, Michaël; Simonis, Priscilla; Deparis, Olivier; Vigneron, Jean Pol

    2014-07-01

    Two separated levels of functionality are identified in the nanostructure which covers the wings of the grey cicada Cicada orni (Hemiptera). The upper level is responsible for superhydrophobic character of the wing, while the lower level enhances its anti-reflective behavior. Extensive wetting experiments with various chemical species and optical measurements were performed in order to assess the bi-functionality. Scanning electron microscopy imaging was used to identify the nanostructure morphology. Numerical optical simulations and analytical wetting models were used to prove the roles of both levels of the nanostructure. In addition, the complex refractive index of the chitinous material of the wing was determined from measurements.

  12. A two-in-one superhydrophobic and anti-reflective nanodevice in the grey cicada Cicada orni (Hemiptera)

    International Nuclear Information System (INIS)

    Dellieu, Louis; Sarrazin, Michaël; Simonis, Priscilla; Deparis, Olivier; Vigneron, Jean Pol

    2014-01-01

    Two separated levels of functionality are identified in the nanostructure which covers the wings of the grey cicada Cicada orni (Hemiptera). The upper level is responsible for superhydrophobic character of the wing, while the lower level enhances its anti-reflective behavior. Extensive wetting experiments with various chemical species and optical measurements were performed in order to assess the bi-functionality. Scanning electron microscopy imaging was used to identify the nanostructure morphology. Numerical optical simulations and analytical wetting models were used to prove the roles of both levels of the nanostructure. In addition, the complex refractive index of the chitinous material of the wing was determined from measurements.

  13. Primer registro de Conidiobolus coronatus (Zygomycetes: Entomophthorales en crías experimentales de dos especies plaga del maíz: Delphacodes kuscheli y D. haywardi (Hemiptera: Delphacidae en la Argentina First record of Conidiobolus coronatus (Zygomycetes: Entomophthorales in experimental breeding of two pest species of corn: Delphacodes kuscheli and D. haywardi Muir (Hemiptera: Delphacidae in Argentine

    Directory of Open Access Journals (Sweden)

    A. V. Toledo

    Full Text Available Se investigó la ocurrencia natural del hongo entomopatógeno Conidiobolus coronatus (Costantin Batko (Zygomycetes: Entomophthorales en adultos de Delphacodes kuscheli Fennah y D. haywardi Muir (Hemiptera: Delphacidae, criados sobre Hordeum vulgare L. bajo condiciones de invernadero. Los insectos muertos, por una sospechada infección fúngica, fueron recolectados, esterilizados superficialmente, y examinados en el laboratorio. Conidiobolus coronatus fue aislado en cultivos puros, descrito morfológicamente y depositado en colecciones micológicas. Este trabajo presenta el primer registro de C. coronatus contra insectos perjudiciales en la Argentina.The natural occurrence of the entomopathogenic fungus Conidiobolus coronatus (Costantin Batko (Zygomycetes: Entomophthorales in adults of Delphacodes kuscheli Fennah and D. haywardi Muir (Hemiptera: Delphacidae, reared on Hordeum vulgare L. under greenhouse conditions, was investigated. Dead insects, suspected of fungal infection, were collected, surface sterilized, and examined in the laboratory. Conidiobolus coronatus was isolated in pure cultures, described morphologically, and deposited in mycological collections. This paper presents the first record of C. coronatus against harmful insects in Argentina.

  14. Organization of the mitochondrial genomes of whiteflies, aphids, and psyllids (Hemiptera, Sternorrhyncha

    Directory of Open Access Journals (Sweden)

    Baumann Paul

    2004-08-01

    Full Text Available Abstract Background With some exceptions, mitochondria within the class Insecta have the same gene content, and generally, a similar gene order allowing the proposal of an ancestral gene order. The principal exceptions are several orders within the Hemipteroid assemblage including the order Thysanoptera, a sister group of the order Hemiptera. Within the Hemiptera, there are available a number of completely sequenced mitochondrial genomes that have a gene order similar to that of the proposed ancestor. None, however, are available from the suborder Sternorryncha that includes whiteflies, psyllids and aphids. Results We have determined the complete nucleotide sequence of the mitochondrial genomes of six species of whiteflies, one psyllid and one aphid. Two species of whiteflies, one psyllid and one aphid have mitochondrial genomes with a gene order very similar to that of the proposed insect ancestor. The remaining four species of whiteflies had variations in the gene order. In all cases, there was the excision of a DNA fragment encoding for cytochrome oxidase subunit III(COIII-tRNAgly-NADH dehydrogenase subunit 3(ND3-tRNAala-tRNAarg-tRNAasn from the ancestral position between genes for ATP synthase subunit 6 and NADH dehydrogenase subunit 5. Based on the position in which all or part of this fragment was inserted, the mitochondria could be subdivided into four different gene arrangement types. PCR amplification spanning from COIII to genes outside the inserted region and sequence determination of the resulting fragments, indicated that different whitefly species could be placed into one of these arrangement types. A phylogenetic analysis of 19 whitefly species based on genes for mitochondrial cytochrome b, NADH dehydrogenase subunit 1, and 16S ribosomal DNA as well as cospeciating endosymbiont 16S and 23S ribosomal DNA indicated a clustering of species that corresponded to the gene arrangement types. Conclusions In whiteflies, the region of the

  15. Tools for evaluating Lipolexis oregmae (Hymenoptera: Aphidiidae) in the field: Effects of host aphid and host plant on mummy location and color plus improved methods for obtaining adults

    International Nuclear Information System (INIS)

    Singh, R.; Hoy, M.A.

    2007-01-01

    Lipolexis oregmae Gahan was introduced into Florida in a classical biological control program directed against the brown citrus aphid, Toxoptera citricida (Kirkaldy), on citrus. Prior to evaluating distribution, host range, and potential nontarget effects of L. oregmae in Florida, we evaluated the role of other potential host aphids and host plants on mummy production and location. Under laboratory conditions, this parasitoid produced the most progeny on the target pest, the brown citrus aphid on citrus. This parasitoid, unlike the majority of aphidiids, did not produce mummies on any of the host plants tested when reared in black citrus aphid T. aurantii (Boyer de Fonscolombe) on grapefruit, spirea aphid Aphis spiraecola Patch on grapefruit and pittosporum, cowpea aphid A. craccivora Koch on grapefruit and cowpeas, or melon aphid A. gossypii Glover on grapefruit and cucumber. Thus, sampling for L. oregmae mummies of these host aphids and host plants must involve holding foliage in the laboratory until mummies are produced. This parasitoid requires high relative humidity to produce adults because no adults emerged when mummies were held in gelatin capsules, but high rates of emergence were observed when mummies were held on 1.5% agar plates. In addition, we compared the color of 6 aphid hosts and the color of mummies produced by L. oregmae when reared in them to determine if color of mummies could be used to identify L. oregmae . Mummy color varied between aphid hosts and tested host plants, and is not a useful tool for identifying L. oregmae for nontarget effects. (author) [es

  16. Are Phenacoccus solani Ferris and P. defectus Ferris (Hemiptera: Pseudococcidae) distinct species?

    Science.gov (United States)

    Chatzidimitriou, Evangelia; Simonato, Mauro; Watson, Gillian W; Martinez-Sañudo, Isabel; Tanaka, Hirotaka; Zhao, Jing; Pellizzari, Giuseppina

    2016-03-24

    Among the Nearctic species of Phenacoccus (Hemiptera: Pseudococcidae), Phenacoccus solani Ferris and P. defectus Ferris are morphologically similar and it can be difficult to separate them on the basis of microscopic morphological characters of the adult female alone. In order to resolve their identity, a canonical variates morphological analysis of 199 specimens from different geographical origins and host plants and a molecular analysis of the COI and 28S genes were performed. The morphological analysis supported synonymy of the two species, as although the type specimens of the "species" are widely separated from each other in the canonical variates plot, they are all part of a continuous range of variation. The molecular analysis showed that P. solani and P. defectus are grouped in the same clade. On the basis of the morphological and molecular analyses, P. defectus is synonymized under the senior name P. solani, syn. n.

  17. Evaluasi Sifat Ovisidal dan Nimfasidal Insektisida Buprofezin 100 g/l terhadap Telur dan Nimfa Wereng Coklat, Nilaparvata lugens (Stal.) (Hemiptera: Delphacidae)

    OpenAIRE

    BAEHAKI SUHERLAN EFFENDI; EKO HARI ISWANTO; AMIR HAMZAH

    2016-01-01

    Evaluation of ovicidal and nymphcidal properties of buprofezin 100 g/linsecticide to eggs and nymphs of brown planthopper, Nilaparvata lugens(Stal.) (Hemiptera: Delphacidae). Research was carried out in screen house ofSukamandi, Indonesian Center for Rice Research (ICRR) in the wet season of 2013. Theresearch used randomized block design with 5 doses levels insecticide treatment of buprofezin100 g/l and four replications. The buprofezin treatments were 250, 500, 750, 1000, and 1500ml/ha compa...

  18. Levantamento da fauna de Triatominae (Hemiptera: Reduviidae em ambiente domiciliar e infecção natural por Trypanosomatidae no Estado de Mato Grosso do Sul Survey of Triatominae (Hemiptera: Reduviidae fauna in domestic environments and natural infection by Trypanosomatidae in the State of Mato Grosso do Sul

    Directory of Open Access Journals (Sweden)

    Paulo Silva de Almeida

    2008-08-01

    Full Text Available Entre 2000 a 2004, foi realizado levantamento da fauna de Triatominae (Hemiptera: Reduviidae e exame de infecção natural por Trypanosomatidae, no Estado de Mato Grosso do Sul. Um total de 13.671 espécimes foram capturados. Na análise faunística das espécies capturadas, Triatoma sordida foi caracterizada como muito abundante, muito freqüente, constante e dominante. Os índices de infecção natural para Trypanosoma cruzi apresentaram os valores de 3,2% para Panstrongylus geniculatus, 0,6% para Rhodnius neglectus e 0,1% para Triatoma sordida, apesar do Estado de Mato Grosso do Sul apresentar-se livre da transmissão vetorial endêmica.Between 2000 and 2004, a survey of Triatominae fauna (Hemiptera: Reduviidae and examination of natural infection caused by Trypanosomatidae in the State of Mato Grosso do Sul, Brazil, was conducted. A total of 13,671 specimens were collected. Through fauna analysis on the insects that were caught, Triatoma sordida was characterized as very abundant, very frequent, constant and dominant. The rates of natural infection with Trypanosoma cruzi were 3.2% for Panstrongylus geniculatus, 0.6% for Rhodnius neglectus and 0.1% for Triatoma sordida. Nevertheless, the State of Mato Grosso do Sul is free from endemic vector transmission.

  19. Insects found in birds' nests from Argentina. Pseudoseisura lophotes Reichenbach, 1853 and Anumbius annumbi (Vieillot, 1817) (Aves: Furnariidae), hosts of Triatoma platensis Neiva, 1913 (Hemiptera: Reduviidae: Triatominae).

    Science.gov (United States)

    Paola, Turienzo

    2014-02-24

    The insect fauna of the nests of Pseudoseisura lophotes (Reichenbach, 1853) (Aves: Furnariidae) from Argentina was investigated. A total of 110 species (68 identified to species, 22 identified to genus, 20 identified to family) in 40 families of 10 orders of insects was found in these nests. Triatoma platensis Neiva, 1913 (Hemiptera: Reduviidae) was found again in nests of P. lophotes, corroborating after 73 years the first observations made by Mazza in 1936. The occurrence of the insects in nests of P. lophotes is compared with the previously known insect fauna in nests of A. annumbi, Furnarius rufus (Furnariidae), and Myiopsitta monachus (Psittacidae). The insect fauna in additional nests of Anumbius annumbi from the same and/or different localities is given, and used in comparisons. The first occurrence of Cuterebridae (Diptera) in birds' nests, their pupae as the overwintering stage, and the second simultaneous infestation by two species of Philornis (Diptera: Muscidae) on the same nestlings are presented. Other simultaneous infestations of different hematophagous arthropods (Hemiptera: Cimidae; Reduviidae: Triatominae, and Acari: Argasidae) are remarked and discussed.

  20. A new Anagyrus (Hymenoptera: Encyrtidae) from Argentina, parasitoid of Hypogeococcus sp. (Hemiptera: Pseudococcidae) on Harrisia pomanensis (Cactaceae).

    Science.gov (United States)

    Triapitsyn, Serguei V; Aguirre, María B; Logarzo, Guillermo A

    2016-05-26

    A new species of Anagyrus Howard (Hymenoptera: Encyrtidae), A. lapachosus sp. n., is described from Salta Province of Argentina as a parasitoid of Hypogeococcus sp. (Hemiptera: Pseudococcidae) on Harrisia pomanensis cactus (Cactaceae). It is a candidate "new association" biological control agent for quarantine evaluation and possible following introduction to Puerto Rico (USA) against another Hypogeococcus sp., commonly called the Harrisia cactus mealybug and often misidentified as H. pungens Granara de Willink (according to our unpublished data the latter attacks only Amaranthaceae), which devastates or threatens the native cacti there and also in some other Caribbean islands (Triapitsyn, Aguirre et al. 2014; Carrera-Martínez et al. 2015).

  1. Megamelus bellicus (Hemiptera: Delphacidae: immature stages and biology

    Directory of Open Access Journals (Sweden)

    Roxana MARIANI

    2007-01-01

    Full Text Available Se describen e ilustran los estados inmaduros de Megamelus bellicus Remes Lenicov & Sosa (Hemiptera: Delphacidae y se presenta una clave para identificarlos. La descripción de cada estadio se realizó sobre la base de ninfas extraidas 24 horas posteriores a la eclosión, de colonias de laboratorio y criadas sobre trozos de hojas de camalote Eichhornia crassipes (Martius Solms Laubach. Los principales caracteres para distinguir los distintos estadios son: tamaño del cuerpo, color, número de tarsómeros, espinulación de la metatibia y número de dientes del calcar y presencia de sensorios en el pedicelo antenal. Datos biológicos basados en observaciones en el laboratorio y en el campo, muestran que M. bellicus realiza su ciclo biológico exitosamente sobre Pontederiaceae. Los huevos, dispuestos de 1 a 9 por postura, son colocados profundamente en el aerénquima del pecíolo; son más frecuentes de 3-4, menos frecuentes 5, 2 y 6, y raramente 1, 7 y 9. Se registra el porcentaje de parasitoidismo de un Hymenoptera oófilo de la familia Eulophidae, Aprostocetus (Ootetrastichus sp. Debido a que M. bellicus ocupa el mismo hábitat ecológico que M. scutellaris Berg, se resaltan las principales diferencias morfológicas y de comportamiento entre las mismas.

  2. Spectral Detection of Soybean Aphid (Hemiptera: Aphididae) and Confounding Insecticide Effects in Soybean

    Science.gov (United States)

    Alves, Tavvs Micael

    Soybean aphid, Aphis glycines (Hemiptera: Aphididae) is the primary insect pest of soybean in the northcentral United States. Soybean aphid may cause stunted plants, leaf discoloration, plant death, and decrease soybean yield by 40%. Sampling plans have been developed for supporting soybean aphid management. However, growers' perception about time involved in direct insect counts has been contributing to a lower adoption of traditional pest scouting methods and may be associated with the use of prophylactic insecticide applications in soybean. Remote sensing of plant spectral (light-derived) responses to soybean aphid feeding is a promising alternative to estimate injury without direct insect counts and, thus, increase adoption and efficiency of scouting programs. This research explored the use of remote sensing of soybean reflectance for detection of soybean aphids and showed that foliar insecticides may have implications for subsequent use of soybean spectral reflectance for pest detection. (Abstract shortened by ProQuest.).

  3. Efeito de extratos de plantas do Cerrado em Dipetalogaster maxima (Uhler (Hemiptera, Reduviidae Effect of Cerrado plant extracts on Dipetalogaster maxima (Uhler (Hemiptera, Reduviidae

    Directory of Open Access Journals (Sweden)

    André A. M. Coelho

    2009-01-01

    Full Text Available A transmissão da doença de Chagas ocorre, principalmente, por meio de fezes de hemípteros hematófagos (Triatominae, os quais ingerem o Trypanosoma cruzi ao se alimentarem do sangue de pessoas ou outros mamíferos infectados. Para o controle dos triatomíneos, os piretróides são os principais inseticidas utilizados. Entretanto, algumas populações de insetos demonstraram resistência a determinados piretróides, indicando a necessidade do desenvolvimento de novos inseticidas eficazes no controle desses vetores. Assim, foi avaliada a atividade inseticida de 83 extratos vegetais, pertencentes a 35 espécies diferentes, em ninfas do primeiro estádio de Dipetalogaster maxima (Uhler, 1894 (Hemiptera: Reduviidae, triatomíneo encontrado no México. Para o teste tópico, foram aplicados 50 ìg de cada extrato nos tergitos abdominais de dez ninfas, em duplicata. Como controles, foram utilizados insetos tratados com etanol, acetona ou sem nenhum tipo de tratamento. Os triatomíneos foram observados durante 28 dias. Nenhum extrato apresentou atividade inseticida significativa, entretanto, o extrato hexânico do fruto e o etanólico da casca do caule de Simarouba versicolor (Simaroubaceae inibiram a taxa de ecdise em D. maxima (40% e 25%, respectivamente. Sugere-se que estes extratos sejam quimicamente investigados e monitorados por ensaios biológicos a fim de determinar os componentes, para que estes possam ser utilizados como modelos moleculares ou como compostos biorracionais nos programas de controle de insetos.Chagas disease, also known as American Trypanosomiasis, is chiefly transmitted by faeces of haematophagous bugs (Triatominae that ingested Trypanosoma cruzi from blood of infected people or other mammals. Pyrethroids have been the main insecticides used against these insects. However, some populations of insects have shown significant levels of resistance to several pyrethroids, indicating the need of new insecticides for the control of

  4. Three new species of mealybug (Hemiptera, Coccomorpha, Pseudococcidae) on persimmon fruit trees (Diospyros kaki) in southern Brazil.

    Science.gov (United States)

    Pacheco da Silva, Vitor C; Kaydan, Mehmet Bora; Germain, Jean-François; Malausa, Thibaut; Botton, Marcos

    2016-01-01

    Brazil has the greatest insect diversity in the world; however, little is known about its scale insect species (Hemiptera: Coccomorpha). Mealybugs (Pseudococcidae) have been found in at least 50% of persimmon orchards Diospyros kaki L. in the southern part of the country. In this study three new mealybug species on persimmon trees located in the Serra Gaúcha Region, RS, Brazil, namely, Anisococcus granarae Pacheco da Silva & Kaydan, sp. n., Ferrisia kaki Kaydan & Pacheco da Silva, sp. n. and Pseudococcus rosangelae Pacheco da Silva & Kaydan, sp. n. are described. In addition, an identification key for the genera occurring on fruit orchards and vineyards in Brazil is provided, together with illustrations and molecular data for the new species.

  5. First occurrence of Alcaeorrhynchus grandis (Dallas) (Hemiptera: Pentatomidae) preying on defoliating caterpillars of oil palm in the state of Para, Brazil

    International Nuclear Information System (INIS)

    Ribeiro, Rafael C.; Lemos, Walkymario P.; Muller, Antonio A.

    2010-01-01

    The oil palm Elaeis guineensis is usually attacked by pests, particularly, defoliating caterpillars. Between 2004 and 2006 a stinkbug predator (Asopinae) was registered preying on caterpillars of Brassolis sophorae L., Opsiphanes invirae Hubner (Lepidoptera: Nymphalidae) and Sibine spp. (Lepidoptera: Limacodidae), reducing their populations in commercial oil palm plantations in the State of Para, Brazil. Specimens of the natural enemy were collected, mounted, and identified as Alcaeorrhynchus grandis (Dallas) (Hemiptera: Pentatomidae), corresponding to the first report of the occurrence of this stinkbug attacking defoliating caterpillars of oil palm in Brazil. (author)

  6. Does the aggressiveness of the prey modify the attack behavior of the predator Supputius cincticeps (Stål (Hemiptera, Pentatomidae?

    Directory of Open Access Journals (Sweden)

    Rafael Braga da Silva

    2012-06-01

    Full Text Available Does the aggressiveness of the prey modify the attack behavior of the predator Supputius cincticeps (Stål (Hemiptera, Pentatomidae? The stink bug Supputius cincticeps (Stål (Hemiptera, Pentatomidae is a predator found in several Brazilian regions, which possesses desirable attributes as a natural control agent and in biological control programs. The aim of this study was to test if the attack behavior and predation success of S. cincticeps were affected by prey species. Larvae of Tenebrio molitor (L. (Coleoptera, Tenebrionidae, Spodoptera frugiperda (J. E. Smith (Lepidoptera, Noctuidae, and Thyrinteina arnobia (Stoll (Lepidoptera, Geometridae were offered to S. cincticeps in laboratory bioassays where predatory attack and prey defensive behaviors were observed for 2-hour periods. The attack behavior of S. cincticeps changed with the prey species offered. More than 25% of T. molitor and S. frugiperda larvae were immediately attacked, but T. arnobia was not immediately attacked by S. cincticeps. Successful attack (i.e., successful insertion of the predator stylets into the prey depends on the region of the body attacked, with a greater proportion of successful attacks in the anterior than in the median or posterior regions. Larvae of T. arnobia and S. frugiperda displayed a sequence of abrupt head and body movements in response to S. cincticeps attack. Attempts of predation were more successful on T. molitor and S. frugiperda than on T. arnobia. Information about the differential attack behavior of S. cincticeps on different prey species is important for designing successful biological control programs using this hemipteran predator.

  7. Bionomy of the laurel scale Aonidia lauri (Bouche (Hemiptera: Diaspididae in Podgorica, Montenegro

    Directory of Open Access Journals (Sweden)

    Graora Draga

    2016-01-01

    Full Text Available Aonidia lauri (Bouche (Hemiptera: Diaspididae is a serious pest of laurel (Laurus nobilis L. in urban parts of the City of Podgorica (Montenegro. Severe infestation causes chlorotic spots and necrotic rings around feeding spots, drying and dieback of leaves and buds. In addition, plants become physiologically weak and lose in aesthetic quality, while continuous infestation in urban areas often leads to partial or complete drying of plants. This study of the biology of A. lauri on L. nobilis was carried out at three locations in Podgorica ('Stara Varoš', 'Centar' and 'Preko Morače', Montenegro, in 2010 and 2011. A. lauri developed three generations annually and overwintered on laurel leaves and branches as the second-instar nymph-larval stage. An extended period of larval development ensures a continuous presence of all development stages on plants, which leads to overlapping of generations. Sporadic predatory ladybirds, Chilocorus bipustulatus (L. (Coleoptera: Coccinellidae, whose larvae and adults feed on scales, were detected inside A. lauri colonies.

  8. Probing behaviors of Sitobion avenae (Hemiptera: Aphididae on enhanced UV-B irradiated plants

    Directory of Open Access Journals (Sweden)

    Hu Zu-Qing

    2013-01-01

    Full Text Available UV-B induced changes in plants can influence sap-feeding insects through mechanisms that have not been studied. Herein the grain aphid, Sitobion avenae (Fabricius (Hemiptera: Aphididae, was monitored on barley plants under the treatments of control [0 kJ/ (m2.d], ambient UV-B [60 kJ/ (m2.d], and enhanced UV-B [120 kJ/ (m2.d] irradiation. Electrical penetration graph (EPG techniques were used to record aphid probing behaviors. Enhanced UV-B irradiated plants negatively affected probing behaviors of S. avenae compared with control plants. In particular, phloem factors that could diminish sieve element acceptance appeared to be involved, as reflected by smaller number of phloem phase, shorter phloem ingestion, and fewer aphids reaching the sustained phloem ingestion phase (E2>10min. On the other hand, factors from leaf surface, epidermis, and mesophyll cannot be excluded, as reflected by higher number of non-probing, longer non-probing and pathway phase, and later the time to first probe.

  9. A new genus and species of tettigarctid cicada from the early Miocene of New Zealand: Paratettigarcta zealandica (Hemiptera, Auchenorrhyncha, Tettigarctidae)

    Science.gov (United States)

    Kaulfuss, Uwe; Moulds, Max

    2015-01-01

    Abstract A new genus and species of primitive cicada (Hemiptera: Tettigarctidae) is described from the early Miocene of southern New Zealand. Paratettigarcta zealandica gen. et sp. n. is the first cicada (Cicadoidea) fossil from New Zealand and exhibits wing venation patterns typical for the subfamily Tettigarctinae. It differs from other fossil taxa and the extant genus Tettigarcta in the early divergence of CuA2 from the nodal line in the forewing, its parallel-sided subcostal cell, the early bifurcation of vein M and long apical cells of the hindwing, and in wing pigmentation patterns. PMID:25829843

  10. Nymphal and adult performance of Euschistus heros (Fabr.) (Hemiptera: Pentatomidae), as a potential alternative host for egg parasitoids multiplication

    International Nuclear Information System (INIS)

    Peres, Wilsimar A.A.; Correa-Ferreira, Beatriz S.

    2001-01-01

    This research aimed to evaluate the potential of Euschistus heros (Fabr.) (Hemiptera: Pentatomidae) as host for multiplication of egg parasitoids, by determining the nymphal and adult performance of E. heros from laboratory and the field, comparing with Nezara viridula (L.) (Hemiptera: Pentatomidae), under mass conditions. One hundred eggs of E. heros and N. viridula were placed among the leaves of soybean plants contained in cages (50x50x70 cm) and observation were made until adult emergence. The nymphs fed on soybean pods, dry soybean and peanuts seeds. The number of nymphs that reached adulthood and the development time were calculated. The survivorship and reproduction performance of laboratory and field populations of E. heros and N. viridula were evaluated during 13 weeks in February-May 1999. The number of eggs produced by 100 pairs of stink bugs per cage containing the same diet was recorded. Nymphal development time of E. heros and N. viridula was 33.0 and 34.0 days and 65.0% and 71.3% of nymphs reached adulthood, respectively. Adults of E. heros reared under laboratory conditions produced 2.5 times more eggs (5547.0 eggs/cage) than those collected in the field (2262.7 eggs/cage). The adult field population of E. heros had reduced reproduction and longevity due to parasitism by Hexacladia smithii Ash. (Hymenoptera: Encyrtidae). The N. viridula adults collected in the field produced 1.7 times more eggs (6304.9 eggs/cage) than those reared in the laboratory (3609.2 eggs/cage). E. heros laboratory reared is a promising host for egg parasitoids multiplication when compared with N. viridula collected in the field. (author)

  11. Nymphal and adult performance of Euschistus heros (Fabr.) (Hemiptera: Pentatomidae), as a potential alternative host for egg parasitoids multiplication

    Energy Technology Data Exchange (ETDEWEB)

    Peres, Wilsimar A.A. [Universidade Federal do Parana, Curitiba, PR (Brazil). Dept. de Zoologia; Correa-Ferreira, Beatriz S. [EMBRAPA, Londrina, PR (Brazil). Centro Nacional de Pesquisa de Soja

    2001-12-15

    This research aimed to evaluate the potential of Euschistus heros (Fabr.) (Hemiptera: Pentatomidae) as host for multiplication of egg parasitoids, by determining the nymphal and adult performance of E. heros from laboratory and the field, comparing with Nezara viridula (L.) (Hemiptera: Pentatomidae), under mass conditions. One hundred eggs of E. heros and N. viridula were placed among the leaves of soybean plants contained in cages (50x50x70 cm) and observation were made until adult emergence. The nymphs fed on soybean pods, dry soybean and peanuts seeds. The number of nymphs that reached adulthood and the development time were calculated. The survivorship and reproduction performance of laboratory and field populations of E. heros and N. viridula were evaluated during 13 weeks in February-May 1999. The number of eggs produced by 100 pairs of stink bugs per cage containing the same diet was recorded. Nymphal development time of E. heros and N. viridula was 33.0 and 34.0 days and 65.0% and 71.3% of nymphs reached adulthood, respectively. Adults of E. heros reared under laboratory conditions produced 2.5 times more eggs (5547.0 eggs/cage) than those collected in the field (2262.7 eggs/cage). The adult field population of E. heros had reduced reproduction and longevity due to parasitism by Hexacladia smithii Ash. (Hymenoptera: Encyrtidae). The N. viridula adults collected in the field produced 1.7 times more eggs (6304.9 eggs/cage) than those reared in the laboratory (3609.2 eggs/cage). E. heros laboratory reared is a promising host for egg parasitoids multiplication when compared with N. viridula collected in the field. (author)

  12. An annotated checklist of scale insects (Hemiptera: Coccoidea) of Saint Lucia, Lesser Antilles .

    Science.gov (United States)

    Malumphy, Chris

    2014-07-31

    An annotated list of 83 scale insect species (Hemiptera: Sterorrhyncha: Coccoidea) recorded from Saint Lucia is presented, based on data gathered from UK quarantine interceptions, samples collected in an urban coastal habitat in the North West of the Island in 2013, and published records. Thirty-three species (40%) are recorded for the first time for the country, including Dysmicoccus joannesiae (Costa Lima), a South American mealybug, and Poliaspoides formosana (Takahashi), an Asian armoured scale insect pest of bamboo, which are new for the Caribbean region. The economic, environmental and social impacts caused by introduced exotic species of scale insect are discussed. Two predatory midges Diadiplosis ?coccidivora (Felt) and Diadiplosis multifila (Felt) (Diptera: Cecidomyiidae) are recorded for the first time from Saint Lucia. The latter species was observed causing 90% mortality of a large infestation of passion vine mealybug Planococcus minor (Maskell) on soursop fruit. 

  13. Identification of top-down forces regulating cotton aphid population growth in transgenic Bt cotton in central China.

    Directory of Open Access Journals (Sweden)

    Peng Han

    Full Text Available The cotton aphid Aphis gossypii Glover is the main aphid pest in cotton fields in the Yangtze River Valley Cotton-planting Zone (YRZ in central China. Various natural enemies may attack the cotton aphid in Bt cotton fields but no studies have identified potential specific top-down forces that could help manage this pest in the YRZ in China. In order to identify possibilities for managing the cotton aphid, we monitored cotton aphid population dynamics and identified the effect of natural enemies on cotton aphid population growth using various exclusion cages in transgenic Cry1Ac (Bt+CpTI (Cowpea trypsin inhibitor cotton field in 2011. The aphid population growth in the open field (control was significantly lower than those protected or restricted from exposure to natural enemies in the various exclusion cage types tested. The ladybird predator Propylaea japonica Thunberg represented 65% of Coccinellidae predators, and other predators consisted mainly of syrphids (2.1% and spiders (1.5%. The aphid parasitoids Aphidiines represented 76.7% of the total count of the natural enemy guild (mainly Lysiphlebia japonica Ashmead and Binodoxys indicus Subba Rao & Sharma. Our results showed that P. japonica can effectively delay the establishment and subsequent population growth of aphids during the cotton growing season. Aphidiines could also reduce aphid density although their impact may be shadowed by the presence of coccinellids in the open field (likely both owing to resource competition and intraguild predation. The implications of these results are discussed in a framework of the compatibility of transgenic crops and top-down forces exerted by natural enemy guild.

  14. A new iranian species of Uroleucon Mordvilko, 1914 (Hemiptera, Aphididae from specimens in the Natural History Museum collection

    Directory of Open Access Journals (Sweden)

    Nieto Nafría, Juan M.

    2014-06-01

    Full Text Available Uroleucon (Uromelan helichrysi sp. n. (Hemiptera, Aphididae, Aphidinae: Macrosiphini is established from Iranian apterous and alate viviparous females caught on Helichrysum sp. (Asteraceae and preserved in the collection of the Natural History Museum (BMNH in London. The number of setae on the first tarsal segments (5, the number of caudal setae (20 to 28, the presence of abdominal marginal tubercles on abdominal segments 2 to 4, and the size of the cells of the siphuncular reticulation (relatively small allow the new species to be distinguished from other Palaeartic species of the subgenus Uromelan. Blackman and Eastop’s key to apterae on Helichrysum is modified to include the new species. urn:lsid:zoobank.org:pub:E2B89D59-05FD-4A9E-AD78-B3C302219A10Se establece la especie Uroleucon helichrysi n. sp. (Hemiptera: Aphididae: Aphidinae: Macrosiphini con la descripción de sus hembras vivíparas ápteras y aladas recogidas en Irán sobre Helichrysum sp. (Asteraceae, conservadas en la colección del Natural History Museum de Londres. La nueva especie se diferencia de otras especies paleárticas del subgénero Uromelan por la cantidad de setas en el primer segmento tarsal (5, la cantidad de setas caudales (20 a 28, por el tamaño de las celdillas de la reticulación cornicular (que son relativamente pequeñas y por la presencia de papilas marginales (presentes en los segmentos abdominales 2 a 4 Se incluye una modificación a la clave de Blackman and Eastop para las ápteras que viven sobre Helichrysum. urn:lsid:zoobank.org:pub:E2B89D59-05FD-4A9E-AD78-B3C302219A10

  15. Comparison of Relative Bias, Precision, and Efficiency of Sampling Methods for Natural Enemies of Soybean Aphid (Hemiptera: Aphididae).

    Science.gov (United States)

    Bannerman, J A; Costamagna, A C; McCornack, B P; Ragsdale, D W

    2015-06-01

    Generalist natural enemies play an important role in controlling soybean aphid, Aphis glycines (Hemiptera: Aphididae), in North America. Several sampling methods are used to monitor natural enemy populations in soybean, but there has been little work investigating their relative bias, precision, and efficiency. We compare five sampling methods: quadrats, whole-plant counts, sweep-netting, walking transects, and yellow sticky cards to determine the most practical methods for sampling the three most prominent species, which included Harmonia axyridis (Pallas), Coccinella septempunctata L. (Coleoptera: Coccinellidae), and Orius insidiosus (Say) (Hemiptera: Anthocoridae). We show an important time by sampling method interaction indicated by diverging community similarities within and between sampling methods as the growing season progressed. Similarly, correlations between sampling methods for the three most abundant species over multiple time periods indicated differences in relative bias between sampling methods and suggests that bias is not consistent throughout the growing season, particularly for sticky cards and whole-plant samples. Furthermore, we show that sticky cards produce strongly biased capture rates relative to the other four sampling methods. Precision and efficiency differed between sampling methods and sticky cards produced the most precise (but highly biased) results for adult natural enemies, while walking transects and whole-plant counts were the most efficient methods for detecting coccinellids and O. insidiosus, respectively. Based on bias, precision, and efficiency considerations, the most practical sampling methods for monitoring in soybean include walking transects for coccinellid detection and whole-plant counts for detection of small predators like O. insidiosus. Sweep-netting and quadrat samples are also useful for some applications, when efficiency is not paramount. © The Authors 2015. Published by Oxford University Press on behalf of

  16. Triatoma ryckmani (Hemiptera: Reduviidae) in the epiphyte Tillandsia xerographica (Bromeliaceae) in the semiarid region of Guatemala.

    Science.gov (United States)

    Marroquín, Ricardo; Monroy, Carlota; Jaenson, Thomas G T

    2004-05-01

    For the first time, the reduviid bug Triatoma ryckmani Zeledón and Ponce (Hemiptera; Reduviidae) was recorded to inhabit the epiphyte Tillandsia xerographica Rohweder (Bromeliaceae) in the semiarid region of Guatemala. These bromeliads grow mainly in drought-resistant trees with rough bark such as Pereskia lychnidiflora (Cactaceae). In our study site, we investigated 30 T. xerographica, and 53 specimens of T. ryckmani were found. Most T. ryckmani (68.5%) were unfed. Ants (Formicidae) were the predominant (92.2%) insect taxon in T. xerographica. Other insects such as Blattidae (3.0%), Reduviidae (T. ryckmani: 2.5%), Blaberidae (2.2%), Gryllidae (0.1%), and Acrididae (0.1%) were recorded in the bromeliads. T. xerographica is illegally commercialized without previous inspection. This may cause accidental introduction of T. ryckmani to houses and to other countries.

  17. Milkweed (Gentianales: Apocynaceae): a farmscape resource for increasing parasitism of stink bugs (Hemiptera: Pentatomidae) and providing nectar to insect pollinators and monarch butterflies.

    Science.gov (United States)

    Tillman, P G; Carpenter, J E

    2014-04-01

    In peanut-cotton farmscapes in Georgia, the stink bugs Nezara viridula (L.) and Chinavia hilaris (Say) (Hemiptera: Pentatomidae) and the leaffooted bug, Leptoglossus phyllopus (L.) (Hemiptera: Coreidae), disperse at crop-to-crop interfaces to feed on bolls in cotton. The main objective of this study was to determine whether insecticide-free tropical milkweed (Asclepias curassavica L.), a nectar-producing plant, can increase parasitism of these bugs by Trichopoda pennipes (F.) (Diptera: Tachinidae) and provide nectar to monarch butterflies and insect pollinators in these farmscapes. Peanut-cotton plots with and without flowering milkweed plants were established in 2009 and 2010. Adult T. pennipes, monarch butterflies, honey bees, and native insect pollinators readily fed on floral nectar of milkweed. Monarch larvae feeding on milkweed vegetation successfully developed into pupae. In 2009, N. viridula was the primary host of T. pennipes in cotton, and parasitism of this pest by the parasitoid was significantly higher in milkweed cotton (61.6%) than in control cotton (13.3%). In 2010, parasitism of N. viridula, C. hilaris, and L. phyllopus by T. pennipes was significantly higher in milkweed cotton (24.0%) than in control cotton (1.1%). For both years of the study, these treatment differences were not owing to a response by the parasitoid to differences in host density, because density of hosts was not significantly different between treatments. In conclusion, incorporation of milkweed in peanut-cotton plots increased stink bug parasitism in cotton and provided nectar to insect pollinators and monarch butterflies.

  18. Efeito da cobertura vegetal sobre a pérola-da-terra (Hemiptera: Margarodidae na cultura da videira = Effect of cover crops on brazilian ground pearl (Hemiptera: Margarodidae in vineyards

    Directory of Open Access Journals (Sweden)

    Marcos Botton

    2010-10-01

    Full Text Available O uso da cobertura vegetal em vinhedos é uma prática empregada paraminimizar a erosão e melhorar as qualidades químicas e físicas do solo. Neste trabalho, foi avaliado o efeito de coberturas vegetais sobre a população da pérola-da-terra Eurhizococcus brasiliensis (Hemiptera: Margarodidae na cultura da videira. No primeiro experimento, o vinhedo foi mantido sem cobertura vegetal por meio da aplicação trimestral do herbicida glifosato comparado com o uso de vegetação espontânea, durante o ano, de vegetação espontânea, no verão, e de aveia preta no inverno. No segundo experimento foi avaliado o efeito da mucuna-preta (Stizolobium aterrimum cultivada no vinhedo durante o verão comparado com a vegetação espontânea. No primeiro experimento, a população da pérolada-terra nas raízes de plantas de videira foi maior em áreas mantidas sem cobertura vegetal emostrou-se semelhante em áreas onde se manteve a vegetação espontânea, ao longo do ano, e com aveia preta no inverno e vegetação espontânea no verão. A infestação das plantas de videira em áreas onde foi empregada a mucuna-preta durante o verão foi equivalente à da vegetação espontânea. S. aterrimum foi registrada pela primeira vez como hospedeira de E. brasiliensis. The use of cover crops is an important strategy to reduce erosion and improve chemical and physical soil properties. In this work, we evaluate the effect of cover crops to reduce Brazilian ground pearl Eurhizococcus brasiliensis (Hemiptera: Margarodidae infestation in vineyards. In the first experiment, glyphosate was sprayed each three months to avoid cover crops. This treatment was compared with naturally occurring vegetation during the year and the use of Avena sativa in the winter. In a second experiment, Stizolobium aterrimum was cultivated during the summer compared with naturally occurringvegetation. Brazilian ground pearl population was higher in glyphosate sprayed areas than where cover

  19. Hallazgo de Triatoma platensis Neiva, 1913 (Hemiptera, Triatominae en el estado brasileño de "Rio Grande do Sul" Finding of Triatoma platensis Neiva, 1913 (Hemiptera, Triatominae in the Brazilian State of "Rio Grande do Sul"

    Directory of Open Access Journals (Sweden)

    Roberto Salvatella

    1991-02-01

    Full Text Available Triatoma platensis Neiva 1913 (Hemiptera, Triatominae, especie ornitófila, con área de dispersión conocida en Argentina, Bolivia, Paraguay y Uruguay es notificada en un primer registro para Brasil. Hallada en el municipio de Uruguaiana (Río Grande do Sul en nidos de Anumbius annumbi (Vieillot, 1817 (Passeriformes, Furnariidae donde cohabitaba con cricétidos de la especie Orizomys flavescens. Ningún ejemplar de los siete colectados se presentó infectado por Trypanosoma cruzi.Triatoma platensis, an ornitophilic species, found in Argentina, Bolivia, Paraguay and Uruguay is reported for the first time in Brazil. It was found in the county of Uruguaiana (Rio Grande do Sul in nests of Anumbius annumbi (Vieillot, 1817 (Passeriformes, Furnariidae where it cohabited with cricetids belonging to the species Orizomys flavescens. None of the seven individuals collected were infected by Trypanosoma cruzi.

  20. Modeling and Control for Microgrids

    Science.gov (United States)

    Steenis, Joel

    Traditional approaches to modeling microgrids include the behavior of each inverter operating in a particular network configuration and at a particular operating point. Such models quickly become computationally intensive for large systems. Similarly, traditional approaches to control do not use advanced methodologies and suffer from poor performance and limited operating range. In this document a linear model is derived for an inverter connected to the Thevenin equivalent of a microgrid. This model is then compared to a nonlinear simulation model and analyzed using the open and closed loop systems in both the time and frequency domains. The modeling error is quantified with emphasis on its use for controller design purposes. Control design examples are given using a Glover McFarlane controller, gain scheduled Glover McFarlane controller, and bumpless transfer controller which are compared to the standard droop control approach. These examples serve as a guide to illustrate the use of multi-variable modeling techniques in the context of robust controller design and show that gain scheduled MIMO control techniques can extend the operating range of a microgrid. A hardware implementation is used to compare constant gain droop controllers with Glover McFarlane controllers and shows a clear advantage of the Glover McFarlane approach.

  1. Unaspis lansivora sp. n. (Hemiptera: Diaspididae), a new pest of Lansium domesticum (Meliaceae), and a key to Unaspis species.

    Science.gov (United States)

    Watson, Gillian W

    2015-01-13

    Since 2004, an undescribed species of Unaspis (Hemiptera: Diaspididae) has become a damaging pest on Lansium domesticum Corrêa in the Philippines. Its attack on the leaves causes premature senescence and defoliation, resulting in the production of few, underdeveloped, sour fruit and sometimes killing the trees. The scale was misidentified initially as Lepidosaphes ulmi (Linnaeus) and then as Unaspis citri (Comstock), but further study indicated that it was an undescribed species of potential plant quarantine significance. The pest is described as U. lansivora sp. n. and an identification key to all 19 species of Unaspis is provided. Its distribution, host range and prospects for its biological control are discussed.

  2. A new species of the genus Mahanarva Distant, 1909 (Hemiptera: Cercopoidea: Cercopidae, with a key to the species from Central America and Mexico

    Directory of Open Access Journals (Sweden)

    Ulises Castro–Valderrama

    2018-02-01

    Full Text Available The genus Mahanarva Distant, 1909 (Hemiptera: Cercopoidea: Cercopidae currently includes two subgenera: Mahanarva Distant, 1909 with 38 species and six subspecies, and Ipiranga Fennah, 1968 with nine species. The Manaharva species are all from the Americas, and a few species are important pests in pasture grasses and sugarcane. There are no reports of any Manaharva species from North America, including Mexico and areas to the north. Here, a new species is described from Mexico and a key to the species of Mahanarva from Central America and Mexico is proposed.

  3. First report of Lecanodiaspis dendrobii Douglas, 1892 (Hemiptera: Lecanodiaspididae and the associated parasitoid Cephaleta sp. (Hymenoptera: Pteromalidae in Brazil

    Directory of Open Access Journals (Sweden)

    A. L. Marsaro Júnior

    Full Text Available Abstract Lecanodiaspis dendrobii Douglas, 1892 (Hemiptera: Coccoidea: Lecanodiaspididae and the associated parasitoid Cephaleta sp. (Hymenoptera: Pteromalidae are reported for the first time in Brazil. Specimens of this scale insect were collected on branches and stems of Acacia mangium Willd., Leucaena leucocephala (Lam. de Wit (Fabaceae, Morus nigra L. (Moraceae, Citrus reticulata Blanco (Rutaceae, Tectona grandis L. f. (Verbenaceae, Anacardium occidentale (Anacardiaceae, Annona squamosa L. and Xylopia aromatica (Lam. Mart. (Annonaceae, in three municipalities of the Roraima state. All plants here mentioned are recorded for the first time as a host for L. dendrobii. Morphological characters of L. dendrobii and symptoms presented by the host plants infested by this pest are included in this work.

  4. First report of Lecanodiaspis dendrobii Douglas, 1892 (Hemiptera: Lecanodiaspididae) and the associated parasitoid Cephaleta sp. (Hymenoptera: Pteromalidae) in Brazil.

    Science.gov (United States)

    Marsaro Júnior, A L; Peronti, A L B G; Costa, V A; Morais, E G F; Pereira, P R V S

    2016-02-01

    Lecanodiaspis dendrobii Douglas, 1892 (Hemiptera: Coccoidea: Lecanodiaspididae) and the associated parasitoid Cephaleta sp. (Hymenoptera: Pteromalidae) are reported for the first time in Brazil. Specimens of this scale insect were collected on branches and stems of Acacia mangium Willd., Leucaena leucocephala (Lam.) de Wit (Fabaceae), Morus nigra L. (Moraceae), Citrus reticulata Blanco (Rutaceae), Tectona grandis L. f. (Verbenaceae), Anacardium occidentale (Anacardiaceae), Annona squamosa L. and Xylopia aromatica (Lam.) Mart. (Annonaceae), in three municipalities of the Roraima state. All plants here mentioned are recorded for the first time as a host for L. dendrobii. Morphological characters of L. dendrobii and symptoms presented by the host plants infested by this pest are included in this work.

  5. Effects Of Irradiation On Mealybug Dysmicoccus neobrevipes (Hemiptera: Pseudococcidae) Infesting On Dragon Fruits

    International Nuclear Information System (INIS)

    Doan Thi The; Nguyen Thuy Khanh; Vo Kim Lang; Cao Van Chung; Tran Thien An; Nguyen Hoang Hanh Thi

    2011-01-01

    Since 2008 APHIS/USDA approved to import dragon fruit into the United States from Vietnam if fruits are treated with the minimum absorbed dose of 400 Gy to control fruit flies and mealybugs. However, a lower dose could be accepted if released data is enough to demonstrate that it is efficient to inhibit the development and stop the reproduction of adult females for three species of mealybugs (Order: Hemiptera; Family: Pseudococcidae) infesting on dragon fruit. Four development stages including 1 st , 2 nd , 3 rd instars and adult of Dymicoccus neobrevipes by isolating and rearing in the laboratory conditions were irradiated in Co-60 source gamma with dosages of 100, 200, 300 and 400 Gy. The main purposes of the study are to find the most tolerant stage and to determine the most optimal dose to control D. neobrevipes. The initial obtained results showed that the adult stage is the most radiotolerant and the dose of 200 Gy could be an effective dose to inhibit development and to control reproduction of D. neobrevipes. (author)

  6. Effects of gamma irradiation on different stages of mealybug Dysmicoccus neobrevipes (Hemiptera: Pseudococcidae)

    Science.gov (United States)

    The, Doan Thi; Khanh, Nguyen Thuy; Lang, Vo Thi Kim; Van Chung, Cao; An, Tran Thi Thien; Thi, Nguyen Hoang Hanh

    2012-01-01

    Utilization of phytosanitary irradiation as a potential treatment to disinfest agricultural commodities in trade has expanded rapidly in the recent years. Cobalt-60 gamma ray target doses of 100, 150, 200 and 250 Gy were used to irradiate immatures and adults of Dysmicoccus neobrevipes (Beardsley) (Hemiptera: Pseudococcidae) infesting dragon fruits to find the most tolerant stage and the most optimal dose range for quarantine treatment. In general, irradiation affected significantly all life stages of D. neobrevipes mortality and adult reproduction. The pattern of tolerance to irradiation in D. neobrevipes was 1st instars<2nd instars<3rd instars

  7. The foraging behavior of Diaeretiella rapae (Hymenoptera: Braconidae on Diuraphis noxia (Hemiptera: Aphididae

    Directory of Open Access Journals (Sweden)

    Tazerouni Zahra

    2011-01-01

    Full Text Available Host stage preference, functional response and mutual interference of Diaeretiella rapae (McIntosh (Hymenoptera: Braconidae: Aphidiinae on Diuraphis noxia (Mordvilko (Hemiptera: Aphididae were investigated under defined laboratory conditions (20±1°C; 60±5% relative humidity; 16 h light/8 h dark photoperiod. Nicholson’s model and linear regression were used to determine per capita search-efficiency and the interference coefficient, respectively. There was a significant difference between the rates of parasitism on different stages of D. noxia. The highest parasitism percentage was observed on the third instar nymphs of D. noxia in both choice and no-choice preference tests. Results of logistic regression revealed a type II functional response. The estimated values of search-efficiency (a and handling time (Th were 0.072 h-1 and 0.723 h, respectively. The maximum attack rate was calculated to be 33.22. The per capita search-efficiency decreased from 0.011 to 0.004 (h-1 as parasitoid densities increased from 1 to 8. Therefore, different host-parasitoid ratios can affect the efficacy of D. rapae.

  8. Dose-response relationships of clothianidin, imidacloprid, and thiamethoxam to Blissus occiduus (Hemiptera: Blissidae).

    Science.gov (United States)

    Stamm, M D; Baxendale, F P; Heng-Moss, T M; Siegfried, B D; Blankenship, E E; Gaussoin, R E

    2011-02-01

    The western chinch bug, Blissus occiduus Barber (Hemiptera: Blissidae), has emerged as a serious pest of buffalograss, Buchlod dactyloides (Nuttall) Engelmann. In general, neonicotinoid insecticides effectively control a variety of turfgrass insects, particularly phloem-feeding pests. However, because of well documented inconsistencies in control, these compounds are generally not recommended for chinch bugs. This study was designed to document the contact and systemic toxicity of three neonicotinoid insecticides (clothianidin, imidacloprid, and thiamethoxam) to B. occiduus. In contact bioassays, thiamethoxam was approximately 20-fold less toxic than clothianidin or imidacloprid to B. occiduus nymphs and three-fold more toxic to adults. In adult systemic bioassays, thiamethoxam was up to five-fold more toxic than clothianidin or imidacloprid. Interestingly, thiamethoxam was significantly more toxic to adults than to nymphs in both contact and systemic bioassays. This was not observed with clothianidin or imidacloprid. Bifenthrin, used for comparative purposes, exhibited 1844-fold and 122-fold increase in toxicity to nymphs and adults, respectively. These results provide the first documentation of the relative toxicity of these neonicotinoid insecticides to B. occiduus.

  9. Morphometric comparisons of Diaphorina citri (Hemiptera: Liviidae) populations from Iran, USA and Pakistan.

    Science.gov (United States)

    Lashkari, Mohammadreza; Hentz, Matthew G; Boykin, Laura M

    2015-01-01

    The Asian citrus psyllid (ACP), Diaphorina citri Kuwayama (Hemiptera: Liviidae), vector of citrus greening disease pathogen, Huanglongbing (HLB), is considered the most serious pest of citrus in the world. Prior molecular based studies have hypothesized a link between the D. citri in Iran and the USA (Florida). The purpose of this study was to collect morphometric data from D. citri populations from Iran (mtCOI haplotype-1), Florida (mtCOI haplotype-1), and Pakistan (mtCOI haplotype-6), to determine whether different mtCOI haplotypes have a relationship to a specific morphometric variation. 240 samples from 6 ACP populations (Iran-Jiroft, Chabahar; Florida-Ft. Pierce, Palm Beach Gardens, Port St. Lucie; and Pakistan-Punjab) were collected for comparison. Measurements of 20 morphological characters were selected, measured and analysed using ANOVA and MANOVA. The results indicate differences among the 6 ACP populations (Wilks' lambda = 0.0376, F = 7.29, P citri species in this study, (1) Iran, (2) USA (Florida) and (3) Pakistan population. Morphometric comparisons provided further resolution to the mtCOI haplotypes and distinguished the Florida and Iranian populations.

  10. Biology and bionomics of dysdercus koenigii f. (hemiptera: pyrrhocoridae) under laboratory conditions

    International Nuclear Information System (INIS)

    Jaleel, W.; Naqqash, M.N.

    2013-01-01

    Red Cotton Bug, Dysdercus koenigii F., (Hemiptera: Pyrrhocoridae) is an important pest of cotton in South East Asia. Studies were carried out during 2012 to find the effect of temperature on incubation period and to explore the reproductive biology and bionomics of D. koenigii under laboratory conditions. Minimum incubation period (4.70+-0.42 days) was recorded at 35 degree C while the eggs failed to hatch at 40 degree C at 70-75% relative humidity. There were five nymphal instars which completed their development in 23.42+-2.49 days. The female lived longer (20.85+-6.12 days) than the male (16.18+-6.06 days). Each female mated three times in her life and there was statistically significant difference in mating duration (days), number of eggs laid and hatching percentage in each mating time. Number of eggs and hatching percentage was significantly higher after 1st time mating followed by 2nd and 3rd time matings. Duration of pre-oviposition, oviposition and post oviposition period recorded was 7.47+-0.86, 12.43+-0.82 and 8.77+-2.41 days, respectively. The study will help in devising pest management strategy against D. koenigii. (author)

  11. Phenotypic variation and identification of Phenacoccus solenopsis Tinsley (Hemiptera: Pseudococcidae) in China.

    Science.gov (United States)

    Zhao, Jing; Watson, Gillian W; Sun, Yang; Tan, Yongan; Xiao, Liubin; Bai, Lixin

    2014-05-23

    Phenacoccus solenopsis Tinsley (Hemiptera: Pseudococcidae) is an invasive mealybug that seriously damages cotton and other important crops. In previous studies in China, the presence of two submedian longitudinal lines of pigmented spots on the dorsum of adult females frequently has been used to identify this species. However, the present study records the occasional absence of pigmented spots in a sample from Guangxi province, China. Specimens without pigmented spots showed all the molecular and morphological characters that separate P. solenopsis from the similar species P. solani Ferris, especially the distribution of multilocular disc pores. In different geographic populations of P. solenopsis in China, mitochondrial COI and nuclear 28SrDNA genes are very similar (99.8-100%), indicating that they are conspecific. For COI, the genetic distance between P. solenopsis and P. solani is more than 3%. A map of the distribution of P. solenopsis in China is given. To help identify both pigmented and non-pigmented P. solenopsis accurately, an identification key to the 16 species of Phenacoccus found in China is provided. The key also identifies five potentially invasive Phenacoccus species not yet established in China, in case they get introduced there.

  12. A new mealybug in the genus Pseudococcus Westwood (Hemiptera: Coccomorpha: Pseudococcidae) from North America, with a key to species of Pseudococcus from the New World.

    Science.gov (United States)

    Ellenrieder, Natalia Von; Watson, Gillian

    2016-04-19

    A mealybug species that feeds on Agave spp., Pseudococcus variabilis sp. n. (Hemiptera: Coccomorpha: Pseudococcidae), is described from North America. Its entry into the United States was likely via the horticultural trade on its host plants in the genus Agave (Liliales: Agavaceae). Descriptions and illustrations of the adult female and male, diagnosis from congeners in the New World, and a molecular characterization based on COI are provided, as well as a key to adult females of all Pseudococcus species recorded from the New World.

  13. Duração do período ninfal e sobrevivência do predador Podisus connexivus Bergroth (Hemiptera, Pentatomidae, em três presas alternativas Ninfal period duration and survival of the predator Podisus connexivus Bergroth (Hemiptera, Pentatomidae, in three alternative preys

    Directory of Open Access Journals (Sweden)

    José Cola Zanuncio

    1993-01-01

    Full Text Available Longevity and survival of the predator Podisus connexivus (Hemiptera: Pentatomidae were studied in three alternative preys: T1 - Bombyx mori (Lepidoptera, Bombycidae catterpilars; T2 - Musca domestica (Diptera, Muscidae larva and T3 - Tenebrio molitor (Coleoptera, Tenebrionidae larva. Longevity and survival were: 22,1±0,6 days and 54,3±5,3%; 25,2±1,3 days and 56,0±4,9% and 22,0±0,8 days and 34,6±8,6%, for treatments T1, T2 and T3, respectively. Comparing to other researches, a lower survival was found. This is probably because a F2 generation from field material, was used. Since the insect was not well adapted to the laboratory conditions this could have led to lower survival.

  14. A preliminary molecular phylogeny of planthoppers (Hemiptera: Fulgoroidea based on nuclear and mitochondrial DNA sequences.

    Directory of Open Access Journals (Sweden)

    Nan Song

    Full Text Available The planthopper superfamily Fulgoroidea (Insecta: Hemiptera is one of the most dominant groups of phytophagous insects. It comprises about 20 families, containing a total of 9000 species worldwide. Despite several recent studies, the phylogeny of Fulgoroidea is not yet satisfactorily resolved and the phylogenetic positions of several key families, especially Cixiidae, Delphacidae, Tettigometridae, Nogodinidae, Acanaloniidae and Issidae, are contentious. Here, we expand upon recent phylogenetic work using additional nuclear (18S and 28S and novel mitochondrial (16S and cytb markers. Maximum likelihood and Bayesian analyses yielded robust phylogenetic trees. In these topologies, a group containing Cixiidae and Delphacidae is recovered as the sister group to the remaining taxa. Tettigometridae is placed in a more nested position and is grouped with Caliscelidae. Sister relationships are found between Flatidae and Ricaniidae, and between Dictyopharidae and Fulgoridae. Nogodinidae and Issidae are confirmed to be non-monophyletic families. For major nodes of interest, divergence date estimates are generally older than those from the fossil record.

  15. Phytoreovirus-like sequences isolated from salivary glands of the glassy-winged sharpshooter Homolodisca vitripennis (Hemiptera: Cicadellidae)

    International Nuclear Information System (INIS)

    Katsar, C.S.; Hunter, W.B.; Sinisterra, X.H.

    2007-01-01

    The salivary glands of the Glassy-winged sharpshooter (GWSS), Homalodisca vitripennis Germar 1821, (syn. H. coagulata, Hemiptera: Cicadellidae) were collected and used to produce a cDNA library. Examination by BLASTX analyses identified 2 viral sequences, one a 610-base pair fragment and a second 839-base pair fragment, both of which had significant homology to viruses within the genus Phytoreovirus. Resequencing of the fragments confirmed sequence validities. These sequences were used for in silico protein translation and BLASTP analysis confirming the established homology. While the GWSS is the primary vector of Pierce's disease of grapes, this is the first report that GWSS may be a vector of a phytoreoviruses. Phylogenetic and homology comparisons with BLASTX, BLASTP, and PAUP analyses indicated that the viral sequences isolated from GWSS were closely related to the viruses in the Family Reoviridae, Genus Phytoreovirus, specifically Rice Dwarf Phytoreovirus (RDV). RDV is the only plant reovirus that is not limited to the phloem. Phytoreoviruses are transmitted in a propagative manner by cicadellid leafhoppers (Hemiptera: Cicadellidae), which acquire and transmit them during feeding. Phytoreoviruses have been reported from Agallian, Agalliopsis, Nephotettix, and Recilia, genera of leafhoppers, with evidence for transovarial transmission. The GWSS, although considered to feed primarily from the xylem, ingests from other plant tissues, such as the phloem and mesophyll during probing similar to other leafhoppers. The feeding behavior and wide host range of the GWSS provides an overlapping condition for these two organisms, leafhopper and virus. GWSS will feed from grasses as a transitory host, and on herbaceous and woody plants as primary hosts, which may favor the acquisition and transmission of Phytoreovirus by this leafhopper. Monitoring for an increase of Phytoreovirus spread in graminaceous crops that are in proximity to vineyards or tree crop orchards, where

  16. REPRODUÇÃO DE Edessa meditabunda (HEMIPTERA: PENTATOMIDAE EM ALGODOEIRO

    Directory of Open Access Journals (Sweden)

    Rosalia Azambuja

    2015-05-01

    Full Text Available O percevejo-asa-preta-da-soja Edessa meditabunda (Fabricius (Hemiptera: Pentatomidae no final do ciclo da soja dispersa para algodoeiro e utiliza essa planta como hospedeiro alternativo. Visando conhecer o potencial desta espécie como praga em algodoais e auxiliar na tomada decisão quanto ao manejo deste inseto, hipotetizou-se nesse trabalho que o algodoeiro é nutricionalmente adequado para a reprodução e desenvolvimento de E. meditabunda. Os tratamentos testados foram: 1 folhas e maçã de algodoeiro e 2 dieta padrão, recomendada para criação de pentatomídeos fitófagos em laboratório, utilizada como testemunha. As características biológicas avaliadas foram: período de desenvolvimento ninfal, duração de cada ínstar, porcentagem de sobrevivência, peso dos adultos na emergência, longevidade de machos e de fêmeas, período de pré-oviposição e de oviposição, número total de ovos por fêmea e fecundidade das fêmeas. Observou-se que, apesar do prolongamento do período de desenvolvimento ninfal, as ninfas alimentadas com algodoeiro sobreviveram, atingiram a fase adulta e os adultos se reproduziram, o que nos permite sugerir que o algodoeiro seja uma planta nutricionalmente adequada para o desenvolvimento e reprodução de E. meditabunda, permitindo a manutenção do inseto em campo após a colheita da soja.  RESUMO El chinche Edessa meditabunda (Fabricius (Hemiptera: Pentatomidae al final del ciclo de la soja emigra al cultivo de algodón y utiliza esta planta como un huésped alternativo. Con el objetivo de conocer el potencial de esta especie como una plaga en los algodonales y ayudar en la toma de decisiones con respecto al manejo de este insecto, se planteó la hipótesis en este estudio que el algodón y nutritiva, adecuada para la reproducción y el desarrollo de E. meditabunda. Los tratamientos fueron:1 las hojas y el fruto del algodón 2 dieta estándar recomendada para la cría de pentatomidos fitófagos en el

  17. DAMPAK APLIKASI INSEKTISIDA PERMETRIN TERHADAP HAMA PENGISAP BIJAIJ HELOPELTIS SPP. (HEMIPTERA: MIRIDAE DAN ARTROPODA NON-TARGET PADA PERTANAMAN KAKAO (THEOBROMA CACAO L.

    Directory of Open Access Journals (Sweden)

    Rosma Hasibuan

    2014-08-01

    Full Text Available Impact of Permethrin-Insecticide Application on Mirid Pest of Cocoa Helopeltis spp. (Hemiptera: Miridae and on Non-target  Arthropods in Cocoa Plantations (Theobroma cacao L.. Cocoa mirid bugs, Helopeltis spp., (Hemiptera: Miridae are the most important pest of cocoa in Indonesia. A field study was conducted to investigate the effect of permethrin on cocoa mirids and non-target arthropods at a cocoa plantation in specific place. A randomized complete block design was used in which each of four blocks consisted of 5 treatments (4 concentrations of permethrin; 50; 100; 200; and 250 ppm and control. The results indicated that the application of permethrin significantly increased the cocoa mirids mortaliiy throughout all sprayed cocoa trees (up to 100% 72 h after application. Even at 1 h after application, the percentage of Cocoa mirids mortality 29.2% - 53.9% on cocoa trees sprayed with permethrin at concentrations of 50 - 250 ppm was significantly higher than that on control plant (3.6%. At 72 h after treatments, application of permethrin at concentrations of 200 and 250 ppm caused a complete kill (mortalty of 100% in the test mirids. Meanwhile, ground cloths caught at least 22 fanilies of abore-ground arthropods that were found killed by permethrin applications. Moreover, the number of non-target arthropods killed by permethrin at concentrations of 100 - 250 ppm (27.3 - 85.3 individuals/ground cloth were signifcantly higher than that on control trees. These results demonstrated that despite high efficacy of permethrin in controlling of cocoa mirids (Hetopeltis spp., its application also had adverse effects on non-target arthropods incocoa plantations.

  18. Determinación de la capacidad de transmisión de fitoplasmas en dos morfoespecies de la familia Cicadellidae (Hemiptera: Auchenorryncha) de Bogotá D.C.

    OpenAIRE

    Perilla Henao, Laura Margarita

    2013-01-01

    Los fitoplasmas son bacterias fitopatógenas que carecen de pared celular, especializadas en la colonización intracelular del floema de plantas, son transmitidos por insectos vectores del suborden Auchenorryncha (Hemiptera) y están entre los seres vivos con menor tamaño. Los fitoplasmas forman un grupo monofilético en la clase Mollicutes que causan alteraciones morfológicas y fisiológicas en plantas ornamentales, hortícolas, maderables, frutales y cultivos en todo el mundo. No existen métodos...

  19. Differential Life History Trait Associations of Aphids with Nonpersistent Viruses in Cucurbits.

    Science.gov (United States)

    Angelella, G M; Egel, D S; Holland, J D; Nemacheck, J A; Williams, C E; Kaplan, I

    2015-06-01

    The diversity of vectors and fleeting nature of virus acquisition and transmission renders nonpersistent viruses a challenge to manage. We assessed the importance of noncolonizing versus colonizing vectors with a 2-yr survey of aphids and nonpersistent viruses on commercial pumpkin farms. We quantified aphid alightment using pan traps, while testing leaf samples with multiplex RT-PCR targeting cucumber mosaic virus (CMV), zucchini yellow mosaic virus (ZYMV), watermelon mosaic virus (WMV), and papaya ringspot virus (PRSV). Overall, we identified 53 aphid species (3,899 individuals), from which the melon aphid, Aphis gossypii Glover, a pumpkin-colonizing species, predominated (76 and 37% of samples in 2010 and 2011, respectively). CMV and ZYMV were not detected, but WMV and PRSV were prevalent, both regionally (WMV: 28/29 fields, PRSV: 21/29 fields) and within fields (infection rates = 69 and 55% for WMV in 2010 and 2011; 28 and 25% for PRSV in 2010 and 2011). However, early-season samples showed extremely low infection levels, suggesting cucurbit viruses are not seed-transmitted and implicating aphid activity as a causal factor driving virus spread. Interestingly, neither noncolonizer and colonizer alightment nor total aphid alightment were good predictors of virus presence, but community analyses revealed species-specific relationships. For example, cowpea aphid (Aphis craccivora Koch) and spotted alfalfa aphid (Therioaphis trifolii Monell f. maculata) were associated with PRSV infection, whereas the oleander aphid (Aphis nerii Bover de Fonscolombe) was associated with WMV spread within fields. These outcomes highlight the need for tailored management plans targeting key vectors of nonpersistent viruses in agricultural systems. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  20. Weed hosts of cotton mealybug, Phenacoccus solenopsis Tinsley (Hemiptera: Pseudococcidae).

    Science.gov (United States)

    Vennila, S; Prasad, Y G; Prabhakar, M; Agarwal, Meenu; Sreedevi, G; Bambawale, O M

    2013-03-01

    The exotic cotton mealybug, Phenacoccus solenopsis Tinsley (Hemiptera: Pseudococcidae) invaded India during 2006, and caused widespread infestation across all nine cotton growing states. P. solenopsis also infested weeds that aided its faster spread and increased severity across cotton fields. Two year survey carried out to document host plants of P. solenopsis between 2008 and 2010 revealed 27, 83, 59 and 108 weeds belonging to 8, 18, 10 and 32 families serving as alternate hosts at North, Central, South and All India cotton growing zones, respectively. Plant species of four families viz., Asteraceae, Amaranthaceae, Malvaceae and Lamiaceae constituted almost 50% of the weed hosts. While 39 weed species supported P. solenopsis multiplication during the cotton season, 37 were hosts during off season. Higher number of weeds as off season hosts (17) outnumbering cotton season (13) at Central over other zones indicated the strong carryover of the pest aided by weeds between two cotton seasons. Six, two and seven weed hosts had the extreme severity of Grade 4 during cotton, off and cotton + off seasons, respectively. Higher number of weed hosts of P. solenopsis were located at roadside: South (12) > Central (8) > North (3) zones. Commonality of weed hosts was higher between C+S zones, while no weed host was common between N+S zones. Paper furnishes the wide range of weed hosts of P. solenopsis, discusses their significance, and formulated general and specific cultural management strategies for nationwide implementation to prevent its outbreaks.

  1. How will Mahanarva spectabilis (Hemiptera: Cercopidae) Respond to Global Warming?

    Science.gov (United States)

    Fonseca, M G; Auad, A M; Resende, T T; Hott, M C; Borges, C A V

    2016-01-01

    The aim of this study was to determine the favorable constant temperature range for Mahanarva spectabilis(Distant) (Hemiptera: Cercopidae) development as well as to generate geographic distribution maps of this insect pest for future climate scenarios. M. spectabilis eggs were reared on two host plants (Brachiaria ruziziensis(Germain and Edvard) and Pennisetum purpureum(Schumach)), with individual plants kept at temperatures of 16, 20, 24, 28, and 32 °C. Nymphal stage duration, nymphal survival, adult longevity, and egg production were recorded for each temperature*host plant combination. Using the favorable temperature ranges for M. spectabilis development, it was possible to generate geographic distribution. Nymphal survival was highest at 24.4 °C, with estimates of 44 and 8% on Pennisetum and Brachiaria, respectively. Nymphal stage duration was greater on Brachiaria than on Pennisetum at 20 and 24 °C but equal at 28 °C. Egg production was higher on Pennisetum at 24 and 28 °C than at 20 °C, and adult longevity on Pennisetum was higher at 28 °C than at 20 °C, whereas adult longevity at 24 °C did not differ from that at 20 and 28 °C. With these results, it was possible to predict a reduction in M. spectabilis densities in most regions of Brazil in future climate scenarios. © The Author 2016. Published by Oxford University Press on behalf of the Entomological Society of America.

  2. Ecotope effect in Triatoma brasiliensis (Hemiptera: Reduviidae) suggests phenotypic plasticity rather than adaptation.

    Science.gov (United States)

    Batista, V S P; Fernandes, F A; Cordeiro-Estrela, P; Sarquis, O; Lima, M M

    2013-09-01

    Triatoma brasiliensis (Hemiptera: Reduviidae) is an important vector of Chagas' disease in both sylvatic and peridomestic ecotopes. Discriminating between these populations of Triatominae has been proposed as a means of investigating re-infestation rates of human dwellings. Geometric morphometrics have been widely applied in the study of Triatominae polymorphisms at species and population levels. This study characterizes morphometric differences between sylvatic and peridomestic populations, as well as between sexes in T. brasiliensis specimens from Jaguaruana, Ceará, in northeastern Brazil. No differences in either the shape or size of the cephalic capsule were apparent between sexes or ecotopes. However, the wings showed differentiation in shape and size. Sexual dimorphism was detected, with females presenting significantly higher values and conformations. Size differentiation was also evident, with sylvatic specimens being generally larger than peridomestic examples. These results indicate that differences in the wings of T. brasiliensis may be related to the existence of phenotypic plasticity, and variations in size and shape may be associated with different ecotopes, possibly as a result of conditions in each micro-habitat, such as temperature, relative humidity, food supply and density. © 2012 The Royal Entomological Society.

  3. First record of Pulvinaria urbicola Cockerell (Hemiptera: Coccidae) from India, with a key to the Indian species of Pulvinaria Targioni Tozzetti.

    Science.gov (United States)

    Joshi, Sunil

    2017-02-23

    The notoriously destructive and invasive soft scale, Pulvinaria urbicola Cockerell (Hemiptera: Coccidae), is recorded for the first time from India. This scale, with variable morphological appearance and similarities with other known scales of the same genus established in India, is redescribed to facilitate its identification and separation from other similar species. Information on its host range, natural enemies and distribution is provided. Management options in the event of an outbreak are discussed briefly. A key to the species of Pulvinaria Targioni Tozzetti in India is also provided. This new arrival warrants special attention in India as it is a potentially damaging plant pest and has a broad host range across many plant families.

  4. New data on polymorphism of the meadow spittlebug Philaenus spumarius (L.) (Hemiptera: Aphrophoridae) from the island of São Miguel (Azores).

    Science.gov (United States)

    Borges, Paulo A V; Rodrigues, Ana S B; Silva, Sara E; Seabra, Sofia G; Paulo, OctÁvio S; Quartau, JosÉ A

    2018-01-02

    The meadow spittlebug, Philaenus spumarius (L.) (Hemiptera, Aphrophoridae) is a widespread insect species in the Holarctic region, exhibiting a dorsal colour balanced polymorphism. In the Azores the species is known from high elevations in Terceira and São Miguel islands. A sample of 235 individuals from Pico da Vara and Graminhais protected areas (São Miguel, Azores) (between 645 and 935 m a.s.l.), collected in 2000 and 2017, showed a remarkable high frequency of the melanic morphs flavicollis (FLA) and quadrimaculatus (QUA). In addition, a high frequency of melanics was observed in males. We explore the hypotheses for the origin of Azorean colonization and for the high proportion of melanism in the Azorean populations.

  5. Atividade de buprofezin sobre a cigarrinha verde do feijoeiro Empoasca kraemeri (Ross & Moore, 1957) (Hemiptera, Cicadellidae) em condições de laboratório

    OpenAIRE

    Moreno,Paulo Rogério; Nakano,Octávio

    2002-01-01

    A espécie Empoasca kraemeri é uma importante praga para a cultura do feijoeiro (Phaseolus vulgaris L.) em toda a América Latina, sendo necessário recorrer ao controle químico quando a praga atinge alta população. Neste trabalho, foi estudado o efeito do inseticida buprofezin sobre ninfas de primeiro instar de Empoasca kraemeri (Hemiptera, Cicadellidae), sob condições de laboratório. Esta fase da praga mostrou-se altamente susceptível ao inseticida, sendo a CL50 estimada de 0,112 mg L-1. Em ou...

  6. Life History of the Camelthorn Gall Leafhopper, Scenergates viridis (Vilbaste (Hemiptera, Cicadellidae

    Directory of Open Access Journals (Sweden)

    Roman Rakitov

    2012-01-01

    Full Text Available The world’s only member of Hemiptera Auchenorrhyncha known to form true galls, the leafhopper Scenergates viridis (Vilbaste (Cicadellidae, transforms leaves of camelthorn (Alhagi maurorum Medikus, Fabaceae into pod-like chambers, up to 35 mm long, inside which individual leafhoppers develop, mate, and lay eggs. At the study site 40 km SE of Bukhara (Uzbekistan, two generations develop annually. First-instar nymphs cause young leaves to fold along the midrib. The subsequent development takes place inside the tightly closed growing gall, plugged at both ends with a mixture of leafhopper excrement, brochosomes, and crushed exuviae. These plugs act as mechanical barriers and sticky traps for intruders. The inner surface of the gall, lined with brochosomes and wax platelets, is hydrophobic. Adult males emerge from their galls and squeeze into female galls. Fertilized females insert an average of 146 eggs under the gall’s inner epidermis and remain inside, possibly protecting the brood, until they die. The walls of the galls containing eggs are approximately three times thicker than regular leaves. The galls are subject to predation by Gelechiidae caterpillars; the eggs of the leafhopper are parasitized by two species of Trichogrammatidae and one Mymaridae (Hymenoptera, and its larvae by one species of Pipunculidae (Diptera.

  7. Efeitos da temperatura e do alimento no desenvolvimento de Dysdercus maurus Distant (Hemiptera, Pyrrhocoridae Effects of temperature and food on the development of Dysdercus maurus Distant (Hemiptera, Pyrrhocoridae

    Directory of Open Access Journals (Sweden)

    Fábio Souto Almeida

    2007-12-01

    Full Text Available Dysdercus maurus Distant, 1901 (Hemiptera, Pyrrhocoridae é uma importante praga de Gossypium spp. (algodoeiro, Citrus Sinensis Osbeck (Rutaceae (laranjeira e Citrus reticulata (Rutaceae (tangerineira, além de sementes de Chorisia speciosa St. Hil. (paineira. Este trabalho objetivou avaliar os efeitos da temperatura e do alimento no desenvolvimento de D. maurus. Foram realizados oito tratamentos, seis em que os percevejos foram alimentados com sementes de paineira e mantidos a 15, 18, 20, 25 e 30 ± 1ºC, UR 80 ± 3% e fotofase de 12 h ou em condições ambientais de laboratório (23,5 ± 2,6ºC, UR 73,3 ± 9,9 %, e dois em que foram alimentados com sementes de algodão variedade IAC-22 e mantidos a 25 e 30ºC. Em todos os tratamentos foram observados cinco estágios imaturos. O aumento da temperatura proporcionou diminuição do tempo de desenvolvimento. A temperatura de 15ºC foi letal para ovos e ninfas de D. maurus. A menor mortalidade de ninfas ocorreu quando os percevejos foram alimentados com sementes de algodão a 25ºC (24,07%. A menor temperatura base (Tb foi obtida para o 1º ínstar (11,54ºC e a maior para o 2º ínstar (15,33ºC. As fêmeas de D. maurus necessitam de maior quantidade de graus-dias (329,93 graus-dias que os machos (300,49 graus-dias para atingir o estádio adulto.Dysdercus maurus Distant, 1901 (Hemiptera, Pyrrhocoridae is an important pest on Gossypium spp. (cotton tree, Citrus sinensis Osbeck (Rutaceae and Citrus reticulata Blanco (Rutaceae crops. This insect also feeds on seeds of Chorisia speciosa St. Hil. (Bombacaceae. This work aimed to evaluate the effects of temperature and food on the development of D. maurus. Eight treatments were carried out, in six of them bugs were fed with seeds of C. speciosa and kept at 15, 18, 20, 25 and 30 ± 1ºC, 80 ± 3% RH and 12h photophase or in laboratory conditions (23.5 ± 2.6ºC, 73.3 ± 9.9 % RH, and in the other two treatments bugs were fed with seeds of cotton variety

  8. Descriptions of the immature stages and new host plant records of Notozulia entreriana (Berg) (Hemiptera: Cercopidae) pests of grasses in subtropical areas of the Americas.

    Science.gov (United States)

    Foieri, Alvaro; Lenicov, Ana M Marino De Remes; Virla, Eduardo G

    2016-04-11

    Notozulia entreriana (Berg) (Hemiptera: Cercopidae) is one of the most common spittlebugs inhabiting the subtropical region of the America, inflicting important economic damage to grass crops. The immature stages are described and illustrated; the main characteristics that distinguish instars are the body size, color, number of flagellomeres, and number of tibial and metatarsomere spines. A key for identification of nymphs is provided as a tool to develop field studies.  Nine host plants, all belonging to Poaceae, are recorded as breeding and feeding host plants from different localities in northern Argentina.

  9. The impact of some environmental factors on the fecundity of phenacoccus solenopsis tinsley (hemiptera: pseudococcidae): a serious pest of cotton and other crops

    International Nuclear Information System (INIS)

    Abbas, G.; Arif, M.J.; Aslam, M.

    2010-01-01

    Phenacoccus solenopsis Tinsley (Hemiptera: Sternorrhyncha: Pseudococcidae) was first recorded on cultivated cotton from Texas, USA in 1991. Since 2005, this New World species has emerged as serious pest of cotton in Pakistan and India, and is now a serious threat to cotton in China and other cotton-growing countries worldwide. The species is polyphagous and invasive, and can attack many other economic crops. So far, it has been reported from 173 species in 54 plant families, and from 26 countries in different ecological zones. The study found that host plant species and meteorological conditions had significant effects, whereas locality had no significant effect on the fecundity of the mealybug. (author)

  10. Seasonal phenology, spatial distribution, and sampling plan for the invasive mealybug Phenacoccus peruvianus (Hemiptera: Pseudococcidae).

    Science.gov (United States)

    Beltrá, A; Garcia-Marí, F; Soto, A

    2013-06-01

    Phlenacoccus peruvianus Granara de Willink (Hemiptera: Pseudococcidae) is an invasive mealybug of Neotropical origin. In recent years it has invaded the Mediterranean Basin causing significant damages in bougainvillea and other ornamental plants. This article examines its phenology, location on the plant and spatial distribution, and presents a sampling plan to determine P. peruvianus population density for the management of this mealybug in southern Europe. Six urban green spaces with bougainvillea plants were periodically surveyed between March 2008 and September 2010 in eastern Spain, sampling bracts, leaves, and twigs. Our results show that P. peruvianus abundance was high in spring and summer, declining to almost undetectable levels in autumn and winter. The mealybugs showed a preference for settling on bracts and there were no significant migrations between plant organs. P. peruvianus showed a highly aggregated distribution on bracts, leaves, and twigs. We recommend abinomial sampling of 200 leaves and an action threshold of 55% infested leaves for integrated pest management purposes on urban landscapes and enumerative sampling for ornamental nursery management and additional biological studies.

  11. Impact of insecticides on non-target arthropods in watermelon cropImpacto de inseticidas em artrópodes não-alvo associados à cultura da melancia

    Directory of Open Access Journals (Sweden)

    Cíntia Ribeiro Souza

    2012-10-01

    Full Text Available Watermelon Citrullus lunatus (Thunberg, Matsumura & Nakai is an ecosystem having a variety of arthropods, each one playing a specific role. Although some of them are considered pest to crops, some others are responsible for soil aeration, nutrient release and predation of pest species and are, therefore, considered beneficial to crops. The intensive farming practiced for watermelon cultivation in Brazil is based on the use of tiamethoxam and deltamethrin, which may not only kill target but also nontarget organisms such as beneficial arthropods. Research data regarding the influence of insecticides on arthropods in watermelon cropping is scarce. This study aimed to evaluate the effect of the insecticides deltamethrin and thiamethoxam on soil surface and watermelon canopy arthropod community. The study was carried out in the State of Tocantins, Brazil. Although the application of thiamethoxam and deltamethrin was efficient in controlling populations of Aphis gossypii (Glover, as we expected, they negatively affected non-target arthropods such as detritivores insects in the canopy and soil surface. Ecological implications of the impact of such pesticides on beneficial arthropod species are discussed.A cultura da melancia Citrullus lunatus (Thunberg, Matsumura & Nakai abriga uma grande diversidade de artrópodes, cada um desempenhando um papel específico. Apesar de alguns desses artrópodes serem considerados pragas, outros são responsáveis pela aeração do solo, liberação de nutrientes e predação das espécies-praga, sendo, dessa forma, considerados benéficos às culturas. A agricultura intensiva praticada no Brasil para o cultivo da melancia é baseada no uso dos inseticidas como tiamethoxam e deltametrina, que pode não só matar as pragas, mas também organismos não-alvo. Pesquisas relacionadas à influência de inseticidas sobre artrópodes benéficos na cultura da melancia são escassas. Este estudo foi realizado com o objetivo de

  12. Identification of a sex pheromone of the chrysanthemum lace bug Corythucha marmorata (Hemiptera: Tingidae).

    Science.gov (United States)

    Watanabe, Kisaki; Shimizu, Nobuhiro

    2017-08-04

    Although the nymphs of Corythucha marmorata form clusters on the undersides of host plant leaves, as frequently observed for Hemiptera, the adults are scattered in the vicinity of the nymph population. By investigating the biological activities of volatile secretions from the adult, we found that the secretions activated male mounting behaviour. A chemical analysis revealed that borneol was a common component of the secretions from both sexes. The absolute configuration of the natural product was the (+)-enantiomer of borneol and the optical isomer was undetectable. Although (+)-borneol showed significant sex pheromone activity against males, the antipode (-)-borneol also induced sex pheromone activity, albeit only slightly. Males may not have a strict identification mechanism based on stereochemistry. To verify the origin of this sex pheromone, we analysed the components of the essential oil of the leaves of Solidago canadensis L. (Compositae: Asteraceae), a host plant; bornyl acetate was detected to be a major component. The plant-produced bornyl acetate had different stereochemistry from the sex pheromone. The results suggested that the adults do not utilise the secondary metabolites of plants but biosynthesise this sex pheromone themselves. This is the first report on sex pheromone identification in Tingidae.

  13. KEBERADAAN DYSMICOCCUS BREVIPES (COCKERELL (HEMIPTERA: PSEUDOCOCCIDAE SEBAGAI VEKTOR PINEAPPLE MEALYBUG WILT-ASSOCIATED VIRUS (PMWAV PADA TANAMAN NANAS

    Directory of Open Access Journals (Sweden)

    Dewi Sartiami

    2006-04-01

    Full Text Available Mealybug can almost be found in all pineapple fields (Ananas comosus (Linnaeus. The insect is known to be a vector of Pineapple Mealybug wilt-associated Virus (PMWaV. The insect samples taken from pineapple in Bunihayu, Jalancagak, Subang, West Java, were identified in laboratory. Mealybug-ant symbionts were also taken. The ability of this ant to carry the mealybugs from colony reared on kabocha (Cucurbita maxima to pineapple was also tested at green house level. Only one spesies of mealybug was found on pineapple, i.e. Dysmicoccus brevipes (Cockerell (Hemiptera: Pseudococcidae. The mealybugs were found to colonize root, basal of stem and the leaf. Eight ant species were found to be associated with mealybug. There are four species belongs to Pseudolasius genera, two species Cardiocondyla genera, Paratrechina sp. and Dorylus sp. Paratrechina sp. showed the ability to carry D. brevipes from kabocha population to pineapple. Therefore the ants should also be controlled in the total management of PMWav.

  14. Identification guide to Nordic aphids associated with mosses, horsetails and ferns (Bryophyta, Equisetophyta, Polypodiophyta (Insecta, Hemiptera, Aphidoidea

    Directory of Open Access Journals (Sweden)

    Anders Christian Albrecht

    2015-10-01

    Full Text Available Keys and diagnoses of North European aphids (Hemiptera, Aphidoidea associated with mosses, horsetails and ferns are given, based on fresh and freeze-dried material. Numerous externally visible and thus informative characters, that are absent in cleared, slide-mounted specimens, such as body shape colours, wax coating and pattern etc., are utilized. Most of the species are illustrated by photographs of live specimens and drawings. Root-feeding species living in the moss layer or otherwise often present in moss samples are also included, even if their hosts were spermatophytes. The combination of colour images and diagnoses, utilizing easily observed characters, allows the identification of a large number of species already in the field, and many more at home with the aid of a stereo microscope. Host plant relationships and association with ants are summarised, including new records. Brief accounts on aphid life cycles, freeze-drying preparation techniques, etc. are also given to support the use of the keys.

  15. Factors affecting water strider (Hemiptera: Gerridae) mercury concentrations in lotic systems

    Energy Technology Data Exchange (ETDEWEB)

    Jardine, T.D.; Kidd, K.A.; Cunjak, R.A.; Arp, P.A. [University of New Brunswick, St John, NB (Canada). Canadian Rivers Institute

    2009-07-15

    Water striders (Hemiptera: Gerridae) have been considered as a potential sentinel for mercury (Hg) contamination of freshwater ecosystems, yet little is known about factors that control Hg concentrations in this invertebrate. Striders were collected from 80 streams and rivers in New Brunswick, Canada, in August and September of 2004 through 2007 to assess the influence of factors such as diet, water chemistry, and proximity to point sources on Hg concentrations in this organism. Higher than average Hg concentrations were observed in the southwest and Grand Lake regions of the province, the latter being the location of a coal-fired power plant that is a source of Hg (similar to 100 kg annually), with elevated Hg concentrations in the lichen Old Man's Beard (Usnea spp.) in its immediate vicinity. Across all streams, pH and total organic carbon of water were relatively weak predictors of strider Hg concentrations. Female striders that were larger in body size than males had significantly lower Hg concentrations within sites, suggestive of growth dilution. There was no relationship between percent aquatic carbon in the diet and Hg concentrations in striders. For those striders feeding solely on terrestrial carbon, Hg concentrations were higher in animals occupying a higher trophic level. Mercury concentrations were highly variable in striders collected monthly over two growing seasons, suggesting short-term changes in Hg availability. These measurements highlight the importance of considering both deposition and postdepositional processes in assessing Hg bioaccumulation in this species.

  16. Simulate rain about action insecticide flonicamid in the control of the cotton aphid=Chuva simulada sobre ação inseticida flonicamid no controle do pulgão-do-algodoeiro.

    Directory of Open Access Journals (Sweden)

    Paulo Eduardo Degrande

    2011-10-01

    Full Text Available The cotton production system in Brazil concentrates on the area of the cerrado, characterized by frequent rains that interfere in the effectiveness of the necessary sprays during its cycle. The objective of the work was to evaluate simulate rain of 15 mm in 4 hours after spraying in the control of Aphis gossypii with insecticide flonicamid. Plants of Gossypium hirsutum were cultivated in pots containing soil as substrate in greenhouse conditions. The pots were arranged in randomized complete design with seven treatments and five replicates, consisting of: test without insecticide spraying, without insecticide spraying with rain, flonicamid spraying with simulate rain of 15 mm after 30 minutes, 1, 2 and 4 hours after spraying. Equivalent insecticide was sprayed 75 g of flonicamid by hectare. The efficiency evaluation was accomplished through the individuals of A. gossypii count which started from an artificial infestation 6 days before the application of the treatments. The results were: a 15-mm precipitation during the first four hours after flonicamid spraying interfered negatively in the control of A. gossypii.O cultivo do algodoeiro no Brasil concentra-se na Região do Cerrado, caracterizada por chuvas freqüentes que interferem na eficácia das pulverizações necessárias durante seu ciclo. O objetivo do trabalho foi avaliar chuva simulada de 15 mm nas 4h iniciais após pulverização no controle de A. gossypii com inseticida flonicamid. Plantas de Gossypium hirsutum foram cultivadas em vasos contendo solo como substrato em condições de casa-de-vegetação. Cada parcela foi constituída de um vaso com duas plantas. Utilizou-se delineamento experimental inteiramente casualizado com sete tratamentos e cinco repetições, consistindo de: testemunha sem pulverização de inseticida, testemunha sem pulverização de inseticida com presença de chuva e pulverização de flonicamid com chuva simulada de 15 mm aos 30 min., 1, 2 e 4h após aplica

  17. Cicadas (Hemiptera: Cicadidae) from Camiguin of Mindanao Province and Dinagat Island in the Philippines, with a new genus and three new species.

    Science.gov (United States)

    Lee, Young June; Marshall, David C; Mohagan, Alma; Hill, Kathy B R

    2016-03-30

    This paper provides the first faunal checklist for the family Cicadidae (Hemiptera) from Camiguin of Mindanao Province and Dinagat Island in the Philippines, comprising ten species belonging to nine genera. Cryptotympana shillana Lee & Mohagan sp. nov., Orientopsaltria inermis (Stål, 1870), Purana crassinotata Lee, 2015, and Huechys parvula Haupt, 1924 are recorded for the first time from Camiguin. Platypleura dinagatensis Lee sp. nov., Chremistica kyoungheeae Lee, 2010, Dundubia vaginata (Fabricius, 1787), Oncotympana pallidiventris Stål, 1870, and Philipsalta nigrina Lee, Marshall & Hill sp. nov. are newly recorded from Dinagat Island. A new genus Philipsalta Lee, Marshall & Hill gen. nov. is erected. Huechysini Distant, 1905 syn. nov. is synonymized with Cicadettini Buckton, 1889. Information on geographic distributions of the Camiguin and Dinagat species is also provided.

  18. The Complete Mitochondrial Genome of Mindarus keteleerifoliae (Insecta: Hemiptera: Aphididae) and Comparison with Other Aphididae Insects.

    Science.gov (United States)

    Wang, Yuan; Chen, Jing; Jiang, Li-Yun; Qiao, Ge-Xia

    2015-12-17

    The mitogenome of Mindarus keteleerifoliae Zhang (Hemiptera: Aphididae) is a 15,199 bp circular molecule. The gene order and orientation of M. keteleerifoliae is similarly arranged to that of the ancestral insect of other aphid mitogenomes, and, a tRNA isomerism event maybe identified in the mitogenome of M. keteleerifoliae. The tRNA-Trp gene is coded in the J-strand and the same sequence in the N-strand codes for the tRNA-Ser gene. A similar phenomenon was also found in the mitogenome of Eriosoma lanigerum. However, whether tRNA isomers in aphids exist requires further study. Phylogenetic analyses, using all available protein-coding genes, support Mindarinae as the basal position of Aphididae. Two tribes of Aphidinae were recovered with high statistical significance. Characteristics of the M. keteleerifoliae mitogenome revealed distinct mitogenome structures and provided abundant phylogenetic signals, thus advancing our understanding of insect mitogenomic architecture and evolution. But, because only eight complete aphid mitogenomes, including M. keteleerifoliae, were published, future studies with larger taxon sampling sizes are necessary.

  19. Plant Essential Oils Synergize and Antagonize Toxicity of Different Conventional Insecticides against Myzus persicae (Hemiptera: Aphididae)

    Science.gov (United States)

    Faraone, Nicoletta; Hillier, N. Kirk; Cutler, G. Christopher

    2015-01-01

    Plant-derived products can play an important role in pest management programs. Essential oils from Lavandula angustifolia (lavender) and Thymus vulgaris (thyme) and their main constituents, linalool and thymol, respectively, were evaluated for insecticidal activity and synergistic action in combination with insecticides against green peach aphid, Myzus persicae (Sulzer) (Hemiptera: Aphididae). The essential oils and their main constituents exerted similar insecticidal activity when aphids were exposed by direct sprays, but were non-toxic by exposure to treated leaf discs. In synergism experiments, the toxicity of imidacloprid was synergized 16- to 20-fold by L. angustifolia and T. vulgaris essential oils, but far less synergism occurred with linalool and thymol, indicating that secondary constituents of the oils were probably responsible for the observed synergism. In contrast to results with imidacloprid, the insecticidal activity of spirotetramat was antagonized by L. angustifolia and T. vulgaris essential oils, and linalool and thymol. Our results demonstrate the potential of plant essential oils as synergists of insecticides, but show that antagonistic action against certain insecticides may occur. PMID:26010088

  20. Transferrin Family Genes in the Brown Planthopper, Nilaparvata lugens (Hemiptera: Delphacidae) in Response to Three Insecticides.

    Science.gov (United States)

    Wu, Shun-Fan; Li, Jian; Zhang, Yong; Gao, Cong-Fen

    2018-02-09

    Transferrins are involved in iron metabolism, immunity, xenobiotics tolerance, and development in eukaryotic organisms including insects. However, little is known about the relationship between transferrins and insecticide toxicology and resistance. Three transferrin family genes, NlTsf1, NlTsf2, and NlTsf3, of the brown planthopper, Nilaparvata lugens (Stål) (Hemiptera: Delphacidae)a major insect pest of rice field in Asia, had been identified and characterized in this study. Quantitative polymerase chain reaction results demonstrated that NlTsf1 was significantly higher than the other two genes in different tissues. All of them were expressed at higher levels in abdomen and head than in antenna, leg, stylet, and thorax. Compared with the control, the expression of three N. lugens transferrin family genes decreased dramatically 24 h after treatment with buprofezin, pymetrozine and imidacloprid. Published by Oxford University Press on behalf of Entomological Society of America 2017. This work is written by (a) US Government employee(s) and is in the public domain in the US.

  1. Two-Spotted Ladybeetle Adalia bipunctata L. (Coleoptera: Coccinellidae): A Commercially Available Predator to Control Asian Citrus Psyllid Diaphorina citri (Hemiptera: Liviidae).

    Science.gov (United States)

    Khan, Azhar A; Qureshi, Jawwad A; Afzal, Muhammad; Stansly, Philip A

    2016-01-01

    The Asian citrus psyllid Diaphorina citri Kuwayama (Hemiptera: Liviidae) is an economically important pest of citrus because it serves as a vector of the causal pathogens of huanglongbing (HLB) also known as citrus greening disease. The increased use of insecticides for control of D. citri negatively impacts several natural enemies including some effective ladybeetle species which are not available commercially. The two-spotted ladybeetle, Adalia bipunctata (Coleoptera: Coccinellidae) is found in some crop and forest ecosystems of Asia, Europe and North America and available commercially. It is known to attack aphids and mealybugs but there are no published records of feeding on psyllids. We evaluated suitability and preference of A. bipunctata for nymphs of D. citri compared to corn leaf aphid Rhopalosiphum maidis (Hemiptera: Aphididae) a global pest of cereal crops and prey for many predaceous insects. We also compared development and reproduction of A. bipunctata on these two species with frozen eggs of the Mediterranean flour moth Ephestia kuehniella (Lepidoptera: Pyralidae) at 25°C. Initially, more D. citri than R. maidis nymphs were consumed in the no-choice tests although final consumption by larva and adult of A. bipunctata did not differ in the choice and no-choice tests. Larval development was prolonged by one day on D. citri compared to R. maidis nymphs but did not differ between either of these diets and E. kuehniella. Larval survival to adult averaged 93-100% and was not impacted by diet. Adult life span did not differ between diets although those on D. citri and R. maidis nymphs weighed less and produced fewer but more fertile eggs than on E. kuehniella eggs. Significant reduction of D. citri nymphs averaging 54% was observed in colonies caged with adult A. bipunctata on field planted citrus. R° (net reproductive rate) was least for beetles fed R. maidis, but otherwise there were no significant differences in demographic parameters. Successful

  2. The EU needs more anticipatory funding of health and environmental research

    DEFF Research Database (Denmark)

    Hansen, Steffen Foss; Gee, David

    2014-01-01

    In recent months, there have been several attacks on the Precautionary Principle and how the principle has been used in the EU. For example, the scientific advisor to the President of the European Commission, Ann Glover, has accused Commissioners of having “crazy ideas” about the safety of nanote......In recent months, there have been several attacks on the Precautionary Principle and how the principle has been used in the EU. For example, the scientific advisor to the President of the European Commission, Ann Glover, has accused Commissioners of having “crazy ideas” about the safety...

  3. Molecular and morphological identification of  pistachio armored scale insects (Hemiptera: Diaspididae), with description of a new species.

    Science.gov (United States)

    Hosseininaveh, Fatemeh; Nozari, Jamasb; Kaydan, Mehmet Bora; Hosseininaveh, Vahid

    2016-12-01

    Members of the family Diaspididae (Hemiptera: Coccomorpha) can be devastating pests that suck parenchyma cell contents from crops and cause severe damage to pistachio trees (Pistacia vera L.). The current research collected and characterized diaspidid species from pistachio orchards in Kerman province, Iran, according to their morphological and molecular features. Lepidosaphes pistaciae Archangelskaya, Suturaspis davatchi (Balachowsky & Kaussari) and Melanaspis inopinata (Leonardi) are redescribed and a new species, Melanaspis pistaciae Hosseininaveh & Kaydan sp. n., is described. Phylogenetic trees based on molecular analysis of COI and 28S rDNA fragments placed all the species in separated clades and confirmed M. pistaciae as a new taxon which is concluded by morphological differences. Molecular analysis suggests non-monophyly of the populations of each species. Melanaspis pistaciae sp. n. has spread to most cultivated pistachio areas in Iran and has probably been misidentified as M. inopinata in the past. Further investigation of the biology of this species may lead to development of more effective approaches for controlling this pest.

  4. Effects of temperature and food on the development of Dysdercus maurus Distant (Hemiptera, Pyrrhocoridae); Efeitos da temperatura e do alimento no desenvolvimento de Dysdercus maurus Distant (Hemiptera, Pyrrhocoridae)

    Energy Technology Data Exchange (ETDEWEB)

    Almeida, Fabio Souto [Universidade Federal Rural do Rio de Janeiro (UFRRJ), Seropedica, RJ (Brazil). Dept. de Ciencias Ambientais], e-mail: fbio_almeida@yahoo.com.br; Goncalves, Lenicio [Universidade Federal Rural do Rio de Janeiro (UFRRJ), Seropedica, RJ (Brazil). Dept. de Biologia Animal. Area de Biologia], e-mail: lencygon@globo.com

    2007-10-15

    Dysdercus maurus Distant, 1901 (Hemiptera, Pyrrhocoridae) is an important pest on Gossypium spp. (cotton tree), Citrus sinensis Osbeck (Rutaceae) and Citrus reticulata Blanco (Rutaceae) crops. This insect also feeds on seeds of Chorisia speciosa St. Hil. (Bombacaceae). This work aimed to evaluate the effects of temperature and food on the development of D. maurus. Eight treatments were carried out, in six of them bugs were fed with seeds of C. speciosa and kept at 15, 18, 20, 25 and 30 {+-} 1 deg C, 80 {+-} 3% RH and 12h photo phase or in laboratory conditions (23.5 {+-} 2.6 deg C, 73.3 {+-} 9.9 % RH), and in the other two treatments bugs were fed with seeds of cotton variety IAC-22 and kept at 25 or 30 deg C. In all treatments five immature stages were observed. The increase of temperature caused reduction in the developmental time. The temperature of 15 deg C disabled nymphal eclosion and was also lethal to those nymphs ecloded at other temperatures. The lower mortality of nymphs occurred in the temperature of 25 deg C with cotton as food (24.07%). The lower threshold temperature (Tb) occurred for the first instar (11.54 deg C) and the higher for the second instar (15.33 deg C). The females of D. maurus required more degree-days (329.93 degree-days) than males (300.49 degree-days) until adult emergence. (author)

  5. The Damage Capacity of Mahanarva spectabilis (Distant, 1909 (Hemiptera: Cercopidae Adults on Brachiaria ruziziensis Pasture

    Directory of Open Access Journals (Sweden)

    Tiago Teixeira Resende

    2013-01-01

    Full Text Available The aim of this study was to determine the damage caused by adult Mahanarva spectabilis (Distant, 1909 (Hemiptera: Cercopidae on Brachiaria ruziziensis (Germain & Evard under field conditions. A total of 0, 4, 8, 12, or 16 M. spectabilis adults per plot were maintained for 6 days. Thereafter, the insects were removed from the plant, and the following parameters were evaluated: chlorophyll content, damage score, dry as well as fresh weights, percentage of shoots’ dry matter, and the forage’s ability to regrow. The chlorophyll content was significantly reduced; the damage score and percentage of dry matter in plants increased depending on the increased insect infestation density after 6 days of exposure. In contrast, no change was observed on the B. ruziziensis fresh and dry weights as well as the regrowth capacity depending on the M. spectabilis infestation densities. Attacks by 8 adult M. spectabilis per clump of B. ruziziensis with an average of 80 tillers for 6 days were sufficient to reduce the chlorophyll content and the functional plant loss index. This density can be a reference for spittlebug integrated management in Brachiaria.

  6. Molecular markers reveal infestation dynamics of the bed bug (Hemiptera: Cimicidae) within apartment buildings.

    Science.gov (United States)

    Booth, Warren; Saenz, Virna L; Santangelo, Richard G; Wang, Changlu; Schal, Coby; Vargo, Edward L

    2012-05-01

    The bed bug, Cimex lectularius L. (Hemiptera: Cimicidae), has experienced an extraordinary global resurgence in recent years, the reasons for which remain poorly understood. Once considered a pest of lower socioeconomic classes, bed bugs are now found extensively across all residential settings, with widespread infestations established in multiapartment buildings. Within such buildings, understanding the population genetic structure and patterns of dispersal may prove critical to the development of effective control strategies. Here, we describe the development of 24 high-resolution microsatellite markers through next generation 454 pyrosequencing and their application to elucidate infestation dynamics within three multistory apartment buildings in the United States. Results reveal contrasting characteristics potentially representative of geographic or locale differences. In Raleigh, NC, an infestation within an apartment building seemed to have started from a single introduction followed by extensive spread. In Jersey City, NJ, two or more introductions followed by spread are evident in two buildings. Populations within single apartments in all buildings were characterized by high levels of relatedness and low levels of diversity, indicative of foundation from small, genetically depauperate propagules. Regardless of the number of unique introductions, genetic data indicate that spread within buildings is extensive, supporting both active and human-mediated dispersal within and between adjacent rooms or apartments spanning multiple floors.

  7. Exposure to Guava Affects Citrus Olfactory Cues and Attractiveness to Diaphorina citri (Hemiptera: Psyllidae).

    Science.gov (United States)

    Barman, Jagadish Chandra; Campbell, Stuart A; Zeng, Xinnian

    2016-06-01

    Intercropping can reduce agricultural pest incidence, and represents an important sustainable alternative to conventional pest control methods. Understanding the ecological mechanisms for intercropping could help optimize its use, particularly in tropical systems which present a large number of intercropping possibilities. Citrus is threatened worldwide by greening disease (huanglongbing, HLB) vectored by the Asian citrus psyllid, Diaphorina citri Kuwayama (Hemiptera: Psyllidae). Control of HLB and citrus psyllid can be partially achieved through intercropping with guava, Psidium guajava L., but the mechanisms remain unclear. We tested the hypothesis that guava olfactory cues affect psyllid behavior by altering the attractiveness of citrus through plant-plant interactions. In choice and no-choice cage experiments, psyllid settlement was reduced on citrus shoots that had been exposed to guava shoot odors for at least 2 h. In Y-tube olfactometer experiments, psyllids oriented to odors of unexposed, compared with guava-exposed, citrus shoots. These behavioral results indicate that a mechanism for the success of guava intercropping for sustainable, ecological disease management may be the indirect effect of guava on citrus attractiveness. © The Authors 2016. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  8. Understanding trophic interactions of Orius spp. (Hemiptera: Anthocoridae) in lettuce crops by molecular methods.

    Science.gov (United States)

    Gomez-Polo, Priscila; Alomar, Oscar; Castañé, Cristina; Aznar-Fernández, Thaïs; Lundgren, Jonathan G; Piñol, Josep; Agustí, Nuria

    2016-02-01

    The aphid Nasonovia ribisnigri (Mosley) (Hemiptera: Aphididae) and the thrips Frankliniella occidentalis (Pergande) (Thysanoptera: Thripidae) are common pests in Mediterranean lettuce crops, where Orius spp. are common generalist predators. Predation by Orius spp. was studied in a lettuce plot by conventional polymerase chain reaction (PCR) and real-time PCR analyses using specific primers of both main pests. Also, high-throughput sequencing was used to have a wider approach of the diet of these predators in natural field conditions. Molecular analyses indicated a higher predation on N. ribisnigri in spring and on F. occidentalis in summer. Predation on alternative prey, like Collembola, was also found in both seasons. Real-time PCR was more sensitive than conventional PCR in showing the target trophic links, whereas high-throughput sequencing revealed predation on other natural enemies - intraguild predation (IGP), showing other trophic interactions of Orius majusculus within the studied ecosystem. This study gives important information about the trophic relationships present in Mediterranean lettuce crops in different periods of the year. The detected predation by Orius spp. on alternative prey, as well as on other natural enemies, should be further investigated to clarify whether it adds or detracts to the biological control of N. ribisnigri and F. occidentalis. © 2015 Society of Chemical Industry.

  9. Laboratory Evaluation of Different Insecticides against Hibiscus Mealybug, Maconellicoccus hirsutus (Hemiptera: Pseudococcidae

    Directory of Open Access Journals (Sweden)

    Samman Fatima

    2016-01-01

    Full Text Available Hibiscus mealybug, Maconellicoccus hirsutus (Hemiptera: Pseudococcidae, is the major pest of many vegetables, fruits, crops, and ornamental plants causing losses to the farmers and its control has been an issue of significance in the pest management. This study was aimed at evaluating different concentrations (0.06%, 0.1%, and 0.14% of Telsta, Advantage, Talstar, Imidacloprid, and their mixtures against hibiscus mealybug in the Laboratory of Systematics and Pest Management at University of Gujrat, Pakistan. The toxic effect was evaluated in the laboratory bioassay after 24 and 48 h of the application of insecticides. The highest mortality (95.83% was shown by Talstar and Talstar + Imidacloprid at the concentration of 0.14% after 48 h followed by Advantage + Talstar with 87.50% mortality at 0.14% concentration after 48 h of application. The study also showed that the least effective treatment observed was Advantage + Telsta with no mortality after 24 h and 25% mortality after 48 h at 0.14% concentration. The study revealed that the concentration 0.14% was highly effective in lowering the mealybug population and insecticide mixtures were effective in reducing mealybug density. The study emphasizes the use of such insecticide mixtures to develop better management strategy for mealybug populations attacking ornamental plants. However effects of such insecticide mixtures on other organisms and biological control agents should be checked under field conditions.

  10. The Hemiptera (Insecta) of Canada: Constructing a Reference Library of DNA Barcodes

    Science.gov (United States)

    Gwiazdowski, Rodger A.; Foottit, Robert G.; Maw, H. Eric L.; Hebert, Paul D. N.

    2015-01-01

    DNA barcode reference libraries linked to voucher specimens create new opportunities for high-throughput identification and taxonomic re-evaluations. This study provides a DNA barcode library for about 45% of the recognized species of Canadian Hemiptera, and the publically available R workflow used for its generation. The current library is based on the analysis of 20,851 specimens including 1849 species belonging to 628 genera and 64 families. These individuals were assigned to 1867 Barcode Index Numbers (BINs), sequence clusters that often coincide with species recognized through prior taxonomy. Museum collections were a key source for identified specimens, but we also employed high-throughput collection methods that generated large numbers of unidentified specimens. Many of these specimens represented novel BINs that were subsequently identified by taxonomists, adding barcode coverage for additional species. Our analyses based on both approaches includes 94 species not listed in the most recent Canadian checklist, representing a potential 3% increase in the fauna. We discuss the development of our workflow in the context of prior DNA barcode library construction projects, emphasizing the importance of delineating a set of reference specimens to aid investigations in cases of nomenclatural and DNA barcode discordance. The identification for each specimen in the reference set can be annotated on the Barcode of Life Data System (BOLD), allowing experts to highlight questionable identifications; annotations can be added by any registered user of BOLD, and instructions for this are provided. PMID:25923328

  11. Molecular and Morphological Identification of Mealybug Species (Hemiptera: Pseudococcidae) in Brazilian Vineyards

    Science.gov (United States)

    Pacheco da Silva, Vitor C.; Bertin, Aline; Blin, Aurélie; Germain, Jean-François; Bernardi, Daniel; Rignol, Guylène; Botton, Marcos; Malausa, Thibaut

    2014-01-01

    Mealybugs (Hemiptera: Pseudococcidae) are pests constraining the international trade of Brazilian table grapes. They damage grapes by transmitting viruses and toxins, causing defoliation, chlorosis, and vigor losses and favoring the development of sooty mold. Difficulties in mealybug identification remain an obstacle to the adequate management of these pests. In this study, our primary aim was to identify the principal mealybug species infesting the major table grape-producing regions in Brazil, by morphological and molecular characterization. Our secondary aim was to develop a rapid identification kit based on species-specific Polymerase Chain Reactions, to facilitate the routine identification of the most common pest species. We surveyed 40 sites infested with mealybugs and identified 17 species: Dysmicoccus brevipes (Cockerell), Dysmicoccus sylvarum Williams and Granara de Willink, Dysmicoccus texensis (Tinsley), Ferrisia cristinae Kaydan and Gullan, Ferrisia meridionalis Williams, Ferrisia terani Williams and Granara de Willink, Phenacoccus baccharidis Williams, Phenacoccus parvus Morrison, Phenacoccus solenopsis Tinsley, Planococcus citri (Risso), Pseudococcus viburni (Signoret), Pseudococcus cryptus Hempel, four taxa closely related each of to Pseudococcus viburni, Pseudococcus sociabilis Hambleton, Pseudococcus maritimus (Ehrhorn) and Pseudococcus meridionalis Prado, and one specimen from the genus Pseudococcus Westwood. The PCR method developed effectively identified five mealybug species of economic interest on grape in Brazil: D. brevipes, Pl. citri, Ps. viburni, Ph. solenopsis and Planococcus ficus (Signoret). Nevertheless, it is not possible to assure that this procedure is reliable for taxa that have not been sampled already and might be very closely related to the target species. PMID:25062012

  12. Spatiotemporal Dynamics of Whitefly Bemisia tabaci (Hemiptera: Aleyrodidae) in Commercial Watermelon Crops.

    Science.gov (United States)

    Lima, Carlos H O; Sarmento, Renato A; Galdino, Tarcísio V S; Pereira, Poliana S; Silva, Joedna; Souza, Danival J; Dos Santos, Gil R; Costa, Thiago L; Picanço, Marcelo C

    2018-04-16

    Spatiotemporal dynamics studies of crop pests enable the determination of the colonization pattern and dispersion of these insects in the landscape. Geostatistics is an efficient tool for these studies: to determine the spatial distribution pattern of the pest in the crops and to make maps that represent this situation. Analysis of these maps across the development of plants can be used as a tool in precision agriculture programs. Watermelon, Citrullus lanatus (Thunb.) Matsum. and Nakai (Cucurbitales: Cucurbitaceae), is the second most consumed fruit in the world, and the whitefly Bemisia tabaci (Gennadius) (Hemiptera: Aleyrodidae) is one of the most important pests of this crop. Thus, the objective of this work was to determine the spatiotemporal distribution of B. tabaci in commercial watermelon crops using geostatistics. For 2 yr, we monitored adult whitefly densities in eight watermelon crops in a tropical climate region. The location of the samples and other crops in the landscape was georeferenced. Experimental data were submitted to geostatistical analysis. The colonization of B. tabaci had two patterns. In the first, the colonization started at the outermost parts of the crop. In the second, the insects occupied the whole area of the crop since the beginning of cultivation. The maximum distance between sites of watermelon crops in which spatial dependence of B. tabaci densities was observed was 19.69 m. The adult B. tabaci densities in the eight watermelon fields were positively correlated with rainfall and relative humidity, whereas wind speed negatively affected whiteflies population.

  13. Degree Day Requirements for Kudzu Bug (Hemiptera: Plataspidae), a Pest of Soybeans.

    Science.gov (United States)

    Grant, Jessica I; Lamp, William O

    2018-04-02

    Understanding the phenology of a new potential pest is fundamental for the development of a management program. Megacopta cribraria Fabricius (Hemiptera: Plataspidae), kudzu bug, is a pest of soybeans first detected in the United States in 2009 and in Maryland in 2013. We observed the phenology of kudzu bug life stages in Maryland, created a Celsius degree-day (CDD) model for development, and characterized the difference between microhabitat and ambient temperatures of both kudzu, Pueraria montana (Lour.) Merr. (Fabales: Fabaceae) and soybeans, Glycine max (L.) Merrill (Fabales: Fabaceae). In 2014, low population numbers yielded limited resolution from field phenology observations. We observed kudzu bug populations persisting within Maryland; but between 2013 and 2016, populations were low compared to populations in the southeastern United States. Based on the degree-day model, kudzu bug eggs require 80 CDD at a minimum temperature of 14°C to hatch. Nymphs require 545 CDD with a minimum temperature of 16°C for development. The CDD model matches field observations when factoring a biofix date of April 1 and a minimum preoviposition period of 17 d. The model suggests two full generations per year in Maryland. Standard air temperature monitors do not affect model predictions for pest management, as microhabitat temperature differences did not show a clear trend between kudzu and soybeans. Ultimately, producers can predict the timing of kudzu bug life stages with the CDD model for the use of timing management plans in soybean fields.

  14. Molecular Characterization and Expression Profiles of Polygalacturonase Genes in Apolygus lucorum (Hemiptera: Miridae.

    Directory of Open Access Journals (Sweden)

    Lili Zhang

    Full Text Available Polygalacturonase (PG is an enzyme in the salivary glands of piercing-sucking mirid bugs (Hemiptera: Miridae that plays a key role in plant feeding and injury. By constructing a full-length cDNA library, we cloned and characterized 14 PG genes from the salivary glands of Apolygus lucorum, a pestiferous mirid bug in cotton, fruit trees and other crops in China. BLAST search analysis showed that the amino acid sequences deduced from transcripts of the PG genes were closely related to PGs from other mirid bugs. Phylogenetic analysis showed that the PGs of mirid bugs had six main branches, PG1-PG6 (Genbank accession numbers: KF881899~KF881912. We investigated the mRNA expression patterns of the A. lucorum PG genes using real-time PCR. All 14 PGs were expressed significantly higher in the salivary glands than in other tissues (head, thorax, abdomen, leg and wing. For eggs and nymphs, the expression levels of these PGs were much higher in the 5th instar stage than in the egg, and 1st and 3rd instar stages. The PG expression levels in 1-day-old adults were very low, and increased in 5, 20 and 30-day-old adults. Additionally, PG expression levels were generally similar between males and females. The possible physiological functions of PGs in A. lucorum were discussed.

  15. Effects of gamma irradiation on different stages of mealybug Dysmicoccus neobrevipes (Hemiptera: Pseudococcidae)

    International Nuclear Information System (INIS)

    The, Doan Thi; Khanh, Nguyen Thuy; Lang, Vo Thi Kim; Van Chung, Cao; An, Tran Thi Thien; Thi, Nguyen Hoang Hanh

    2012-01-01

    Utilization of phytosanitary irradiation as a potential treatment to disinfest agricultural commodities in trade has expanded rapidly in the recent years. Cobalt-60 gamma ray target doses of 100, 150, 200 and 250 Gy were used to irradiate immatures and adults of Dysmicoccus neobrevipes (Beardsley) (Hemiptera: Pseudococcidae) infesting dragon fruits to find the most tolerant stage and the most optimal dose range for quarantine treatment. In general, irradiation affected significantly all life stages of D. neobrevipes mortality and adult reproduction. The pattern of tolerance to irradiation in D. neobrevipes was 1st instars<2nd instars<3rd instars< adults, in which the adult is the most tolerant stage. Based on obtained results after 21 days of irradiation, predicted doses for 100% mortality of each different development stage in the above mentioned pattern were 224.6, 241.3, 330.9 and 581.5 Gy, respectively. No survived female adult produced offspring at 200 and 250 Gy. Dose range between 200 and 250 Gy could be efficient to prevent the reproduction of this mealybug. - Highlights: → Gamma Co-60 irradiation as a potential phytosanitary for quarantine treatments. → Reproduction ability of D. neobrevipes has been efficiently inhibited at low dose. → Pattern of tolerance to irradiation was 1st<2nd<3rd instars< adults. → Doses from 200 to 250 Gy could be efficient to prevent the reproduction of mealybug.

  16. Effects of gamma irradiation on different stages of mealybug Dysmicoccus neobrevipes (Hemiptera: Pseudococcidae)

    Energy Technology Data Exchange (ETDEWEB)

    The, Doan Thi, E-mail: doanthithe@yahoo.com [Research and Development Center for Radiation Technology, Vietnam Atomic Energy Institute, 202A Street 11, Linh Xuan Ward, Thu Duc District, Ho Chi Minh City (Viet Nam); Khanh, Nguyen Thuy; Lang, Vo Thi Kim; Van Chung, Cao [Research and Development Center for Radiation Technology, Vietnam Atomic Energy Institute, 202A Street 11, Linh Xuan Ward, Thu Duc District, Ho Chi Minh City (Viet Nam); An, Tran Thi Thien; Thi, Nguyen Hoang Hanh [Agriculture and Forestry University, Linh Trung Ward, Thu Duc District, Ho Chi Minh City (Viet Nam)

    2012-01-15

    Utilization of phytosanitary irradiation as a potential treatment to disinfest agricultural commodities in trade has expanded rapidly in the recent years. Cobalt-60 gamma ray target doses of 100, 150, 200 and 250 Gy were used to irradiate immatures and adults of Dysmicoccus neobrevipes (Beardsley) (Hemiptera: Pseudococcidae) infesting dragon fruits to find the most tolerant stage and the most optimal dose range for quarantine treatment. In general, irradiation affected significantly all life stages of D. neobrevipes mortality and adult reproduction. The pattern of tolerance to irradiation in D. neobrevipes was 1st instars<2nd instars<3rd instars Gamma Co-60 irradiation as a potential phytosanitary for quarantine treatments. > Reproduction ability of D. neobrevipes has been efficiently inhibited at low dose. > Pattern of tolerance to irradiation was 1st<2nd<3rd instars Doses from 200 to 250 Gy could be efficient to prevent the reproduction of mealybug.

  17. New record of Helopeltis bradyi Waterhouse and Pachypeltis maesarum Kirkaldy (Hemiptera: Miridae on tea Camellia sinensis L.O. (Kuntze in southern India

    Directory of Open Access Journals (Sweden)

    Kodakkadan SRIKUMAR

    2017-03-01

    Full Text Available Helopeltis theivora commonly called as tea mosquito bug (TMB is considered as important pest of tea in South India. Extensive survey in tea plantations of Anamallais, recorded H. bradyi and Pachypeltis maesarum (Hemiptera: Miridae causing considerable damage and were registered for the first time on tea. Their occurrence was seen in association with H. theivora. There was considerable variation among these species in size of the circular rings formed by rostral piercing, indicating that these three species can be easily demarcated based on the observation of feeding punctures even in field condition. As the dosage and recommendations of insecticides against TMB in tea in south India was pertaining only to H. theivora the addition of H. bradyi and P. maesarum will improve the future pest management strategies.

  18. First report of Maconellicoccus hirsutus (Green, 1908) (Hemiptera: Coccoidea: Pseudococcidae) and the associated parasitoid Anagyrus kamali Moursi, 1948 (Hymenoptera: Encyrtidae), in Brazil.

    Science.gov (United States)

    Marsaro Júnior, A L; Peronti, A L B G; Penteado-Dias, A M; Morais, E G F; Pereira, P R V S

    2013-05-01

    The pink hibiscus mealybug (PHM), Maconellicoccus hirsutus (Green) (Hemiptera: Pseudococcidae) and the associated hymenopterous parasitoid, Anagyrus kamali Moursi, 1948 (Hymenoptera: Encyrtidae), are reported for the first time in Brazil. Specimens of the PHM were collected on nine hosts plants, Annona muricata L. (Anonnaceae), Glycine max (L.) Merr. (Fabaceae), Centrolobium paraensis Tul. (Fabaceae), Inga edulis Mart. (Fabaceae), Hibiscus rosa-sinensis L. (Malvaceae), Psidium guajava L. (Myrtaceae), Averrhoa carambola L. (Oxalidaceae), Citrus sinensis (L.) Osbeck (Rutaceae) and Solanum lycopersicum L. (Solanaceae), in four municipalities in the north-northeast of the state of Roraima. The plants C. paraensis, I. edulis and C. sinensis are recorded for the first time as a hosts for PHM. Characteristic injuries observed on the host plants infested by PHM and suggestions for its management are presented.

  19. Phenology of the Pine Bark Adelgid, Pineus strobi (Hemiptera: Adelgidae), in White Pine Forests of Southwestern Virginia.

    Science.gov (United States)

    Wantuch, Holly A; Kuhar, Thomas P; Salom, Scott M

    2017-12-08

    The pine bark adelgid, Pineus strobi Hartig (Hemiptera: Adelgidae), is a native herbivore of eastern white pine, Pinus strobus L. (Pinales: Pinaceae), in eastern North America. P. strobi does not appear to have any dominant overwintering lifestage in southwest Virginia, as it does in its northern range. Eggs can be found consistently from late March through early December and may be produced sporadically later throughout the winter during warm periods. Two distinct generations were observed in the spring, after which life stage frequencies overlapped. Adult body size varied seasonally and was greatest in the spring. The present study constitutes the first recording of phenological details of the P. strobi in its southern range, informing biological control efforts aimed at closely related invasive pests. The phenological plasticity observed between northern and southern P. strobi populations provides insight into the potential effects of climate on the population dymanics of this and related species. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  20. Nitrogen in Hydroponic Growing Medium of Tomato Affects the Demographic Parameters of Trialeurodes vaporariorum (Westwood) (Hemiptera: Aleyrodidae).

    Science.gov (United States)

    Hosseini, R S; Madadi, H; Hosseini, M; Delshad, M; Dashti, F

    2015-12-01

    We evaluated the effects of different nitrogen levels (380, 310, 240, and 174 ppm) on the life history parameters of Trialeurodes vaporariorum (Westwood) (Hemiptera: Aleyrodidae) on hydroponically cultured tomato plants. Our data show that there is a positive correlation between the nitrogen content and the demographic parameters, as the intrinsic rate of increase of T. vaporariorum was the lowest (0.059 ± 0.007 day(-1)) at 174 ppm and the highest (0.088 ± 0.005 day(-1)) at 380 ppm of nitrogen. The net reproduction rate (R 0), finite rate of increase (λ), and mean developmental time (T) were significantly influenced by the nitrogen levels. The mean longevity of males and females showed a positive relationship with the nitrogen level, ranging from 64.8 ± 3.96 to 76.3 ± 2.44 for males and 61.6 ± 5.35 to 71.2 ± 2.44 for females, observed in the lowest and highest nitrogen levels, respectively. The relationship between nitrogen fertilization and T. vaporariorum management on tomato crops is discussed.

  1. Characterization and functional assay of a fatty acyl-CoA reductase gene in the scale insect, Ericerus pela Chavannes (Hemiptera: Coccoidae).

    Science.gov (United States)

    Hu, Yan-Hong; Chen, Xiao-Ming; Yang, Pu; Ding, Wei-Feng

    2018-04-01

    Ericerus pela Chavannes (Hemiptera: Coccoidae) is an economically important scale insect because the second instar males secrete a harvestable wax-like substance. In this study, we report the molecular cloning of a fatty acyl-CoA reductase gene (EpFAR) of E. pela. We predicted a 520-aa protein with the FAR family features from the deduced amino acid sequence. The EpFAR mRNA was expressed in five tested tissues, testis, alimentary canal, fat body, Malpighian tubules, and mostly in cuticle. The EpFAR protein was localized by immunofluorescence only in the wax glands and testis. EpFAR expression in High Five insect cells documented the recombinant EpFAR reduced 26-0:(S) CoA and to its corresponding alcohol. The data illuminate the molecular mechanism for fatty alcohol biosynthesis in a beneficial insect, E. pela. © 2017 Wiley Periodicals, Inc.

  2. A new species of the genus Eurhadina Haupt (Hemiptera: Auchenorrhyncha: Cicadellidae: Typhlocybinae) from Korea, with a key to Korean species.

    Science.gov (United States)

    Oh, Sumin; Lim, Jongok; Jung, Sunghoon

    2016-04-11

    The leafhopper genus Eurhadina Haupt, 1929 belongs to the tribe Typhlocybini of subfamily Typhlocybinae (Hemiptera: Auchenorrhyncha: Cicadellidae). Currently, genus Eurhadina includes 3 subgenera, Eurhadina Haupt 1929, Singhardina Mahmood 1967, Zhihadina Yang & Li 1991. A total of 20 valid species of subgenus Eurhadina have been described in the Nearctic and Palaearctic region and the subgenus Singhardina includes 57 species in the Oriental and Palaearctic region (Huang & Zhang 1999, Dworakowska 2002). The subgenus Zhihadina includes only 1 species from China (Yang & Lee, 1991). So far, four species of subgenus Eurhadina were recorded in the Korean Peninsula (Kwon & Huh 2001): Eurhadina (Eurhadina) betularia Anufriev, 1969, E. (E.) koreana Dworakowska, 1971, E. (E.) pulchella (Fallen, 1806), and E. (E.) wagneri Dworakowska, 1969. The majority of species belonging to the subgenus Eurhadina are difficult to distinguish by external appearance because the color patterns of the forewings are very similar among species.

  3. Storage of Euschistus heros Eggs (Fabricius) (Hemiptera: Pentatomidae) in Liquid Nitrogen for Parasitization by Telenomus podisi Ashmead (Hymenoptera: Platygastridae).

    Science.gov (United States)

    Favetti, B M; Butnariu, A R; Doetzer, A K

    2014-06-01

    Records in the literature with regard to the influence of freezing of pentatomid eggs on parasitism by microhymenopterans are scarce. In this research, we compared the storage of Euschistus heros (Fabricius) (Hemiptera: Pentatomidae) eggs in liquid nitrogen for different periods with the objective of optimizing the multiplication of Telenomus podisi Ashmead (Hymenoptera: Platygastridae) in the laboratory. Fresh eggs of E. heros were exposed (S3, S6) or not (NS3, NS6) to UV light for 30 min and stored in 1.5-mL plastic vials in liquid nitrogen either for 3 (S3, NS3) or 6 months (S6, NS6), and egg suitability to parasitoid development was compared to control eggs exposed (SC) or not (NSC) to UV treatment. Global data analysis showed that E. heros eggs stored in liquid nitrogen with or without UV treatment, for 3 or 6 months, were suitable for T. podisi parasitization.

  4. Morphology of the European species of the aphid genus Eulachnus (Hemiptera: Aphididae: Lachninae) - A SEM comparative and integrative study.

    Science.gov (United States)

    Kanturski, Mariusz; Karcz, Jagna; Wieczorek, Karina

    2015-09-01

    Scanning electron microscopy (SEM) methods were used for the first time to elucidate the external morphology of the European species of the genus Eulachnus (Hemiptera: Aphididae: Lachninae), a representative genus of the conifer-feeding aphids tribe Eulachnini. We examined and compared the external morphology of apterous and alate viviparous females from the parthenogenetic generation as well as oviparous females and alate males belonging to the sexual generation. FE-SEM images based on HMDS and cryo-SEM preparation techniques revealed better image quality than the CPD technique in regard to surface tension and morphological signs of cell deteriorations (i.e., existence of depressions, drying artifacts and membrane blebs). Three morphologically different species groups "agilis", "brevipilosus" and "cembrae" were proposed due to the differences in head, antennae, legs and dorsal chaetotaxy as well as dorsal sclerotization. The most characteristic features and differences of representatives of these groups are presented and discussed. Copyright © 2015 Elsevier Ltd. All rights reserved.

  5. Differences in bacterial diversity of host-associated populations of Phylloxera notabilis Pergande (Hemiptera: Phylloxeridae) in pecan and water hickory.

    Science.gov (United States)

    Medina, R F; Nachappa, P; Tamborindeguy, C

    2011-04-01

    Host-associated differentiation (HAD) is the presence of genetically divergent, host-associated populations. It has been suggested that microbial symbionts of insect herbivores may play a role in HAD by allowing their insect hosts to use different plant species. The objective of this study was to document if host-associated populations of Phylloxera notabilis Pergande (Hemiptera: Phylloxeridae) in pecan and water hickory corresponded with differences in the composition of their associated bacteria. To test this hypothesis, we characterized the symbionts present in P. notabilis associated with these two tree species through metagenomic analyses using 454 sequencing. Differences in bacterial diversity were found between P. notabilis populations associated with pecan and water hickory. The bacteria, Pantoea agglomerans and Serratia marcescens, were absent in the P. notabilis water hickory population, whereas both species accounted for more than 69.72% of bacterial abundance in the pecan population. © 2011 The Authors. Journal of Evolutionary Biology © 2011 European Society For Evolutionary Biology.

  6. A summary of eight traits of Coleoptera, Hemiptera, Orthoptera and Araneae, occurring in grasslands in Germany

    Science.gov (United States)

    Gossner, Martin M.; Simons, Nadja K.; Achtziger, Roland; Blick, Theo; Dorow, Wolfgang H. O.; Dziock, Frank; Köhler, Frank; Rabitsch, Wolfgang; Weisser, Wolfgang W.

    2015-03-01

    Analyses of species traits have increased our understanding of how environmental drivers such as disturbances affect the composition of arthropod communities and related processes. There are, however, few studies on which traits in the arthropod community are affected by environmental changes and which traits affect ecosystem functioning. The assembly of arthropod traits of several taxa is difficult because of the large number of species, limited availability of trait databases and differences in available traits. We sampled arthropod species data from a total of 150 managed grassland plots in three regions of Germany. These plots represent the spectrum from extensively used pastures to mown pastures to intensively managed and fertilized meadows. In this paper, we summarize information on body size, dispersal ability, feeding guild and specialization (within herbivores), feeding mode, feeding tissue (within herbivorous suckers), plant part (within herbivorous chewers), endophagous lifestyle (within herbivores), and vertical stratum use for 1,230 species of Coleoptera, Hemiptera (Heteroptera, Auchenorrhyncha), Orthoptera (Saltatoria: Ensifera, Caelifera), and Araneae, sampled by sweep-netting between 2008 and 2012. We compiled traits from various literature sources and complemented data from reliable internet sources and the authors’ experience.

  7. Acizzia solanicola (Hemiptera: Psyllidae) probing behaviour on two Solanum spp. and implications for possible pathogen spread

    Science.gov (United States)

    Valenzuela, Isabel; Trebicki, Piotr; Powell, Kevin S.; Vereijssen, Jessica; Norng, Sorn

    2017-01-01

    Piercing-sucking insects are vectors of plant pathogens, and an understanding of their feeding behaviour is crucial for studies on insect population dynamics and pathogen spread. This study examines probing behaviour of the eggplant psyllid, Acizzia solanicola (Hemiptera: Psyllidae), using the electrical penetration graph (EPG) technique, on two widespread and common hosts: eggplant (Solanum melongena) and tobacco bush (S. mauritianum). Six EPG waveforms were observed: waveform NP (non-probing phase), waveform C (pathway phase), G (feeding activities in xylem tissues), D (first contact with phloem tissues), E1 (salivation in the sieve elements) and E2 (ingestion from phloem tissues). Results showed that A. solanicola is predominantly a phloem feeder and time spent in salivation and ingestion phases (E1 and E2) differed between hosts. Feeding was enhanced on eggplant compared to tobacco bush which showed some degree of resistance, as evidenced by shorter periods of phloem ingestion, a higher propensity to return to the pathway phase once in the sieve elements and higher number of salivation events on tobacco bush. We discuss how prolonged phloem feeding could indicate the potential for A. solanicola to become an important pest of eggplant and potential pathogen vector. PMID:28575085

  8. Remote sensing and spatial statistical techniques for modelling Ommatissus lybicus (Hemiptera: Tropiduchidae) habitat and population densities.

    Science.gov (United States)

    Al-Kindi, Khalifa M; Kwan, Paul; R Andrew, Nigel; Welch, Mitchell

    2017-01-01

    In order to understand the distribution and prevalence of Ommatissus lybicus (Hemiptera: Tropiduchidae) as well as analyse their current biographical patterns and predict their future spread, comprehensive and detailed information on the environmental, climatic, and agricultural practices are essential. The spatial analytical techniques such as Remote Sensing and Spatial Statistics Tools, can help detect and model spatial links and correlations between the presence, absence and density of O. lybicus in response to climatic, environmental, and human factors. The main objective of this paper is to review remote sensing and relevant analytical techniques that can be applied in mapping and modelling the habitat and population density of O. lybicus . An exhaustive search of related literature revealed that there are very limited studies linking location-based infestation levels of pests like the O. lybicus with climatic, environmental, and human practice related variables. This review also highlights the accumulated knowledge and addresses the gaps in this area of research. Furthermore, it makes recommendations for future studies, and gives suggestions on monitoring and surveillance methods in designing both local and regional level integrated pest management strategies of palm tree and other affected cultivated crops.

  9. Remote sensing and spatial statistical techniques for modelling Ommatissus lybicus (Hemiptera: Tropiduchidae habitat and population densities

    Directory of Open Access Journals (Sweden)

    Khalifa M. Al-Kindi

    2017-08-01

    Full Text Available In order to understand the distribution and prevalence of Ommatissus lybicus (Hemiptera: Tropiduchidae as well as analyse their current biographical patterns and predict their future spread, comprehensive and detailed information on the environmental, climatic, and agricultural practices are essential. The spatial analytical techniques such as Remote Sensing and Spatial Statistics Tools, can help detect and model spatial links and correlations between the presence, absence and density of O. lybicus in response to climatic, environmental, and human factors. The main objective of this paper is to review remote sensing and relevant analytical techniques that can be applied in mapping and modelling the habitat and population density of O. lybicus. An exhaustive search of related literature revealed that there are very limited studies linking location-based infestation levels of pests like the O. lybicus with climatic, environmental, and human practice related variables. This review also highlights the accumulated knowledge and addresses the gaps in this area of research. Furthermore, it makes recommendations for future studies, and gives suggestions on monitoring and surveillance methods in designing both local and regional level integrated pest management strategies of palm tree and other affected cultivated crops.

  10. Carboxylesterase-mediated insecticide resistance: Quantitative increase induces broader metabolic resistance than qualitative change.

    Science.gov (United States)

    Cui, Feng; Li, Mei-Xia; Chang, Hai-Jing; Mao, Yun; Zhang, Han-Ying; Lu, Li-Xia; Yan, Shuai-Guo; Lang, Ming-Lin; Liu, Li; Qiao, Chuan-Ling

    2015-06-01

    Carboxylesterases are mainly involved in the mediation of metabolic resistance of many insects to organophosphate (OP) insecticides. Carboxylesterases underwent two divergent evolutionary events: (1) quantitative mechanism characterized by the overproduction of carboxylesterase protein; and (2) qualitative mechanism caused by changes in enzymatic properties because of mutation from glycine/alanine to aspartate at the 151 site (G/A151D) or from tryptophan to leucine at the 271 site (W271L), following the numbering of Drosophila melanogaster AChE. Qualitative mechanism has been observed in few species. However, whether this carboxylesterase mutation mechanism is prevalent in insects remains unclear. In this study, wild-type, G/A151D and W271L mutant carboxylesterases from Culex pipiens and Aphis gossypii were subjected to germline transformation and then transferred to D. melanogaster. These germlines were ubiquitously expressed as induced by tub-Gal4. In carboxylesterase activity assay, the introduced mutant carboxylesterase did not enhance the overall carboxylesterase activity of flies. This result indicated that G/A151D or W271L mutation disrupted the original activities of the enzyme. Less than 1.5-fold OP resistance was only observed in flies expressing A. gossypii mutant carboxylesterases compared with those expressing A. gossypii wild-type carboxylesterase. However, transgenic flies universally showed low resistance to OP insecticides compared with non-transgenic flies. The flies expressing A. gossypii W271L mutant esterase exhibited 1.5-fold resistance to deltamethrin, a pyrethroid insecticide compared with non-transgenic flies. The present transgenic Drosophila system potentially showed that a quantitative increase in carboxylesterases induced broader resistance of insects to insecticides than a qualitative change. Copyright © 2014 Elsevier Inc. All rights reserved.

  11. Bioefficacy of gamma radiation on Phenacoccus solenopsis (Hemiptera: pseudococcidae)

    International Nuclear Information System (INIS)

    Zarin, Mahtab; Zubeda; Seth, R.K.; Seth, Ranjana

    2012-01-01

    Ionizing radiation can be considered as a possible alternative for treating agricultural products to overcome quarantine barriers against the Solenopsis mealy bug, Phenacoccus solenopsis (Hemiptera: Pseudococcidae). Exposure of ionizing radiation is one of the quarantine treatments which penetrate commodities quickly and most commodities can tolerate irradiation at doses that kill the pest. Evaluation of various bio-characteristics (survival, metamorphosis and reproductive potential) of Phenacoccus solenopsis irradiated in various life stages was attempted to ascertain the lethal doses and sublethal doses having sterilizing potential. A dose of 40Gy administered to the first instar nymph (N 1 ) inhibited formation of adult male, whereas 100Gy checked the transformation of N 1 up to adult female. Males exhibited short life span and appeared to have no or limited role in progeny formation. Males were more radio-sensitive than the female mealy bugs. Further, in case of N 2 treatment, a dose of 100Gy completely inhibited adult male formation, and 150 Gy could completely inhibit male adult formation. The sexes were discernible only after N 2 . A dose of 500Gy given to female-N 3 totally inhibited adult formation. The developmental period of female N 3 was protracted with increase in radiation dosage. The efficacy of radiation at dose range, 5-300Gy, was evaluated on N 3 and N 4 male nymphs. Irradiation affected metamorphosis and reduced adult formation. For instance, a dose of 300Gy caused 0% male adult development from N 4 . 400Gy was almost sterilizing dose for 11-12 day old female mealy bug, and this sterilizing dose reduced oviposition by 28.1%; whereas 200Gy was found to induce sterility in 5-6 day old female mealy bug, with about 50% reduction in oviposition. The freshly emerged female adults (0-1 day old) was the most sensitive stage than the adult mealy bugs in their older phase, and it was completely sterilized by 40Gy. The data suggests a definite role of

  12. Characterizing Damage of Brown Marmorated Stink Bug (Hemiptera: Pentatomidae) in Blueberries.

    Science.gov (United States)

    Wiman, Nik G; Parker, Joyce E; Rodriguez-Saona, Cesar; Walton, Vaughn M

    2015-06-01

    Brown marmorated stink bug, Halyomorpha halys (Stål) (Hemiptera: Pentatomidae), is a severe economic pest of growing importance in the United States, Canada, and Europe. While feeding damage from H. halys has been characterized in tree fruit, vegetables, and agronomic crops, less is known about the impacts of stink bugs on small fruits such as blueberries. In this study, we examined H. halys feeding on two representative early and late ripening blueberry cultivars in Oregon and New Jersey. This research examined how different densities of H. halys confined on blueberry clusters for week-long periods affected fruit quality at harvest. After fruit were ripe, we stained and quantified the number of salivary sheaths on berries as an indication of feeding pressure. Feeding by H. halys damaged the fruits by causing increased levels of external discoloration, and internal damage in the form of tissue necrosis. Exposure of berries to H. halys was also associated with decreasing berry weights and lower soluble solids in fruits. However, the different cultivars did not respond consistently to feeding pressure from H. halys. Weekly variability in feeding pressure of two of the cultivars as quantified by the number of stylet sheaths per berry was largely accounted for by environmental variables. We conclude that H. halys does have potential to severely damage blueberries and may become an important economic pest. Characterization of damage is important because correct identification of insect damage is key for successful management. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  13. Prevalensi cendawan entomopatogenik, Neozygites fumosa (Speare Remaudie’re & Keller (Zygomycetes: Entomophthorales pada populasi kutu putih, Paracoccus marginatus Williams & Granara De Willink (Hemiptera: Pseudococcidae di wilayah Bogor

    Directory of Open Access Journals (Sweden)

    Anik Nurhayati

    2015-09-01

    Full Text Available The prevalence of entomopathogenic fungus, Neozygites fumosa (Zygomycetes: Entomo-phthorales on the papaya mealybug, Paracoccus marginatus (Hemiptera: Pseudococcidae, was studied in Bogor in two districts: Bubulak and Rancabungur in 2011. Thirty plants of either papaya or cassavas were sampled 8 times, once a week for insect population and biweekly for the fungus infection sampling. The results showed that the cassava mealybug was not found on both plants and all locations. The populations of papaya mealybug in Bubulak were higher than in Rancabungur. The populations of papaya mealybug on papaya were higher than those of cassava. However, N. fumosa infection levels on both plants and both locations were not significantly different.

  14. Facultative symbiont Hamiltonella confers benefits to Bemisia tabaci (Hemiptera: Aleyrodidae), an invasive agricultural pest worldwide.

    Science.gov (United States)

    Su, Qi; Oliver, Kerry M; Pan, Huipeng; Jiao, Xiaoguo; Liu, Baiming; Xie, Wen; Wang, Shaoli; Wu, Qingjun; Xu, Baoyun; White, Jennifer A; Zhou, Xuguo; Zhang, Youjun

    2013-12-01

    Bacterial symbionts infect most insect species, including important pests such as whitefly, Bemisia tabaci (Gennadius) (Hemiptera: Aleyrodidae), and often exert important effects on host ecology. The facultative symbiont Hamiltonella is found at high frequencies in the B. tabaci MED (type: Mediterranean-MED) in China. The prevalence of this symbiont in natural populations suggests beneficial effects of infection or manipulation of host reproduction. To date, however, no empirical studies on the biological role of Hamiltonella on the host B. tabaci have been reported. Here, we investigated the effects of Hamiltonella infection on the sex ratio and several fitness parameters in B. tabaci MED by comparing Hamiltonella-infected whiteflies with Hamiltonella-free ones. We found that Hamiltonella-infected whiteflies produced significantly more eggs, exhibited significantly higher nymphal survival, faster development times, and larger adult body size in comparison with Hamiltonella-free whiteflies, while no evidence of reproductive manipulation by Hamiltonella were found in B. tabaci MED. In conclusion, Hamiltonella infection substantially enhanced B. tabaci MED performance. This beneficial role may, at least partially, explain the high prevalence of Hamiltonella in B. tabaci MED populations and may also contribute to their effectiveness in spread of the plant pathogens tomato yellow leaf curl virus.

  15. Molecular and morphological identification of mealybug species (Hemiptera: Pseudococcidae in Brazilian vineyards.

    Directory of Open Access Journals (Sweden)

    Vitor C Pacheco da Silva

    Full Text Available Mealybugs (Hemiptera: Pseudococcidae are pests constraining the international trade of Brazilian table grapes. They damage grapes by transmitting viruses and toxins, causing defoliation, chlorosis, and vigor losses and favoring the development of sooty mold. Difficulties in mealybug identification remain an obstacle to the adequate management of these pests. In this study, our primary aim was to identify the principal mealybug species infesting the major table grape-producing regions in Brazil, by morphological and molecular characterization. Our secondary aim was to develop a rapid identification kit based on species-specific Polymerase Chain Reactions, to facilitate the routine identification of the most common pest species. We surveyed 40 sites infested with mealybugs and identified 17 species: Dysmicoccus brevipes (Cockerell, Dysmicoccus sylvarum Williams and Granara de Willink, Dysmicoccus texensis (Tinsley, Ferrisia cristinae Kaydan and Gullan, Ferrisia meridionalis Williams, Ferrisia terani Williams and Granara de Willink, Phenacoccus baccharidis Williams, Phenacoccus parvus Morrison, Phenacoccus solenopsis Tinsley, Planococcus citri (Risso, Pseudococcus viburni (Signoret, Pseudococcus cryptus Hempel, four taxa closely related each of to Pseudococcus viburni, Pseudococcus sociabilis Hambleton, Pseudococcus maritimus (Ehrhorn and Pseudococcus meridionalis Prado, and one specimen from the genus Pseudococcus Westwood. The PCR method developed effectively identified five mealybug species of economic interest on grape in Brazil: D. brevipes, Pl. citri, Ps. viburni, Ph. solenopsis and Planococcus ficus (Signoret. Nevertheless, it is not possible to assure that this procedure is reliable for taxa that have not been sampled already and might be very closely related to the target species.

  16. Feeding preference ofNezara viridula (Hemiptera: Pentatomidae and attractiveness of soybean genotypes

    Directory of Open Access Journals (Sweden)

    Efrain de Santana Souza

    2013-12-01

    Full Text Available Nezara viridula (L. (Hemiptera: Pentatomidae is a cosmopolitan insect that causes economic damages to several cultures, in particular soybeans (Glycine max [L.] Merr. Among the techniques that involve Integrated Pest Management, the resistance of plants is pointed as a tool of great value and can contribute to the reduction of populations of insects. The feeding preferences of adults of southern green stink bug (N. viridula, and the attractiveness of soybean genotypes were evaluated under laboratory conditions to detect the most resistant material against attack from this insect. A choice test, using mature grains and green pods of the genotypes was carried out, in which the number of individuals attracted in different periods was counted. Feeding preference was evaluated in the choice tests using green pods and the number of pricks and the average time spent feeding by pricks were evaluated. In addition, texture and trichome density in the green pods were evaluated. The mature grains of 'TMG 117RR' and 'TMG 121RR' were less attractive to the adults of N. viridula. Regarding the green pods, 'IAC 17' and PI 227687 were less attractive; 'IAC 17' and 'IAC PL1' were less consumed, indicating the feeding non-preference as a resistance mechanism. 'IAC 17', 'TMG-117RR' and PI 227687 presented high levels of trichome density, and in 'IAC 17' this morphological characteristic was considered to be the main resistance factor against N. viridula. These results may be useful for breeding programs that focus on the resistance of soybeans to insects.

  17. Dispersion patterns and sampling plans for Diaphorina citri (Hemiptera: Psyllidae) in citrus.

    Science.gov (United States)

    Sétamou, Mamoudou; Flores, Daniel; French, J Victor; Hall, David G

    2008-08-01

    The abundance and spatial dispersion of Diaphorina citri Kuwayama (Hemiptera: Psyllidae) were studied in 34 grapefruit (Citrus paradisi Macfad.) and six sweet orange [Citrus sinensis (L.) Osbeck] orchards from March to August 2006 when the pest is more abundant in southern Texas. Although flush shoot infestation levels did not vary with host plant species, densities of D. citri eggs, nymphs, and adults were significantly higher on sweet orange than on grapefruit. D. citri immatures also were found in significantly higher numbers in the southeastern quadrant of trees than other parts of the canopy. The spatial distribution of D. citri nymphs and adults was analyzed using Iowa's patchiness regression and Taylor's power law. Taylor's power law fitted the data better than Iowa's model. Based on both regression models, the field dispersion patterns of D. citri nymphs and adults were aggregated among flush shoots in individual trees as indicated by the regression slopes that were significantly >1. For the average density of each life stage obtained during our surveys, the minimum number of flush shoots per tree needed to estimate D. citri densities varied from eight for eggs to four flush shoots for adults. Projections indicated that a sampling plan consisting of 10 trees and eight flush shoots per tree would provide density estimates of the three developmental stages of D. citri acceptable enough for population studies and management decisions. A presence-absence sampling plan with a fixed precision level was developed and can be used to provide a quick estimation of D. citri populations in citrus orchards.

  18. ORF Alignment: NC_005786 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ssypii ATCC 10895] ref|NP_984597.1| AEL263Cp ... [Eremothecium gossypii] ... Length = 128 ... Query: 4 ... KDIRT...GDRVLCKVGDFPPWPAVVVPQRFLSKLVYSGKRSKSYVCVAFFNDDSYYWKEPRH 63 ... KDIRTGDRVLCKVGDFPPWPAVVVP...QRFLSKLVYSGKRSKSYVCVAFFNDDSYYWKEPRH Sbjct: 1 ... KDIRTGDRVLCKVGDFPPWPAVVVPQRFLSKLVY

  19. Sobre o condicionamento alimentar na cochonilha-branca, Planococcus citri (Risso (Hemiptera: pseudococcidae Regarding to host conditioning in citrus mealybug Planococcus citri (Risso (Hemiptera: pseudococcidae

    Directory of Open Access Journals (Sweden)

    Lenira Viana Costa Santa-Cecília

    2013-03-01

    Full Text Available Estudos do comportamento alimentar mediante a técnica de "Electrical Penetration Graphs" (EPG das cochonilhas-farinhentas (Pseudococcidae provenientes de um hospedeiro de criação alternativo têm mostrado que esses insetos não atingem ou demoram cerca de 9 horas para alcançar a fase floemática. Por outro lado, aqueles provenientes do hospedeiro-fonte atingem a fase floemática mais rapidamente e apresentam maior frequência de alimentação nos vasos crivados. Esses resultados indicam a presença do fenômeno de condicionamento alimentar, ainda não demonstrado em cochonilhas. Assim, o presente trabalho teve como objetivo determinar a existência desse fenômeno em Planococcus citri (Risso (Hemiptera: Pseudococcidae. Foram realizados testes de livre escolha, monitoramento eletrônico (EPG e estudos de alguns parâmetros biológicos. Em todos os experimentos, o cafeeiro (Coffea arabica L., os citros (Citrus sinensis L. e abóbora (Cucurbita maxima L. foram utilizados como substratos de criação (fonte da cochonilha, sendo os tratamentos constituídos pela combinação entre os hospedeiros-fonte e os hospedeiros receptores (café e citros. O teste de escolha entre cafeeiro e citros nas primeiras 72 horas mostrou que as cochonilhas criadas em cafeeiro apresentaram preferência pelo cafeeiro; aquelas originadas dos citros mostraram uma tendência, embora não significativa, em selecionar os citros em relação ao cafeeiro e aquelas criadas em abóbora não mostraram preferência por nenhum dos hospedeiros. Os estudos do comportamento alimentar mediante o monitoramento eletrônico (EPG mostraram que a fase floemática, considerada como a fase de aceitação do hospedeiro, foi mais frequente em cafeeiro, seja com cochonilhas oriundas deste substrato, seja de citros. Aqueles insetos mantidos em abóbora e transferidos para o cafeeiro ou citros apresentaram excepcionalmente ou não apresentaram nenhuma fase floemática, respectivamente. A

  20. The cotton mealybug, Phenacoccus solenopsis Tinsley (Hemiptera: Pseudococcidae as a new menace to cotton in Egypt and its chemical control

    Directory of Open Access Journals (Sweden)

    El-Zahi El-Zahi Saber

    2016-04-01

    Full Text Available The cotton mealybug, Phenacoccus solenopsis Tinsley (Hemiptera: Pseudococcidae is a polyphagous sap sucking insect with a wide geographical and host range causing severe losses in economically important crops. This study represents the first record of P. solenopsis as a new insect attacking cotton plants (Gossypium barbadense var. Giza 86 in Kafr El-Sheikh governorate, Egypt. The insect was noticed on cotton plants for the first time during its growing season of 2014. The mealybug specimens were collected from infested cotton plants and identified as P. solenopsis. In an attempt to control this pest, eight toxic materials viz., imidacloprid, thiamethoxam, flonicamid, emamectin-benzoate, chlorpyrifos, methomyl, deltamethrin and mineral oil (KZ-oil, belonging to different chemical groups, were tested for their influence against P. solenopsis on cotton under field conditions. Methomyl, imidacloprid, thiamethoxam and chlorpyrifos showed the highest efficacy against P. solenopsis recording 92.3 to 80.4% reduction of the insect population. Flonicamid, emamectin-benzoate and KZ-oil failed to exhibit sufficient P. solenopsis control.

  1. Characterization of a Newly Discovered Symbiont of the Whitefly Bemisia tabaci (Hemiptera: Aleyrodidae)

    Science.gov (United States)

    Bing, Xiao-Li; Yang, Jiao; Zchori-Fein, Einat; Wang, Xiao-Wei

    2013-01-01

    Bemisia tabaci (Hemiptera: Aleyrodidae) is a species complex containing >28 cryptic species, some of which are important crop pests worldwide. Like many other sap-sucking insects, whiteflies harbor an obligatory symbiont, “Candidatus Portiera aleyrodidarum,” and a number of secondary symbionts. So far, six genera of secondary symbionts have been identified in B. tabaci. In this study, we report and describe the finding of an additional bacterium in the indigenous B. tabaci cryptic species China 1 (formerly known as B. tabaci biotype ZHJ3). Phylogenetic analysis based on the 16S rRNA and gltA genes showed that the bacterium belongs to the Alphaproteobacteria subdivision of the Proteobacteria and has a close relationship with human pathogens of the genus Orientia. Consequently, we temporarily named it Orientia-like organism (OLO). OLO was found in six of eight wild populations of B. tabaci China 1, with the infection rate ranging from 46.2% to 76.8%. Fluorescence in situ hybridization (FISH) of B. tabaci China 1 in nymphs and adults revealed that OLOs are confined to the bacteriome and co-occur with “Ca. Portiera aleyrodidarum.” The vertical transmission of OLO was demonstrated by detection of OLO at the anterior pole end of the oocytes through FISH. Quantitative PCR analysis of population dynamics suggested a complex interaction between “Ca. Portiera aleyrodidarum” and OLO. Based on these results, we propose “Candidatus Hemipteriphilus asiaticus” for the classification of this symbiont from B. tabaci. PMID:23144129

  2. Evaluation of Vaccinium spp. for Illinoia pepperi (Hemiptera: Aphididae) performance and phenolic content.

    Science.gov (United States)

    Ranger, Christopher M; Johnson-Cicalese, Jennifer; Polavarapu, Sridhar; Vorsa, Nicholi

    2006-08-01

    Host acceptance and population parameters of the aphid Illinoia pepperi (MacGillivray) (Hemiptera: Aphididae) were measured on highbush blueberry, Vaccinium corymbosum L. 'Elliott', and the wild species Vaccinium boreale Hall and Aalders, Vaccinium tenellum Aiton, Vaccinium pallidum Aiton, Vaccinium hirsutum Buckley, Vaccinium myrsinites Lamarck, and Vaccinium darrowi Camp. After 24 h of exposure, significantly fewer aphids remained in contact with V. boreale and V. hirsutum compared with V. corymbosum Elliott, V. darrowi, and V. pallidum. Length of the prereproductive period of I. pepperi was significantly longer on V. boreale and V. myrsinites, in contrast to V. corymbosum. Fecundity was also lower on V. boreale, V. hirsutum, V. myrsinites, and V. darrowi. Survivorship of I. pepperi 42 d after birth was significantly lower on V. hirsutum compared with the remaining Vaccinium spp. Reduced I. pepperi performance resulted in significantly lower intrinsic rate of increase (r(m)) values being associated with V. myrsinites, V. boreale, V. hirsutum, and V. darrowi, compared with V. corymbosum. Net reproductive rate (R(o)), generation time (T), and doubling time (T(d)) of I. pepperi also were affected by the Vaccinium spp. Total phenolic and flavonol content varied between Vaccinium spp., with some high phenolic content Vaccinium spp. having reduced aphid performance. However, no significant correlation between phenolics and I. pepperi performance was detected. Results from this study identified several potential sources of aphid resistance traits in wild Vaccinium spp.

  3. Biology and life table parameters of Brevicoryne brassicae (Hemiptera: Aphididae) on cauliflower cultivars.

    Science.gov (United States)

    Jahan, Fatemeh; Abbasipour, Habib; Askarianzadeh, Alireza; Hassanshahi, Golamhossein; Saeedizadeh, Ayatallah

    2014-01-01

    In this article, the biology and fertility life table parameters of the cabbage aphid, Brevicoryne brassicae (L.) (Hemiptera: Aphididae), were studied on cauliflower leaves, Brassica oleracea var. botrytis (Brassicales: Brassicaceae), of the cultivars Smilla, Snow mystique, White cloud, Buris, Galiblanka, Snow crown, SG, and Tokita. This study was conducted under controlled conditions: 25 ± 2°C, 65 ± 5% relative humidity (RH), and 16:8 (L:D) h photoperiods. Statistical analysis showed that there was a significant difference (P < 0.05) between the different growth stages and the mean number of laid nymphs. Further, the maximum and minimum growth periods were observed on Galiblanka and Buris cultivars, respectively. The shortest nymphal instar growth period was observed on the Smilla cultivar (6.70 d), and the longest lifespan was seen on the White cloud (8.10 d). The Smilla cultivar (39%), in an adult emergence stage, and the SG (88%) revealed the lowest and highest rates of survival, respectively. Aphids reared on the Smilla cultivar were found to have increased due to the high intrinsic (r(m)) and finite (λ) rate of increase and the low doubling time (DT). The results indicated that the application of cultivars affecting adult reproductive parameters could be a good solution to cabbage aphid control management. © The Author 2014. Published by Oxford University Press on behalf of the Entomological Society of America.

  4. Morphometric comparisons of Diaphorina citri (Hemiptera: Liviidae populations from Iran, USA and Pakistan

    Directory of Open Access Journals (Sweden)

    Mohammadreza Lashkari

    2015-05-01

    Full Text Available The Asian citrus psyllid (ACP, Diaphorina citri Kuwayama (Hemiptera: Liviidae, vector of citrus greening disease pathogen, Huanglongbing (HLB, is considered the most serious pest of citrus in the world. Prior molecular based studies have hypothesized a link between the D. citri in Iran and the USA (Florida. The purpose of this study was to collect morphometric data from D. citri populations from Iran (mtCOI haplotype-1, Florida (mtCOI haplotype-1, and Pakistan (mtCOI haplotype-6, to determine whether different mtCOI haplotypes have a relationship to a specific morphometric variation. 240 samples from 6 ACP populations (Iran—Jiroft, Chabahar; Florida—Ft. Pierce, Palm Beach Gardens, Port St. Lucie; and Pakistan—Punjab were collected for comparison. Measurements of 20 morphological characters were selected, measured and analysed using ANOVA and MANOVA. The results indicate differences among the 6 ACP populations (Wilks’ lambda = 0.0376, F = 7.29, P < 0.0001. The body length (BL, circumanal ring length (CL, antenna length (AL, forewing length (WL and Rs vein length of forewing (RL were the most important characters separating the populations. The cluster analysis showed that the Iran and Florida populations are distinct from each other but separate from the Pakistan population. Thus, three subgroups can be morphologically discriminated within D. citri species in this study, (1 Iran, (2 USA (Florida and (3 Pakistan population. Morphometric comparisons provided further resolution to the mtCOI haplotypes and distinguished the Florida and Iranian populations.

  5. Processed kaolin affects the probing and settling behavior of Diaphorina citri (Hemiptera: Lividae).

    Science.gov (United States)

    Miranda, Marcelo P; Zanardi, Odimar Z; Tomaseto, Arthur F; Volpe, Haroldo Xl; Garcia, Rafael B; Prado, Ernesto

    2018-03-05

    Alternative methods that have the potential to reduce the entry of Diaphorina citri Kuwayama (Hemiptera: Liviidae), the major citrus pest worldwide, into commercial groves could be a viable approach for huanglongbing management. Kaolin is an aluminum silicate that when sprayed on plants forms a white particle film that interferes with host recognition by the insects. Diaphorina citri orients towards the host plants by visual and olfactory cues. The purpose of the study was to determine the effect of processed kaolin on D. citri settling (no-choice) and probing behavior [electrical penetration graph (EPG) technique] under laboratory conditions, and to study its host plant finding ability and dispersal under field conditions in the absence and presence of young shoots. Under laboratory conditions, kaolin caused an overall reduction of 40% in the number of psyllids settled on treated seedlings; furthermore, the proportion of individuals that were able to reach the phloem was 50% lower on kaolin-treated plants than on untreated plants. In the field, the plant finding ability of D. citri was disrupted on kaolin-treated trees (overall reduction of 96%), regardless of the vegetative condition, and psyllid dispersal was slower in kaolin-treated plots than in the untreated control. This study clearly demonstrates that processed kaolin interferes negatively with different aspects of the host plant finding ability of D. citri. These findings suggest that processed kaolin has a high potential to reduce huanglongbing primary infection. © 2018 Society of Chemical Industry. © 2018 Society of Chemical Industry.

  6. ORF Alignment: NC_005787 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available sypii ATCC 10895] ref|NP_985616.1| AFR069Cp ... [Eremothecium gossypii] ... Length = 62 ... Query: 34 GAGAGCPVCQNCHTST...TPLWRRDEHGAVLCNACGLFLKLHGRPRPISLKTDVIKSRN 90 ... GAGAGCPVCQNCHTSTTPLWRRDEHGAVLCNAC...GLFLKLHGRPRPISLKTDVIKSRN Sbjct: 1 ... GAGAGCPVCQNCHTSTTPLWRRDEHGAVLCNACGLFLKLHGRPRPISLKTDVIKSRN 57

  7. The entomopathogenic fungal endophytes Purpureocillium lilacinum (formerly Paecilomyces lilacinus) and Beauveria bassiana negatively affect cotton aphid reproduction under both greenhouse and field conditions.

    Science.gov (United States)

    Castillo Lopez, Diana; Zhu-Salzman, Keyan; Ek-Ramos, Maria Julissa; Sword, Gregory A

    2014-01-01

    The effects of two entomopathogenic fungal endophytes, Beauveria bassiana and Purpureocillium lilacinum (formerly Paecilomyces lilacinus), were assessed on the reproduction of cotton aphid, Aphis gossypii Glover (Homoptera:Aphididae), through in planta feeding trials. In replicate greenhouse and field trials, cotton plants (Gossypium hirsutum) were inoculated as seed treatments with two concentrations of B. bassiana or P. lilacinum conidia. Positive colonization of cotton by the endophytes was confirmed through potato dextrose agar (PDA) media plating and PCR analysis. Inoculation and colonization of cotton by either B. bassiana or P. lilacinum negatively affected aphid reproduction over periods of seven and 14 days in a series of greenhouse trials. Field trials were conducted in the summers of 2012 and 2013 in which cotton plants inoculated as seed treatments with B. bassiana and P. lilacinum were exposed to cotton aphids for 14 days. There was a significant overall effect of endophyte treatment on the number of cotton aphids per plant. Plants inoculated with B. bassiana had significantly lower numbers of aphids across both years. The number of aphids on plants inoculated with P. lilacinum exhibited a similar, but non-significant, reduction in numbers relative to control plants. We also tested the pathogenicity of both P. lilacinum and B. bassiana strains used in the experiments against cotton aphids in a survival experiment where 60% and 57% of treated aphids, respectively, died from infection over seven days versus 10% mortality among control insects. Our results demonstrate (i) the successful establishment of P. lilacinum and B. bassiana as endophytes in cotton via seed inoculation, (ii) subsequent negative effects of the presence of both target endophytes on cotton aphid reproduction using whole plant assays, and (iii) that the P. lilacinum strain used is both endophytic and pathogenic to cotton aphids. Our results illustrate the potential of using these

  8. The entomopathogenic fungal endophytes Purpureocillium lilacinum (formerly Paecilomyces lilacinus and Beauveria bassiana negatively affect cotton aphid reproduction under both greenhouse and field conditions.

    Directory of Open Access Journals (Sweden)

    Diana Castillo Lopez

    Full Text Available The effects of two entomopathogenic fungal endophytes, Beauveria bassiana and Purpureocillium lilacinum (formerly Paecilomyces lilacinus, were assessed on the reproduction of cotton aphid, Aphis gossypii Glover (Homoptera:Aphididae, through in planta feeding trials. In replicate greenhouse and field trials, cotton plants (Gossypium hirsutum were inoculated as seed treatments with two concentrations of B. bassiana or P. lilacinum conidia. Positive colonization of cotton by the endophytes was confirmed through potato dextrose agar (PDA media plating and PCR analysis. Inoculation and colonization of cotton by either B. bassiana or P. lilacinum negatively affected aphid reproduction over periods of seven and 14 days in a series of greenhouse trials. Field trials were conducted in the summers of 2012 and 2013 in which cotton plants inoculated as seed treatments with B. bassiana and P. lilacinum were exposed to cotton aphids for 14 days. There was a significant overall effect of endophyte treatment on the number of cotton aphids per plant. Plants inoculated with B. bassiana had significantly lower numbers of aphids across both years. The number of aphids on plants inoculated with P. lilacinum exhibited a similar, but non-significant, reduction in numbers relative to control plants. We also tested the pathogenicity of both P. lilacinum and B. bassiana strains used in the experiments against cotton aphids in a survival experiment where 60% and 57% of treated aphids, respectively, died from infection over seven days versus 10% mortality among control insects. Our results demonstrate (i the successful establishment of P. lilacinum and B. bassiana as endophytes in cotton via seed inoculation, (ii subsequent negative effects of the presence of both target endophytes on cotton aphid reproduction using whole plant assays, and (iii that the P. lilacinum strain used is both endophytic and pathogenic to cotton aphids. Our results illustrate the potential of

  9. Monitoring of aphid flight activities in seed potato crops in Serbia

    Directory of Open Access Journals (Sweden)

    Andja Vucetic

    2013-07-01

    Full Text Available Aphid flight activities in seed potato fields have been studied by the yellow water traps. It is a good method for monitoring aphids as vectors of viruses, but this study also showed it is a suitable method for insect-diversity research. During the four-year studies, over 11.500 specimens were collected and a total of 107 different taxa of aphids were identified. The most abundant species were polyphagous species, such as: Acyrthosiphon pisum (Haris, Aphis fabae Scopoli, Aphis gossypii Glover and Brachycaudus helichrysi (Kaltenbach. The results of the studies show that diversity of aphids in different regions of Serbia is similar regardless of the altitude and the diversity of terrain. At most sites it ranged from 2 to 3. The highest value was recorded in Begeč, locality in northern part of Serbia, in year 2008, and it was 2.92. The maximum values of the Shannon-Weaver diversity index at all sites were recorded in the first weeks of the monitoring of aphid flight activities. Morisita-Horn similarity index shows no significant differences between sites regardless of altitudes. The sites are grouped by year, not by similarity of relief. In spite of these results, the Chi-square analysis showed highly significant difference in vector frequencies among seasons and sites with more pronounced differences for PVY. As a consequence of differences in vector frequencies, the vector pressure index in some regions was different also. The number of vectors and vector pressure index vary depending on the altitude of localities. At localities at altitudes under 1000 m, they were high. The highest index was at Kotraža, locality in central part of Serbia, in 2007, when PVY index exceeded the value of 180, while for PLRV it was 60. At high altitudes on mountain Golija, above 1100 m, the number of aphids was low, as well as the vector pressure index which indicates that these regions are suitable for producing virus-free seed potato.

  10. Amino acid transporter expansions associated with the evolution of obligate endosymbiosis in sap-feeding insects (Hemiptera: sternorrhyncha).

    Science.gov (United States)

    Dahan, Romain A; Duncan, Rebecca P; Wilson, Alex C C; Dávalos, Liliana M

    2015-03-25

    Mutualistic obligate endosymbioses shape the evolution of endosymbiont genomes, but their impact on host genomes remains unclear. Insects of the sub-order Sternorrhyncha (Hemiptera) depend on bacterial endosymbionts for essential amino acids present at low abundances in their phloem-based diet. This obligate dependency has been proposed to explain why multiple amino acid transporter genes are maintained in the genomes of the insect hosts. We implemented phylogenetic comparative methods to test whether amino acid transporters have proliferated in sternorrhynchan genomes at rates grater than expected by chance. By applying a series of methods to reconcile gene and species trees, inferring the size of gene families in ancestral lineages, and simulating the null process of birth and death in multi-gene families, we uncovered a 10-fold increase in duplication rate in the AAAP family of amino acid transporters within Sternorrhyncha. This gene family expansion was unmatched in other closely related clades lacking endosymbionts that provide essential amino acids. Our findings support the influence of obligate endosymbioses on host genome evolution by both inferring significant expansions of gene families involved in symbiotic interactions, and discovering increases in the rate of duplication associated with multiple emergences of obligate symbiosis in Sternorrhyncha.

  11. The effects of host, geographic origin, and gender on the thermal requirements of Diaphorina citri (Hemiptera: Psyllidae).

    Science.gov (United States)

    Nava, Dori E; Gomez-Torres, Mariuxi L; Rodrigues, Marjorie D; Bento, José M S; Haddad, Marinéia L; Parra, José R P

    2010-04-01

    Diaphorina citri Kuwayama (Hemiptera: Psyllidae) is the vector of the bacteria that causes citrus greening and is considered one of the world's most important citrus diseases. We examined how host, geographic region, and gender affect the thermal requirements of D. citri. The insects were reared in climatic chambers at constant temperatures of 18, 20, 22, 25, 28, 30, and 32 +/- 1 degrees C, 70 +/- 10% RH, and a 14 h photophase. Host plants for D. citri included orange (Citrus sinensis [Rutaceae]) varieties Pêra and Natal, the rootstock, Rungpur lime (C. limonia [Rutaceae]) and the natural host, Orange jessamine (Murraya paniculata [Rutaceae]). To study the influence of geographic origin on thermal requirements, we studied D. citri populations from Piracicaba, SP (warmer region) and Itapetininga, SP (cooler region). The duration and survival of the development stages and the duration of the total development (egg-adult) did not differ significantly on the different hosts, but it did vary with temperature. Nymphs of D. citri created on the different hosts have the same thermal requirements. The thermal requirements for this species collected from the two climate regions were identical; males and females also had the same thermal requirements.

  12. An experimental test of rainfall as a control agent of Glycaspis brimblecombei Moore (Hemiptera, Psyllidae on seedlings of Eucalyptus camaldulensis Dehn (Myrtaceae

    Directory of Open Access Journals (Sweden)

    Karla N. Oliveira

    2012-03-01

    Full Text Available An experimental test of rainfall as a control agent of Glycaspis brimblecombei Moore (Hemiptera, Psyllidae on seedlings of Eucalyptus camaldulensis Dehn (Myrtaceae. Glycaspis brimblecombei is one the greatest threats to eucalyptus plantations in Brazil. The effects of rainfall to reduce the abundance of lerp of Glycaspis brimblecombei on experimentally infested seedlings of Eucalyptus camaldulensis were assessed. The number of lerps on the adaxial and abaxial surfaces of every leaf of 60 seedlings was recorded, before and after submission to the following treatments: "artificial rain", "leaf wetting" and control. A drastic reduction in lerp abundance per plant was observed after the treatments "leaf wetting" and artificial rain (F = 53.630; p Teste experimental da chuva como agente de controle de Glycaspis brimblecombei Moore (Hemiptera, Psyllidae em mudas de Eucalyptus camaldulensis Dehn (Myrtaceae. Glycaspis brimblecombei é uma das maiores ameaças das plantações de eucalipto do Brasil. Foram avaliados os efeitos da água na redução da abundância de conchas desse inseto em mudas de Eucalyptus camaldulensis infestadas experimentalmente. Foi quantificado o número de conchas nas superfícies adaxial e abaxial de todas as folhas de 60 mudas, antes e após a aplicação dos seguintes tratamentos: "chuva artificial", "molhamento das folhas" e controle. Foi observada uma drástica redução na abundância de conchas nos tratamentos "chuva artificial" e "molhamento das folhas" (F = 53,630; p < 0,001, o que não ocorreu para o tratamento controle ao longo do experimento (F = 1,450; p = 0,232. Ao final do experimento, a abundância de conchas foi significativamente menor no tratamento "chuva artificial" e "molhamento das folhas" do que no tratamento controle. Dessa forma, dois dias de chuva mostraram ser eficientes para diminuir mais que 50% da população de conchas, com quase 100% de eficiência após 5 dias de experimento. Nossos resultados

  13. Aphis (Hemiptera: Aphididae) species groups found in the Midwestern United States and their contribution to the phylogenetic knowledge of the genus.

    Science.gov (United States)

    Lagos, Doris M; Voegtlin, David J; Coeur d'acier, Armelle; Giordano, Rosanna

    2014-06-01

    A phylogeny of the genus Aphis Linnaeus, 1 758 was built primarily from specimens collected in the Midwest of the United States. A data matrix was constructed with 68 species and 41 morphological characters with respective character states of alate and apterous viviparous females. Dendrogram topologies of analyses performed using UPGMA (Unweighted Pair Group Method with Arithmetic Mean), Maximum Parsimony and Bayesian analysis of Cytochrome Oxidase I, Elongation Factor 1-α and primary endosymbiont Buchnera aphidicola 16S sequences were not congruent. Bayesian analysis strongly supported most terminal nodes of the phylogenetic trees. The phylogeny was strongly supported by EF1-α, and analysis of COI and EF1-α molecular data combined with morphological characters. It was not supported by single analysis of COI or Buchnera aphidicola 16S. Results from the Bayesian phylogeny show 4 main species groups: asclepiadis, fabae, gossypii, and middletonii. Results place Aphis and species of the genera Protaphis Börner, 1952, Toxoptera Koch, and Xerobion Nevsky, 1928 in a monophyletic clade. Morphological characters support this monophyly as well. The phylogeny shows that the monophyletic clade of the North American middletonii species group belong to the genus Protaphis: P. debilicornis (Gillette & Palmer, 1929), comb. nov., P. echinaceae (Lagos and Voegtlin, 2009), comb. nov., and P. middletonii (Thomas, 1879). The genus Toxoptera should be considered a subgenus of Aphis (stat. nov.). The analysis also indicates that the current genus Iowana Frison, 1954 should be considered a subgenus of Aphis (stat. nov.). © 2013 Institute of Zoology, Chinese Academy of Sciences.

  14. Tip of the clade on the top of the World—the first fossil Lophopidae (Hemiptera: Fulgoromorpha) from the Palaeocene of Tibet

    Science.gov (United States)

    Szwedo, Jacek; Stroiński, Adam; Lin, Qibin

    2015-06-01

    Lophopidae is a family of planthoppers (Hemiptera: Fulgoromorpha) present today in tropical and subtropical zones of the Old World. The most recent taxonomic studies and phylogeny of these insects do not include the extinct representatives. Therefore, each new discovery of a fossil lophopid is of high interest, giving new insights to their evolutionary history and enabling to test the proposed relationships. The recent findings of extinct Lophopidae in Europe, in various Palaeogene deposits, put in doubts their proposed evolutionary and biogeographic scenario. The new fossil from the Palaeocene of Northern Tibet is related to one of the Lophopidae clades, Apia+ group, believed to be the most advanced one, and recently distributed in the recent Sundaland-New Guinea-Queensland area. A new genus and species Gesaris gnapo gen. et sp. n. provide information on early lophopids diversity and relationships and demonstrates the necessity for a revision of the existing hypotheses for the initial diversification and distributional pattern of the Lophopidae.

  15. Elongation Factor-1α Accurately Reconstructs Relationships Amongst Psyllid Families (Hemiptera: Psylloidea), with Possible Diagnostic Implications.

    Science.gov (United States)

    Martoni, Francesco; Bulman, Simon R; Pitman, Andrew; Armstrong, Karen F

    2017-12-05

    The superfamily Psylloidea (Hemiptera: Sternorrhyncha) lacks a robust multigene phylogeny. This impedes our understanding of the evolution of this group of insects and, consequently, an accurate identification of individuals, of their plant host associations, and their roles as vectors of economically important plant pathogens. The conserved nuclear gene elongation factor-1 alpha (EF-1α) has been valuable as a higher-level phylogenetic marker in insects and it has also been widely used to investigate the evolution of intron/exon structure. To explore evolutionary relationships among Psylloidea, polymerase chain reaction amplification and nucleotide sequencing of a 250-bp EF-1α gene fragment was applied to psyllids belonging to five different families. Introns were detected in three individuals belonging to two families. The nine genera belonging to the family Aphalaridae all lacked introns, highlighting the possibility of using intron presence/absence as a diagnostic tool at a family level. When paired with cytochrome oxidase I gene sequences, the 250 bp EF-1α sequence appeared to be a very promising higher-level phylogenetic marker for psyllids. © The Author(s) 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  16. Cold Tolerance of Megacopta cribraria (Hemiptera: Plataspidae): An Invasive Pest of Soybeans.

    Science.gov (United States)

    Grant, Jessica I; Lamp, William O

    2017-12-08

    Kudzu bug, Megacopta cribraria Fabricius (Hemiptera: Plataspidae), first discovered in the United States in 2009, is an invasive pest of soybeans. From 2013 to 2016, Maryland has been the northern limit of its distribution in the United States. We sought to determine the physiological cold temperature limits, timing of movement to overwintering locations, and to characterize overwintering microhabitat temperature. We measured supercooling point (SCP) on three populations from distinct USDA plant hardiness zones in Maryland and Virginia between October and December of 2015. The average SCP across all sample months and populations was -12.6°C and no consistent trend of month or population location were observed. Additionally, we assessed the lower lethal temperature to kill 50% of the population (LLT50) at the same population locations in October and November 2015. The average LLT50 over both months and all three population locations was -5.1°C. Again, no consistent trend based on population location was observed but we did find a modest depression in the LLT50 values between October and November. We observed that kudzu bug overwinters in leaf litter and begins to move into the litter in late November to early December. Leaf litter moderates day to night temperature differences and was warmer than ambient temperature by an average of 0.7°C. Evidence suggests that the cold tolerance of the kudzu bug limits its distribution north of Maryland. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  17. Cryptic Species Identification and Composition of Bemisia tabaci (Hemiptera: Aleyrodidae) Complex in Henan Province, China

    Science.gov (United States)

    Hu, Jian; Wang, Lun-Ji; Dong, Jun-Feng; Song, Yue-Qin; Sun, Hui-Zhong

    2017-01-01

    Abstract Bemisia tabaci (Gennadius) (Hemiptera: Aleyrodidae) is a cryptic species complex, causing significant crop losses in China during the last decade. Although knowledge of cryptic species composition and dynamics within B. tabaci complex is critical for developing sustainable pest management strategies, limited information is available on this pest in the Henan province of China. A systematic survey of the cryptic species composition and distribution of B. tabaci complex in different locations of Henan province was conducted in 2012. The results of RAPD-PCR and the gene for the mitochondrial cytochrome oxidase subunit-1 (mtCOI) based phylogenetic relationships established using Bayesian method indicated there were four known cryptic species MEAM1, MED, Asia II 3, Asia II 9 and a new cryptic species named China 6 in Henan province. In the survey, the invasive cryptic species MED and MEAM1 were found to be predominant with wide spread distribution across the surveyed regions. On the contrary, the indigenous B. tabaci cryptic species including Asia II 3, Asia II 9 and China 6 remained with low prevalence in some surveyed regions. Cryptic species MEAM1 and MED have not completely displaced the native B. tabaci in Henan province. This current study for the first time unifies our knowledge of the diversity and distribution of B. tabaci across Henan province of China. PMID:28973577

  18. Does feeding by Halyomorpha halys (Hemiptera: Pentatomidae) reduce soybean seed quality and yield?

    Science.gov (United States)

    Owens, D R; Herbert, D A; Dively, G P; Reisig, D D; Kuhar, T P

    2013-06-01

    The nonnative brown marmorated stink bug, Halyomorpha halys Stål (Hemiptera: Pentatomidae), has become an abundant pest of mid-Atlantic soybean since its introduction in the mid-1990s. Currently, there is little information indicating how this new pest should be managed in soybean or if economic thresholds developed for native stink bugs should be adjusted. In 2010 and 2011, field cage studies were conducted in Beltsville, MD, and Suffolk, VA, to evaluate H. halys injury to three different soybean reproductive development stages. Cages were infested for 2 wk using densities of zero, one, two, four, or eight stink bugs (fifth instars and adults) per 0.3 row-m. Cage plots were harvested, and subsamples were taken to determine pod losses and seed quality. Feeding injury to soybean caused by H. halys was similar to that of native stink bugs, as evidenced by seed destruction, punctures, and destroyed pods. Densities of four stink bugs per 0.3 row-m resulted in significant seed damage in three of four experiments. The full flowering (R2) soybean development stage was least affected by H. halys feeding. The full pod (R4) and the full seed (R6) stage were similarly sensitive to injury. There was no significant yield loss was associated with stink bug densities at either location, although there were significant differences among stages in two of four experiments. The data do not indicate that threshold densities for H. halys should be different than for the native stink bugs.

  19. Reproduction, longevity and life table parameters of Monosteira unicostata (Hemiptera: Tingidae) at constant temperatures

    Energy Technology Data Exchange (ETDEWEB)

    Sánchez-Ramos, I.; Pascual, S.; Fernández, C.E.; González-Núñez, M.

    2017-07-01

    Information on the effect of temperature on biological parameters of phytophagous insects is one of the tools in IPM programs, as it allows prediction of risk situations in the field. This work reports the effect of temperature on reproductive parameters and longevity of one of the most important current pests of almond orchards in the Mediterranean basin, the poplar lace bug, Monosteira unicostata (Mulsant & Rey) (Hemiptera: Tingidae). The temperatures tested were 22, 25, 28, 31, 34 and 37ºC, always at 60 ± 10% relative humidity and under a L16:D8 photoperiod. Extreme temperatures had an adverse effect on preoviposition period, total fecundity and daily fecundity while increasing values of oviposition period and adults longevity were registered for decreasing temperatures. Male longevity was higher than female longevity, and mortality pattern differed between sexes for all temperatures but 37ºC. The nonlinear Lactin model described accurately the effect of temperature on the intrinsic rate of natural increase of M. unicostata populations and predicted the optimum temperature for population increase at 34.1ºC, at which the population doubling time is 3.6 days. Produced values of lower and upper thresholds for M. unicostata populations were 14.8 and 38.8ºC, respectively. This characterizes the poplar lace bug as a very important pest in the Mediterranean basin, with an increasing potential risk in a global warming scenario.

  20. Effects of temperature and food on the development of Dysdercus maurus Distant (Hemiptera, Pyrrhocoridae)

    International Nuclear Information System (INIS)

    Almeida, Fabio Souto; Goncalves, Lenicio

    2007-01-01

    Dysdercus maurus Distant, 1901 (Hemiptera, Pyrrhocoridae) is an important pest on Gossypium spp. (cotton tree), Citrus sinensis Osbeck (Rutaceae) and Citrus reticulata Blanco (Rutaceae) crops. This insect also feeds on seeds of Chorisia speciosa St. Hil. (Bombacaceae). This work aimed to evaluate the effects of temperature and food on the development of D. maurus. Eight treatments were carried out, in six of them bugs were fed with seeds of C. speciosa and kept at 15, 18, 20, 25 and 30 ± 1 deg C, 80 ± 3% RH and 12h photo phase or in laboratory conditions (23.5 ± 2.6 deg C, 73.3 ± 9.9 % RH), and in the other two treatments bugs were fed with seeds of cotton variety IAC-22 and kept at 25 or 30 deg C. In all treatments five immature stages were observed. The increase of temperature caused reduction in the developmental time. The temperature of 15 deg C disabled nymphal eclosion and was also lethal to those nymphs ecloded at other temperatures. The lower mortality of nymphs occurred in the temperature of 25 deg C with cotton as food (24.07%). The lower threshold temperature (Tb) occurred for the first instar (11.54 deg C) and the higher for the second instar (15.33 deg C). The females of D. maurus required more degree-days (329.93 degree-days) than males (300.49 degree-days) until adult emergence. (author)

  1. Halophilanema prolata n. gen., n. sp. (Nematoda: Allantonematidae, a parasite of the intertidal bug, Saldula laticollis (Reuter(Hemiptera: Saldidae on the Oregon coast

    Directory of Open Access Journals (Sweden)

    Poinar George O

    2012-02-01

    Full Text Available Abstract Background It is rare to find terrestrial nematode lineages parasitizing arthropods inhabiting the intertidal or littoral zone of the oceans. During an ecological study along the Oregon dunes, an allantonematid nematode (Tylenchomorpha: Allantonematidae was discovered parasitizing the intertidal shore bug, Saldula laticollis (Reuter(Hemiptera: Saldidae. This shore bug is adapted to an intertidal environment and can survive short periods of submergence during high tides. The present study describes the nematode parasite and discusses aspects of its development, ecology and evolution. Methods Adults and last instar nymphs of S. laticollis (Hemiptera: Saldidae were collected from the high intertidal zone among clumps of Juncus L. (Juncaceae plants at Waldport, Oregon on October 3, 2011. The bugs were dissected in 1% saline solution and the nematodes killed in 1% Ringers solution and immediately fixed in 5% formalin (at 20°C. Third stage juveniles removed from infected hosts were maintained in 1% saline solution until they matured to the adult stage, molted and mated. Results Halophilanema prolata n. gen., n. sp. (Nematoda: Allantonematidae is described from last instar nymphs and adults of the intertidal bug, Saldula laticollis on the Oregon coast. The new genus can be distinguished from other genera in the Allantonematidae by a stylet lacking basal knobs in both sexes, an excretory pore located behind the nerve ring, ribbed spicules, a gubernaculum, the absence of a bursa and the elongate-tubular shape of the ovoviviparous parasitic females. Studies of the organogenesis of Halophilanema showed development to third stage juveniles in the uterus of parasitic females. Maturation to the free-living adults and mating occurred in the environment. The incidence of infection of S. laticollis ranged from 0% to 85% depending on the microhabitat in the intertidal zone. Conclusions Based on the habitat and morphological characters, it is proposed

  2. Assessment of Feeding Acceptance and Injury of Kerman Pistachios, Pistacia vera, by Brown Marmorated Stink Bug (Hemiptera: Pentatomidae)

    Science.gov (United States)

    Kamiyama, Matthew T; Hernandez, Gabriel; Nay, Justin; Hoddle, Mark S

    2017-01-01

    Abstract In the United States, California (CA) is the primary commercial producer of pistachio nuts, Pistacia vera L. (Anacardiaceae). The brown marmorated stink bug (BMSB), Halyomorpha halys (Stål) (Hemiptera: Pentatomidae), an invasive and polyphagous insect pest from Asia, has established in urban areas in several pistachio-growing counties in CA. Breeding BMSB populations have not been detected in commercial pistachio acreage. However, the detection of BMSB in Kern and Fresno counties, major Kerman pistachio producing areas in CA, underscored key knowledge gaps on BMSB ecology in CA and motivated investigations on the susceptibility of pistachio nuts to BMSB feeding. Laboratory feeding trials conducted in quarantine under permit indicated that adult BMSB stylets can penetrate developing pistachio shells and associated feeding was correlated with kernel necrosis for nuts collected mid to late season (June to August 2016). Feeding damage estimates indicated that higher levels of kernel injury were associated with female BMSB when compared to feeding by male BMSB. These results suggest that there is probable risk of feeding damage to field grown pistachios from BMSB. The implications of this study for BMSB pest management in the CA pistachio system and future research directions are discussed. PMID:29117381

  3. Infestação de Aetalion reticulatum (Linnaeus (Hemiptera: Auchenorrhyncha: Aethalionidae em Plantas de Euterpe oleracea Martius (Arecaceae no Estado do Acre

    Directory of Open Access Journals (Sweden)

    Rodrigo Santos

    2015-04-01

    Abstract. The açai palm (Euterpe oleracea Martius is a native palm tree from the Amazon region floodplains and may be indicated as the most economically profitable species of this genus. Its fruit pulp is extracted and widely consumed by the population of northern Brazil in several ways. With the expansion of the planted area many factors may affect the production and limit the cultivation, highlighting the occurrence of insect pests that cause losses in production. This report presents the first occurrence of the leafhopper Aetalion reticulatum (Linnaeus (Hemiptera: Auchenorrhyncha: Aethalionidae in E. oleracea plants. The occurrence of this insect associated with açai palms in Rio Branco, Acre, increases the list of hosts for this leafhopper in Brazil and reinforces the need for studies of population dynamics, survey of natural enemies, levels of damage and control methods in order to anticipate population outbreaks of this pest in commercial plantations of açai palms in the State.

  4. Selection of Reference Genes for Expression Studies in Diaphorina citri (Hemiptera: Liviidae).

    Science.gov (United States)

    Bassan, Meire Menezes; Angelotti-Mendonc A, Je Ssika; Alves, Gustavo Rodrigues; Yamamoto, Pedro Takao; Moura O Filho, Francisco de Assis Alves

    2017-12-05

    The Asian citrus psyllid, Diaphorina citri Kuwayama (Hemiptera: Liviidae), is considered the main vector of the bacteria associated with huanglongbing, a very serious disease that has threatened the world citrus industry. The absence of efficient control management protocols, including a lack of resistant cultivars, has led to the development of different approaches to study this pathosystem. The production of resistant genotypes relies on D. citri gene expression analyses by RT-qPCR to assess control of the vector population. High-quality, reliable RT-qPCR analyses depend upon proper reference gene selection and validation. However, adequate D. citri reference genes have not yet been identified. In the present study, we evaluated the genes EF 1-α, ACT, GAPDH, RPL7, RPL17, and TUB as candidate reference genes for this insect. Gene expression stability was evaluated using the mathematical algorithms deltaCt, NormFinder, BestKeeper, and geNorm, at five insect developmental stages, grown on two different plant hosts [Citrus sinensis (L.) Osbeck (Sapindales: Rutaceae) and Murraya paniculata (L.) Jack (Sapindales: Rutaceae)]. The final gene ranking was calculated using RefFinder software, and the V-ATPase-A gene was selected for validation. According to our results, two reference genes are recommended when different plant hosts and developmental stages are considered. Considering gene expression studies in D. citri grown on M. paniculata, regardless of the insect developmental stage, GAPDH and RPL7 have the best fit as reference genes in RT-qPCR analyses, whereas GAPDH and EF 1-α are recommended as reference genes in insect studies using C. sinensis. © The Author(s) 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  5. Temperature thresholds and thermal requirements for development of Nasonovia ribisnigri (Hemiptera: Aphididae).

    Science.gov (United States)

    Diaz, Beatriz Maria; Muñiz, Mariano; Barrios, Laura; Fereres, Alberto

    2007-08-01

    Early detection of Nasonovia ribisnigri (Mosley) (Hemiptera: Aphididae) on lettuce is of primary importance for its effective control. Temperature thresholds for development of this pest were estimated using developmental rates [r(T)] at different constant temperatures (8, 12, 16, 20, 24, 26, and 28 degrees C). Observed developmental rates data and temperature were fitted to two linear (Campbell and Muñiz and Gil) and a nonlinear (Lactin) models. Lower temperature threshold estimated by the Campbell model was 3.6 degrees C for apterous, 4.1 degrees C for alates, and 3.1 degrees C for both aphid adult morphs together. Similar values of the lower temperature threshold were obtained with the Muñiz and Gil model, for apterous (4.0 degrees C), alates (4.2 degrees C), and both adult morphs together (3.7 degrees C) of N. ribisnigri. Thermal requirements of N. ribisnigri to complete development were estimated by Campbell and Muñiz and Gil models for apterous in 125 and 129 DD and for both adult morphs together in 143 and 139 DD, respectively. For complete development from birth to adulthood, the alate morph needed 15-18 DD more than the apterous morph. The lower temperature threshold determined by the Lactin model was 5.3 degrees C for alates, 2.3 degrees C for apterous, and 1.9 degrees C for both adult morphs together. The optimal and upper temperature thresholds were 25.2 and 33.6 degrees C, respectively, for the alate morph, 27 and 35.9 degrees C, respectively, for the apterous morph, and 26.1 and 35.3 degrees C, respectively, for the two adult morphs together. The Campbell model provided the best fit to the observed developmental rates data of N. ribisnigri. This information could be incorporated in forecasting models of this pest.

  6. Life table parameters of three Mirid Bug (Adelphocoris species (Hemiptera: Miridae under contrasted relative humidity regimes.

    Directory of Open Access Journals (Sweden)

    Hongsheng Pan

    Full Text Available The genus Adelphocoris (Hemiptera: Miridae is a group of important insect pests of Bt cotton in China. The three dominant species are A. lineolatus, A. suturalis, and A. fasciaticollis, and these species have different population dynamics. The causal factors for the differences in population dynamics have not been determined; one hypothesis is that humidity may be important for the growth of Adelphocoris populations. In the laboratory, the demographic parameters of the three Adelphocoris species were compared when the mirid bugs were subjected to various levels of relative humidity (40, 50, 60, 70 and 80% RH. Middle to high levels of RH (60, 70 and 80% were associated with higher egg and nymph survival rates and increased adult longevity and female fecundity. Lower humidity levels (40 and 50% RH had negative effects on the survival of nymphs, adult longevity and fecundity. The intrinsic rate of increase (rm, the net reproductive rate (R0 and the finite rate of increase (λ for each Adelphocoris species increased with increasing RH. Significant positive relationships were found between RH and the life table parameters, rm, R0 and λ for the three Adelphocoris species. These results will help to better understand the phenology of the three Adelphocoris species, and the information can be used in population growth models to optimize pest forecasting and management strategies for these key pests.

  7. Application of plant growth regulators mitigates chlorotic foliar injury by the black pecan aphid (Hemiptera: Aphididae).

    Science.gov (United States)

    Cottrell, Ted E; Wood, Bruce W; Ni, Xinzhi

    2010-11-01

    Black pecan aphid, Melanocallis caryaefoliae (Davis) (Hemiptera: Aphididae), feeding elicits localized chlorotic injury to pecan foliage [Carya illinoinensis (Wangenh.) K Koch] and apparent acceleration of leaf senescence and defoliation. The ability of certain plant growth regulators (PGRs) (forchlorfenuron, gibberellic acid and aviglycine) to prevent M. caryaefoliae from triggering pecan leaf chlorosis and senescence-like processes was evaluated on two dates in both 2006 and 2007. Treatments were applied to orchard foliage and used in laboratory leaf-disc bioassays to assess possible reduction in aphid-elicited chlorosis and concomitant effects on aphid mortality and development. Foliage pretreated with forchlorfenuron + gibberellic acid prior to being challenged with aphids resulted in significantly less aphid-elicited chlorosis than did control or aviglycine-treated leaf discs. No PGR affected aphid mortality; however, development time was increased by forchlorfenuron + gibberellic acid in 2006 and by aviglycine + gibberellic acid on one date in 2007. Certain PGRs possess the potential for usage on pecan to protect foliar canopies from M. caryaefoliae via changes in the susceptibility of the host leaf to senescence-like factors being introduced by feeding aphids. This protective effect on host foliage and the associated suppressive effect on development of feeding aphids might also be relevant to pest management programs on other aphid-crop systems in which aphid-elicited chlorosis and senescence-like processes can limit profitability. Published 2010 by John Wiley & Sons, Ltd.

  8. Species clarification of Isaria isolates used as biocontrol agents against Diaphorina citri (Hemiptera: Liviidae) in Mexico.

    Science.gov (United States)

    Gallou, Adrien; Serna-Domínguez, María G; Berlanga-Padilla, Angélica M; Ayala-Zermeño, Miguel A; Mellín-Rosas, Marco A; Montesinos-Matías, Roberto; Arredondo-Bernal, Hugo C

    2016-03-01

    Entomopathogenic fungi belonging to the genus Isaria (Hypocreales: Cordycipitaceae) are promising candidates for microbial control of insect pests. Currently, the Mexican government is developing a biological control program based on extensive application of Isaria isolates against Diaphorina citri (Hemiptera: Liviidae), a vector of citrus huanglongbing disease. Previous research identified three promising Isaria isolates (CHE-CNRCB 303, 305, and 307; tentatively identified as Isaria fumosorosea) from Mexico. The goal of this work was to obtain a complete morphological and molecular characterization of these isolates. Comparative analysis of morphology established that the isolates showed similar characteristics to Isaria javanica. Multi-gene analysis confirmed the morphological identification by including the three isolates within the I. javanica clade. Additionally, this work demonstrated the misidentifications of three other Isaria isolates (CHE-CNRCB 310 and 324: I. javanica, formerly I. fumosorosea; CHE-CNRCB 393: I. fumosorosea, formerly Isaria farinosa), underlying the need for a full and correct characterization of an isolate before developing a biological control program. Finally, the inter-simple sequence repeat (ISSR) genotyping method revealed that the CHE-CNRCB 303, 305, and 307 isolates belong to three different genotypes. This result indicates that ISSR markers could be used as a tool to monitor their presence in field conditions. Copyright © 2015 The British Mycological Society. Published by Elsevier Ltd. All rights reserved.

  9. Recilia banda Kramer (Hemiptera: Cicadellidae), a vector of Napier stunt phytoplasma in Kenya

    Science.gov (United States)

    Obura, Evans; Midega, Charles A. O.; Masiga, Daniel; Pickett, John A.; Hassan, Mohamed; Koji, Shinsaku; Khan, Zeyaur R.

    2009-10-01

    Napier grass ( Pennisetum purpureum) is the most important fodder crop in smallholder dairy production systems in East Africa, characterized by small zero-grazing units. It is also an important trap crop used in the management of cereal stemborers in maize in the region. However, production of Napier grass in the region is severely constrained by Napier stunt disease. The etiology of the disease is known to be a phytoplasma, 16SrXI strain. However, the putative insect vector was yet unknown. We sampled and identified five leafhopper and three planthopper species associated with Napier grass and used them as candidates in pathogen transmission experiments. Polymerase chain reaction (PCR), based on the highly conserved 16S gene, primed by P1/P6-R16F2n/R16R2 nested primer sets was used to diagnose phytoplasma on test plants and insects, before and after transmission experiments. Healthy plants were exposed for 60 days to insects that had fed on diseased plants and acquired phytoplasma. The plants were then incubated for another 30 days. Nested PCR analyses showed that 58.3% of plants exposed to Recilia banda Kramer (Hemiptera: Cicadellidae) were positive for phytoplasma and developed characteristic stunt disease symptoms while 60% of R. banda insect samples were similarly phytoplasma positive. We compared the nucleotide sequences of the phytoplasma isolated from R. banda, Napier grass on which these insects were fed, and Napier grass infected by R. banda, and found them to be virtually identical. The results confirm that R. banda transmits Napier stunt phytoplasma in western Kenya, and may be the key vector of Napier stunt disease in this region.

  10. Cryptic Species Identification and Composition of Bemisia tabaci (Hemiptera: Aleyrodidae) Complex in Henan Province, China.

    Science.gov (United States)

    Jiu, Min; Hu, Jian; Wang, Lun-Ji; Dong, Jun-Feng; Song, Yue-Qin; Sun, Hui-Zhong

    2017-05-01

    Bemisia tabaci (Gennadius) (Hemiptera: Aleyrodidae) is a cryptic species complex, causing significant crop losses in China during the last decade. Although knowledge of cryptic species composition and dynamics within B. tabaci complex is critical for developing sustainable pest management strategies, limited information is available on this pest in the Henan province of China. A systematic survey of the cryptic species composition and distribution of B. tabaci complex in different locations of Henan province was conducted in 2012. The results of RAPD-PCR and the gene for the mitochondrial cytochrome oxidase subunit-1 (mtCOI) based phylogenetic relationships established using Bayesian method indicated there were four known cryptic species MEAM1, MED, Asia II 3, Asia II 9 and a new cryptic species named China 6 in Henan province. In the survey, the invasive cryptic species MED and MEAM1 were found to be predominant with wide spread distribution across the surveyed regions. On the contrary, the indigenous B. tabaci cryptic species including Asia II 3, Asia II 9 and China 6 remained with low prevalence in some surveyed regions. Cryptic species MEAM1 and MED have not completely displaced the native B. tabaci in Henan province. This current study for the first time unifies our knowledge of the diversity and distribution of B. tabaci across Henan province of China. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America.

  11. Biological parameters and fertility life table of Aphis forbesi Weed, 1889 (Hemiptera: Aphididae on strawberry

    Directory of Open Access Journals (Sweden)

    E. S. Araujo

    Full Text Available Abstract This study provides the first contribution of the biology and life table of Aphis forbesi Weed, 1889 (Hemiptera: Aphididae, an important strawberry pest throughout the world. This species lives in the crown and leaf petioles of the plant. It is difficulty to rear this species in laboratory due to protocooperation with ants observed only in the field. We studied the life cycle of A. forbesi on the leaves of the Albion strawberry cultivar at 25 ± 2 °C, 60 ± 10% relative humidity, and a 12-h photophase. The experiment was randomised with 100 replicates. The parameters of the fertility life table were calculated using TabVida. In the population studied, 25% and 46% had four and three instars, respectively. A mean of 1.43 nymphs per female per day was generated. The mean reproductive period was seven days and the mean longevity was 10 days. In every 11 days there is a generation of A. forbesi, where each female has the potential to generate between 6 to 9 individuals daily, increasing its population by 1.2 times. The average life cycle was 16.8 days. High viability observed in all instars and the resulting values of R0, rm and λ suggest that A. forbesi has the capacity to increase their numbers in a short period of time, while generating high populations in strawberry crops, requiring differential management.

  12. Facilitation of a native pest of rice, Stenotus rubrovittatus (Hemiptera: Miridae), by the non-native Lolium multiflorum (Cyperales: Poaceae) in an agricultural landscape.

    Science.gov (United States)

    Yoshioka, Akira; Takada, Mayura; Washitani, Izumi

    2011-10-01

    Source populations of polyphagous pests often occur on host plants other than the economically damaged crop. We evaluated the contribution of patches of a non-native meadow grass, Lolium multiflorum Lam. (Poaceae), and other weeds growing in fallow fields or meadows as source hosts of an important native pest of rice, Stenotus rubrovittatus (Matsumura) (Hemiptera: Miridae), in an agricultural landscape of northern Japan. Periodical censuses of this mirid bug by using the sweeping method, vegetation surveys, and statistical analysis revealed that L. multiflorum was the only plant species that was positively correlated with the density of adult S. rubrovittatus through two generations and thus may be the most stable and important host of the mirid bug early in the season before the colonization of rice paddies. The risk and cost of such an indirect negative effect on a crop plant through facilitation of a native pest by a non-native plant in the agricultural landscape should not be overlooked.

  13. Isolation and Characterization of Novel Polymorphic Microsatellite Markers for Cimex hemipterus F. (Hemiptera: Cimicidae).

    Science.gov (United States)

    Seri Masran, Siti Nor Ain; Ab Majid, Abdul Hafiz

    2018-05-04

    Due to the growing public health and tourism awareness, Cimex hemipterus Fabricius (Hemiptera: Cimicidae) has gained a great interest in increasing reported infestation cases in tropical regions of the world, including Malaysia. Since the information on the molecular ecology and population biology of this species are tremendously lacking, the isolation and development of molecular markers can be used to determine its genetic structure. In this study, novel microsatellite primers isolated from enriched genomic libraries of C. hemipterus were developed using 454 Roche shotgun sequencing. Seven validated polymorphic microsatellite primers were consistently amplified and characterized from 70 tropical bed bugs collected from seven locations throughout Malaysia. The number of alleles per locus identified ranged from 6 to 14. Comparison of loci for overall and between population were done with mean observed and expected heterozygosity were determined at 0.320 and 0.814, 0.320 and 0.727, respectively. Polymorphic information criteria (PIC) valued the markers as highly informative as PIC >0.5. Overall population, they are possibly in Hardy-Weinberg equilibrium with loci Ch_09ttn, Ch_01dn, and Ch_13dn showing signs of a null allele. There were no scoring errors caused by stutter peaks, no large allele dropout was detected for all loci and showed no evidence of linkage disequilibrium. In conclusion, all seven molecular microsatellite markers identified can be beneficially used to gain more information on the population genetic structure and breeding patterns of C. hemipterus as well as the relationship of dispersal and infestation.

  14. Sequencing and Characterization of the Invasive Sycamore Lace Bug Corythucha ciliata (Hemiptera: Tingidae) Transcriptome

    Science.gov (United States)

    Qu, Cheng; Fu, Ningning; Xu, Yihua

    2016-01-01

    The sycamore lace bug, Corythucha ciliata (Hemiptera: Tingidae), is an invasive forestry pest rapidly expanding in many countries. This pest poses a considerable threat to the urban forestry ecosystem, especially to Platanus spp. However, its molecular biology and biochemistry are poorly understood. This study reports the first C. ciliata transcriptome, encompassing three different life stages (Nymphs, adults female (AF) and adults male (AM)). In total, 26.53 GB of clean data and 60,879 unigenes were obtained from three RNA-seq libraries. These unigenes were annotated and classified by Nr (NCBI non-redundant protein sequences), Nt (NCBI non-redundant nucleotide sequences), Pfam (Protein family), KOG/COG (Clusters of Orthologous Groups of proteins), Swiss-Prot (A manually annotated and reviewed protein sequence database), and KO (KEGG Ortholog database). After all pairwise comparisons between these three different samples, a large number of differentially expressed genes were revealed. The dramatic differences in global gene expression profiles were found between distinct life stages (nymphs and AF, nymphs and AM) and sex difference (AF and AM), with some of the significantly differentially expressed genes (DEGs) being related to metamorphosis, digestion, immune and sex difference. The different express of unigenes were validated through quantitative Real-Time PCR (qRT-PCR) for 16 randomly selected unigenes. In addition, 17,462 potential simple sequence repeat molecular markers were identified in these transcriptome resources. These comprehensive C. ciliata transcriptomic information can be utilized to promote the development of environmentally friendly methodologies to disrupt the processes of metamorphosis, digestion, immune and sex differences. PMID:27494615

  15. Morphology and volatile compounds of metathoracic scent gland in Tessaratoma papillosa (Drury) (Hemiptera: Tessaratomidae).

    Science.gov (United States)

    Zhao, D; Gao, J; Wang, Y; Jiang, J; Li, R

    2012-08-01

    Tessaratoma papillosa (Drury) (Hemiptera: Tessaratomidae) is a serious insect pest of litchi and longan in South China. When disturbed, this insect could release large quantities of disagreeable odorous volatiles from its scent gland. Knowledge on the scent gland and its secretion is crucial for developing the semiochemical methods to manage this pest. Morphology and ultrastructure of the metathoracic scent glands (MTGs) were studied under stereo and scanning electron microscopy, and the volatile compounds of MTGs from both male and female T. papillosa were analyzed with coupled gas chromatography-mass spectrometry (GC-MS). The MTG complex is located between the metathorax and the first abdominal segment at the ventral surface of the insect, which has a well-developed single double valve cystic-shaped orange median reservoir, paired colorless lateral glands in both sides, and a long and wavy tubular accessory gland that inlays tightly into the ventral edge around the median reservoir. The MTG opens to the body surface through paired ostioles located between the meso- and metacoxae of the evaporatorium with mushroom bodies. The GC-MS analyses showed that female and male adults have nine major volatile components in common. Tridecane is the most abundant in both females and males, reaching up to 47.1% and 51.8% of relative amount, respectively. The minor component is benzophenone with only 0.28% and 0.14%. Furthermore, undecane, tetradecane, 3-methyl-tridecane, and cyclopentadecane were found only in males. The possible function of volatile compounds of MTG contents in T. papillosa is addressed.

  16. Neonicotinoid-Induced Mortality of Diaphorina Citri (Hemiptera: Liviidae) is Affected by Route of Exposure.

    Science.gov (United States)

    Langdon, Kevin W; Rogers, Michael E

    2017-10-01

    The use of neonicotinoids in citrus (Rutaceae) has increased substantially to help manage the Asian citrus psyllid, Diaphorina citri Kuwayama (Hemiptera: Liviidae), a vector of the devastating citrus disease, huanglongbing (HLB). In citrus pest management programs, neonicotinoids are most often applied to the soil as a drench and move through xylem channels from the roots into the foliage. We developed a novel assay to quantify the dose required to kill D. citri following ingestion and compare it with the dose required to kill by contact. The LC50 of the laboratory strain for ingestion of imidacloprid, thiamethoxam, and clothianidin were each approximately 10-fold greater than the respective LC50 by contact exposure. Four field populations were tested to validate comparative exposure of the laboratory strain to imidacloprid and determine the relative susceptibility of field populations to imidacloprid by exposure through ingestion and contact. The contact assay exhibited low (10) RR50 values were observed for the Lake Placid and Lake Alfred populations using the contact and the ingestion method. This research demonstrates that the ingestion assay method described herein is more sensitive in detection of low-level resistance and should be the standard methodology used in monitoring for resistance to systemic insecticides for this global pest. We found D. citri populations with a lower than expected susceptibility to neonicotinoids in the field, which warrants the implementation of resistance management practices to preserve the utility of soil-applied neonicotinoids in citrus. © The Author 2017. Published by Oxford University Press on behalf of Entomological Society of America.

  17. The cicadas (Hemiptera: Cicadidae) of India, Bangladesh, Bhutan, Myanmar, Nepal and Sri Lanka: an annotated provisional catalogue, regional checklist and bibliography.

    Science.gov (United States)

    Price, Benjamin Wills; Allan, Elizabeth Louise; Marathe, Kiran; Sarkar, Vivek; Simon, Chris; Kunte, Krushnamegh

    2016-01-01

    The cicadas of the Indian subcontinent, like many other insects in the region, have remained understudied since the early part of the 20th Century, and await modern taxonomic, systematic and phylogenetic treatment. This paper presents an updated systematic catalogue of cicadas (Hemiptera: Cicadidae) from India, Bangladesh, Bhutan, Myanmar, Nepal and Sri Lanka, the first in over a century. This paper treats 281 species, including: India and Bangladesh (189 species), Bhutan (19 species), Myanmar (81 species), Nepal (46 species) and Sri Lanka (22 species). For each species all recognized junior synonyms are included with information on the type material and additional specimens where relevant. The global distributional range and notes on the taxonomy of each species are included where appropriate. Two lists are provided: (1) species known to occur in India and Bangladesh (treated as a geographic unit), Bhutan, Myanmar, Nepal and Sri Lanka; and (2) species previously listed from these countries in error. A bibliography of species descriptions is provided, with the papers containing the original descriptions provided where copyright allows.

  18. Host Range Testing of Diaphorencyrtus aligarhensis (Hymenoptera: Encyrtidae) for Use in Classical Biological Control of Diaphorina citri (Hemiptera: Liviidae) in California.

    Science.gov (United States)

    Bistline-East, Allison; Pandey, Raju; Kececi, Mehmet; Hoddle, Mark S

    2015-06-01

    Host range tests for Diaphorencyrtus aligarhensis (Shafee, Alam, & Agarwal) (Hymenoptera: Encyrtidae), an endoparasitoid of Asian citrus psyllid, Diaphorina citri Kuwayama (Hemiptera: Liviidae), sourced from Punjab Pakistan, were conducted in quarantine at the University of California, Riverside, CA. Seven nontarget psyllid species representing four psyllid families were exposed to mated D. aligarhensis females in four different treatment types: 1) short sequential no-choice treatments, 2) prolonged sequential no-choice treatments, 3) prolonged no-choice static treatments, and 4) choice treatments. Selection of nontarget psyllid species was based on phylogenetic proximity to D. citri, likelihood of being encountered by D. aligarhensis in the prospective release areas in California, and psyllid species in biological control of invasive weeds. D. aligarhensis exhibited high host affinity to D. citri, and only parasitized one nontarget species, the pestiferous potato psyllid, Bactericera cockerelli (Sulc), at low levels (citri. Results presented here suggest D. aligarhensis poses minimal risk to nontarget psyllid species in California. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  19. Genetics Home Reference: lymphedema-distichiasis syndrome

    Science.gov (United States)

    ... G, Jones MC, Kerstjens-Frederikse WS, Lidral AC, McDonald M, Nelson CC, Witte M, Glover TW. Clinical ... 10 All Bulletins Features What is direct-to-consumer genetic testing? What are genome editing and CRISPR- ...

  20. Taxonomic status of the Bemisia tabaci complex (Hemiptera: Aleyrodidae and reassessment of the number of its constituent species.

    Directory of Open Access Journals (Sweden)

    Wonhoon Lee

    Full Text Available Bemisia tabaci (Hemiptera: Aleyrodidae is one of the most important insect pests in the world. In the present study, the taxonomic status of B. tabaci and the number of species composing the B. tabaci complex were determined based on 1059 COI sequences of B. tabaci and 509 COI sequences of 153 hemipteran species. The genetic divergence within B. tabaci was conspicuously higher (on average, 11.1% than interspecific genetic divergence within the respective genera of the 153 species (on average, 6.5%. This result indicates that B. tabaci is composed of multiple species that may belong to different genera or subfamilies. A phylogenetic tree constructed based on 212 COI sequences without duplications revealed that the B. tabaci complex is composed of a total of 31 putative species, including a new species, JpL. However, genetic divergence within six species (Asia II 1, Asia II 7, Australia, Mediterranean, New World, and Sub Saharan Africa 1 was higher than 3.5%, which has been used as a threshold of species boundaries within the B. tabaci complex. These results suggest that it is necessary to increase the threshold for species boundaries up to 4% to distinguish the constituent species in the B. tabaci complex.

  1. Pengaruh cendawan endofit terhadap biologi dan statistik demografi wereng batang cokelat Nilaparvata lugens Stál (Hemiptera: Delphacidae

    Directory of Open Access Journals (Sweden)

    Amanda Mawan

    2015-09-01

    Full Text Available Endophytic fungi is an endosymbiont that lives within host plant tissues and does not necessary cause any harm to plants. This type of fungus are important as mediators in plant-herbivore interactions. One of the endophytic fungi in rice is Nigrospora sp. The effects of Nigrospora sp. on the biology and demographic statistic of Nilaparvata lugens Stál (Hemiptera: Delphacidae were studied in the laboratory. We used Nigrospora sp. culture powder was used to inoculate the fungi to rice seeds by mixing 10 g of flour endophytic per 1 kg rice seeds. The mixture was then stored in damp and dark storage. Results showed that the rice seeds treated with endophytic fungi showed some resistance to N. lugens. Eggs and early stages of nymph mortality was increased, higher than the control. Endophytic fungi also affect the nymphs growth rates by slowing it down, prolonging N. lugens life cycle, preoviposition period as well as delayed the age at first reproduction. N. lugens population growth is effected by Nigrospora sp. in laboratory scale. Thus, it has the potential as an alternative way to control N. lugens population. In addition, inoculation of endophytic fungi could be a useful method for protecting rice plants from N. lugens.

  2. Assessment of Feeding Acceptance and Injury of Kerman Pistachios, Pistacia vera, by Brown Marmorated Stink Bug (Hemiptera: Pentatomidae).

    Science.gov (United States)

    Lara, Jesús R; Kamiyama, Matthew T; Hernandez, Gabriel; Nay, Justin; Hoddle, Mark S; Gao, Yulin

    2017-09-01

    In the United States, California (CA) is the primary commercial producer of pistachio nuts, Pistacia vera L. (Anacardiaceae). The brown marmorated stink bug (BMSB), Halyomorpha halys (Stål) (Hemiptera: Pentatomidae), an invasive and polyphagous insect pest from Asia, has established in urban areas in several pistachio-growing counties in CA. Breeding BMSB populations have not been detected in commercial pistachio acreage. However, the detection of BMSB in Kern and Fresno counties, major Kerman pistachio producing areas in CA, underscored key knowledge gaps on BMSB ecology in CA and motivated investigations on the susceptibility of pistachio nuts to BMSB feeding. Laboratory feeding trials conducted in quarantine under permit indicated that adult BMSB stylets can penetrate developing pistachio shells and associated feeding was correlated with kernel necrosis for nuts collected mid to late season (June to August 2016). Feeding damage estimates indicated that higher levels of kernel injury were associated with female BMSB when compared to feeding by male BMSB. These results suggest that there is probable risk of feeding damage to field grown pistachios from BMSB. The implications of this study for BMSB pest management in the CA pistachio system and future research directions are discussed. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America.

  3. Metaheuristic approaches to order sequencing on a unidirectional ...

    African Journals Online (AJOL)

    is that tabu search (TS) incorporates “intelligence. ..... location that will benefit the solution quality by considering implications that may arise ..... [12] Glover F, 1986, Future paths for integer programming and links to artificial intelligence, ...

  4. Embryology of Triatoma infestans (KLUG, (Hemiptera, Reduviidae, a Chagas' disease vector Embriología del Triatoma infestans, vector de la enfermedad de Chagas

    Directory of Open Access Journals (Sweden)

    Laura E. Fichera

    1992-06-01

    Full Text Available This study reports the embryogenesis of T. infestans (Hemiptera, Reduviidae. Morphological parameters of growth sequences from oviposition until hatching (12-14 d 28ºC were established. Five periods, as percent of time of development (TD, were characterized from oviposition until hatching. The most important morphological features were: 1 formation of blastoderm within 7% of TD; 2 germ band and gastrulation within 30% of TD; 3 nerve cord, limb budding, thoracic and abdominal segmentation and formation of body cavity within 50% of TD; 4 nervous system and blastokinesis end, and development of embryonic cuticle within 65% of TD; 5 differentiation of the mouth parts, fat body, and Malphigian tubules during final stage and completion of embryo at day 12 to day 14 around hatching. These signals were chosen as appropriate morphological parameters which should enable the evaluation of embryologic modifications due to the action/s of different insecticidesEn este estudio se caracterizó el desarrollo embrionario del T. infestans (Hemiptera Reduviidae. Se establecieron parámetros morfológicos secuenciales de crecimiento desde la oviposición hasta la eclosión, (12-14 d 28ºC. Cinco períodos de crecimiento fueron determinados y expresados como fracciones porcentuales del tiempo total del desarrollo (TD hasta la eclosión. Los eventos morfológicos mas importantes fueron: 1 La formación del blastodermo hasta el 7% del TD; 2 La aparición de la banda germinativa y su gastrulación transcurridos un 30% del TD; 3 El comienzo de la formación del cordón nervioso, de las extremidades, la segmentación torácica y abdominal y la formación del mixocele cuando la embriogénesis alcanzó el 50% del TD; 4 La terminación de la blastoquinesis, el desarrollo completo del sistema nervioso y la aparición de la cutícula embrionaria hasta el 65% del TD; 5 En la etapa final de la embriogenesis se observó la diferenciación del aparato mandibular, el cuerpo graso

  5. Alguns aspectos da biologia de Triatoma pseudomaculata Corrêa & Espínola, 1964, em condições de laboratório (Hemiptera:Reduviidae:Triatominae

    Directory of Open Access Journals (Sweden)

    Teresa Cristina M Gonçalves

    1997-03-01

    Full Text Available Biology of Triatoma pseudomaculata Corrêa & Espínola, 1964, under Laboratory Conditions (Hemiptera:Reduviidae:Triatominae - Observations were made on the evolutive cycle of Triatoma pseudomaculata, held under laboratory conditions, fed weekly on bird (pigeon. Of 60 eggs obtained, only 34 nymphs reached the adult stage in a period of X(S=398±76 days. The following parameters were observed: the time immature stages took to develop from egg to adult emergence; the occurrence of the first meal; the time-lapse between the presenting of the blood-meal and the begining of feeding; time of feeding; amount of blood ingested; variation of weight 24 hr after the blood-meal and until the next blood-meal; and the defecation pattern. The experiment was carried out for 20 months, held in BOD incubator with the average of temperature and humidity of 28±1ºC and 80±5% RU, respectively

  6. Developmental biology, polymorphism and ecological aspects of Stiretrus decemguttatus (Hemiptera, Pentatomidae, an important predator of cassidine beetles

    Directory of Open Access Journals (Sweden)

    Lucia Maria Paleari

    2013-03-01

    Full Text Available Developmental biology, polymorphism and ecological aspects of Stiretrus decemguttatus (Hemiptera, Pentatomidae, an important predator of cassidine beetles. Stiretrus decemguttatus is an important predator of two species of cassidine beetles, Botanochara sedecimpustulata (Fabricius, 1781 and Zatrephina lineata (Fabricius, 1787 (Coleoptera, Cassidinae, on the Marajó Island, Brazil. It attacks individuals in all development stages, but preys preferentially on late-instar larvae. Its life cycle in the laboratory was 43.70 ± 1.09 days, with an egg incubation period of six days and duration from nymph and adult stages of 16.31 ± 0.11 and 22.10 ± 1.67 days, respectively. The duration of one generation (T was 12.65 days and the intrinsic population growth rate (r 0.25. These data reveal the adjustment of the life cycle of S. decemgutattus with those of the two preys, but suggest greater impact on Z. lineata. However, no preference over cassidine species was shown in the laboratory. Up to 17 different color patterns can be found in adults of S. decemguttatus, based on combinations of three basic sets of color markings. Some of them resemble the markings of chrysomelids associated with Ipomoea asarifolia (Convolvulaceae and are possibly a mimetic ring. Three color patterns were identified in nymphs, none of which was associated with any specific adult color pattern.

  7. Keanekaragaman dan Kelimpahan Musuh Alami Bemisia tabaci (Gennadius (Hemiptera: Aleyrodidae pada Pertanaman Cabai Merah di Kecamatan Pakem, Kabupaten Sleman, Daerah Istimewa Yogyakarta

    Directory of Open Access Journals (Sweden)

    Hendrival Hendrival

    2015-09-01

    Full Text Available Research on natural enemies of Bemisia tabaci was conducted in the chili pepper fields in Sub-district of Pakem, District of Sleman, The Special Province of Yogyakarta during the dry season of May-October 2009. The aims of this research were to study the diversity and abundance of parasitoid and predator species associated with B. tabaci. Samplings of insect species were done using yellow pan trap, sweep net, direct observation of insects colonized young leaves, and collection of nymphs for B. tabaci. Measurement of insect diversity was calculated using Shannon’s index diversity and Evenness index. Nine species of insect predator were identified, i.e. Harmonia octomaculata (Fabricius, Menochilus sexmaculata (Fabricius, Scymnus sp., Micraspis inops Mulsant, Coccinella sp. (Coleoptera: Coccinellidae, Paederus fuscipes Curtis (Coleoptera: Staphylinidae, Orius sp. (Hemiptera: Anthocoridae, Linyphiidae sp.1 (Araneae, and Syrphidae sp.1 (Diptera. Eretmocerus sp. (Hymenoptera: Aphelinidae was the only parasitoid found in the nymphs B. tabaci collected and has the potential to control B. tabaci in the red pepper fields.

  8. The isolation and identification of pathogenic fungi from Tessaratoma papillosa Drury (Hemiptera: Tessaratomidae).

    Science.gov (United States)

    Meng, Xiang; Hu, Junjie; Ouyang, Gecheng

    2017-01-01

    Litchi stink-bug, Tessaratoma papillosa Drury (Hemiptera: Tessaratomidae), is one of the most widespread and destructive pest species on Litchi chinensis Sonn and Dimocarpus longan Lour in Southern China. Inappropriate use of chemical pesticides has resulted in serious environmental problems and food pollution. Generating an improved Integrated Pest Management (IPM) strategy for litchi stink-bug in orchard farming requires development of an effective biological control agent. Entomopathogenic fungi are regarded as a vital ecological factor in the suppression of pest populations under field conditions. With few effective fungi and pathogenic strains available to control litchi stink-bug, exploration of natural resources for promising entomopathogenic fungi is warranted. In this study, two pathogenic fungi were isolated from cadavers of adult T. papillosa . They were identified as Paecilomyces lilacinus and Beauveria bassiana by morphological identification and rDNA-ITS homogeneous analysis. Infection of T. papillosa with B. bassiana and P. lilacinus occurred initially from the antennae, metameres, and inter-segmental membranes. Biological tests showed that the two entomopathogenic fungi induced high mortality in 2 nd and 5 th instar nymphs of T. papillosa . B. bassiana was highly virulent on 2 nd instar nymphs of T. papillosa , with values for cadaver rate, LC 50 and LT 50 of 88.89%, 1.92 × 10 7  conidia/mL and 4.34 days respectively. This study provides two valuable entomopathogenic fungi from T. papillosa . This finding suggests that the highly virulent P. lilacinus and B. bassiana play an important role in the biocontrol of T. papillosa in China. These pathogenic fungi had no pollution or residue risk, and could provide an alternative option for IPM of litchi stink-bug.

  9. The isolation and identification of pathogenic fungi from Tessaratoma papillosa Drury (Hemiptera: Tessaratomidae

    Directory of Open Access Journals (Sweden)

    Xiang Meng

    2017-10-01

    Full Text Available Background Litchi stink-bug, Tessaratoma papillosa Drury (Hemiptera: Tessaratomidae, is one of the most widespread and destructive pest species on Litchi chinensis Sonn and Dimocarpus longan Lour in Southern China. Inappropriate use of chemical pesticides has resulted in serious environmental problems and food pollution. Generating an improved Integrated Pest Management (IPM strategy for litchi stink-bug in orchard farming requires development of an effective biological control agent. Entomopathogenic fungi are regarded as a vital ecological factor in the suppression of pest populations under field conditions. With few effective fungi and pathogenic strains available to control litchi stink-bug, exploration of natural resources for promising entomopathogenic fungi is warranted. Methods & Results In this study, two pathogenic fungi were isolated from cadavers of adult T. papillosa. They were identified as Paecilomyces lilacinus and Beauveria bassiana by morphological identification and rDNA-ITS homogeneous analysis. Infection of T. papillosa with B. bassiana and P. lilacinus occurred initially from the antennae, metameres, and inter-segmental membranes. Biological tests showed that the two entomopathogenic fungi induced high mortality in 2nd and 5th instar nymphs of T. papillosa. B. bassiana was highly virulent on 2nd instar nymphs of T. papillosa, with values for cadaver rate, LC50 and LT50 of 88.89%, 1.92 × 107 conidia/mL and 4.34 days respectively. Discussion This study provides two valuable entomopathogenic fungi from T. papillosa. This finding suggests that the highly virulent P. lilacinus and B. bassiana play an important role in the biocontrol of T. papillosa in China. These pathogenic fungi had no pollution or residue risk, and could provide an alternative option for IPM of litchi stink-bug.

  10. Biology of the Huanglongbing vector Diaphorina citri (Hemiptera: Liviidae) on different host plants.

    Science.gov (United States)

    Alves, G R; Diniz, A J F; Parra, J R P

    2014-04-01

    Although many studies have been conducted on the development and reproductive potential of Diaphorina citri Kuwayama, 1908 (Hemiptera: Liviidae) in different host species, few have evaluated these parameters on different varieties of the same host species. This study evaluated the influence of five commercial varieties of citrus (Citrus spp. L.)--Hamlin, Natal, Pêra, Ponkan, and Valencia-and orange jasmine [Murraya exotica (L.) Jack] on the development of D. citri. Survival rates for the egg stage were highest on orange jasmine (85.7%) and on Valencia (83.3%). The lowest viability of the nymphal stage was also observed on Hamlin, averaging 57.4%. Values for total viability ranged from 65.9 to 32.6%, and were highest on Valencia. The longest egg-adult development time was on Natal, with a mean of 18.4 d; the shortest total development time was on orange jasmine, with a mean of 17.3 d. Based on the fertility life table, the net reproductive rate (Ro) of D. citri was 2.5 times higher when reared on Valencia than on Hamlin. The other parameters (duration of each generation [T], finite rate of increase [lambda], and innate capacity to increase in number [r(m)]) also demonstrated that Valencia is best suited to this insect. The results obtained for the biological parameters and the fertility life table indicate that Valencia and orange jasmine were the most suitable hosts, whereas Hamlin was least suitable for the development of D. citri. These results provide information for the installation of new citrus groves, especially in the choice of varieties to be planted and the location of different varieties within the groves, with a view toward the management of Huanglongbing or HLB.

  11. Coat protein sequence shows that Cucumber mosaic virus isolate ...

    Indian Academy of Sciences (India)

    Madhu

    A viral disease was identified on geraniums (Pelargonium spp.) grown in a greenhouse at the .... DNA was cloned in p-GEM Teasy vector (Promega, USA) as per the ... M. persicae and A. gossypii transmitted the virus in non persistent manner ...

  12. Potential of Metarrhizium anisopliae and Beauveria bassiana isolates and Neem oil to control the aphid Lipaphis erysimi (Kalt.) (Hemiptera: Aphididae); Potencial de isolados de Metarhizium anisopliae e Beauveria bassiana e do oleo de Nim no controle do pulgao Lipaphis erysimi (Kalt.) (Hemiptera: Aphididae)

    Energy Technology Data Exchange (ETDEWEB)

    Araujo Junior, Jose M. de; Marques, Edmilson J.; Oliveira, Jose V. de [Universidade Federal Rural de Pernambuco (UFRPE), Recife, PE (Brazil). Dept. de Agronomia - Entomologia], e-mail: jma_junior@yahoo.com.br, e-mail: emar@depa.ufrpe.br, e-mail: vargasoliveira@uol.com.br

    2009-07-15

    This work aimed to determine the efficiency of the entomopathogenic fungi Metarrhizium anisopliae and Beauveria bassiana to control the aphid Lipaphis erysimi (Kalt.) (Hemiptera:Aphididae) in kale Brassica oleracea var acephala D.C., as well as their compatibility with a neem oil formulation (Neemseto{sup R}). Ten isolates of both fungi were tested and the most pathogenic ones were B. bassiana CG001 and M. anisopliae CG30 with 90% and 4.4 days, and 64% and 3.8 days of mortality and median lethal time, respectively. Bioassays with neem at concentrations of 0.5, 1.0 and 2.0% were done either by leaf discs dipping or spraying the aphids on the leaf discs. The neem spraying treatment at 2.0% provided 90% mortality. The use of B. bassiana isolate CG001 or M. anisopliae isolate CG30 with neem at 0.125, 0.25, and 0.5%, demonstrated that these isolates could have their spore viability or colony growth affected when exposed to neem concentrations higher than 0.25%. In absolute values, the isolates B. bassiana CG001 and M. anisopliae CG30 are the most virulent to L. erysimi, and could be utilized in the management of this pest. (author)

  13. First record of Triatoma maculata (Erichson, 1848 (Hemiptera: Reduviidae: Triatomini in Riohacha, La Guajira – Colombia

    Directory of Open Access Journals (Sweden)

    Edith Natalia Gómez-Melendro

    2014-11-01

    Full Text Available Introduction. Knowledge of vector insect species, their habitat and geographical distribution is crucial for determining the risk of transmission of the etiologic agents that cause disease in humans, which allows defining strategies for prevention, surveillance and control in line with the characteristics of each area. Objective. To determine the presence and public health importance of vectors of Chagas disease in the indigenous settlements of Marbacella and El Horno of the Wayúu ethnic group in the municipality of Riohacha, La Guajira, Colombia. Materials and methods. From active search, installation and inspection of biosensors and occasional catches, Hemiptera: Reduviidae: Triatomini were collected intra and in the peridomicile housing of the indigenous settlements of El Horno and Marbacella of the the Wayúu ethnic group. Indices of intra and peridomestic infestation, colonization, density, dispersion and natural infection with Trypanosoma cruzi Chagas, 1909 were calculated. Results. 79.6% (n = 90 of the specimens were collected around the homes and 20.3% (n = 23 inside the homes, all corresponding to Triatoma maculata (Erichson, 1848. The natural infection indices with T. cruzi accounted for 43.5% for Marbacella and 36% for El Horno. Conclusion. This is the first reported capture of individuals of T. maculata, considered a secondary vector of Chagas disease in Colombia, naturally infected with T. cruzi in the municipality of Riohacha expanding the geographical distribution of the species in the department of La Guajira.

  14. Within-plant distribution of Aulacorthum solani (Hemiptera: Aphididae), on various greenhouse plants with implications for control.

    Science.gov (United States)

    Jandricic, S E; Mattson, N S; Wraight, S P; Sanderson, J P

    2014-04-01

    Foxglove aphid, Aulacorthum solani (Kaltenbach) (Hemiptera: Aphididae), has recently undergone a status change from an occasional pest to a serious pest in greenhouses of North America and the United Kingdom. Little nonanecdotal information exists on the ecology of this insect in greenhouse crops. To help improve integrated pest management decisions for A. solani, the within-plant distribution of this pest was explored on a variety of common greenhouse plants in both the vegetative and flowering stage. This aphid generally was found on lower leaves of vegetative plants, but was found higher in the canopy on reproductive plants (on flowers, flower buds, or upper leaves). Aphid numbers were not consistently positively correlated with total leaf surface areas within plant strata across plant species. Thus, the observed differences in preferred feeding sites on vegetative versus flowering plants are possibly a response to differences in nutritional quality of the various host-plant tissues. Despite being anecdotally described as a "stem-feeding aphid," A. solani was rarely found feeding on stems at the population densities established in our tests, with the exception of racemes of scarlet sage (Salvia splendans). Although some previous reports suggested that A. solani prefers to feed on new growth of plants, our results indicate that mature leaves are preferred over growing tips and young leaves. The implications of the within-plant feeding preferences of A. solani populations with respect to both biological and chemical control are discussed.

  15. Applicability of empirical correlations for estimating global solar radiation

    International Nuclear Information System (INIS)

    Gopinathan, K.K.; Baholo, M.

    1987-01-01

    Three empirical models suggested by different investigators, for estimating monthly mean daily global radiation on a horizontal surface, are compared statistically to test their universal applicability. The models thus compared are those suggested by Rietveld, Glover and McCulloch and Gopinathan. The models are compared by calculating the root mean square error, mean bias error and mean relative percentage error values. The model suggested by Gopinathan yields the best results in terms of root mean square, mean bias and mean percentage errors. The model by Rietveld is the second best and the model by Glover and McCulloch comes at third place. However, the differences in the magnitude of errors among the three models are very small and all the three models can be considered to be accurate for global radiation estimation for any location in the world

  16. Morphogenesis of galls induced by Baccharopelma dracunculifoliae (Hemiptera: Psyllidae on Baccharis dracunculifolia (Asteraceae leaves

    Directory of Open Access Journals (Sweden)

    M. Arduin

    Full Text Available The commonest insect gall on Baccharis dracunculifolia (Asteraceae leaves is induced by Baccharopelma dracunculifoliae (Hemiptera, Psyllidae. The gall-inducing insect attacks young leaves in both the unfolded and the fully expanded stages. Four developmental phases were observed in this type of gall: 1 A folding phase, during which the leaf lamina folded upward alongside the midrib and the edges of the upper portion of the leaf approached each other, forming a longitudinal slit. A single chamber was formed on the adaxial surface of the leaf; 2 A swelling phase, in which the folded leaf tissues thickened and the edges of the leaf drew closer together, narrowing the slit. In this phase the gall matured, turning succulent, fusiform and pale green. The single nymphal chamber was lined with white wax and was able to house from one to several nymphs; 3 A dehiscence phase, characterized by the opening of the slit to release inducers; and 4 A senescence phase, when the gall turned dark and dry. The dermal system of the mature gall was composed of a single-layered epidermis. The mesophyll was swollen, and the swelling was due mainly to hyperplasia of the parenchyma. The vascular tissues along the midrib vein were conspicuous and the perivascular fibers resembled parenchymal cells. The hypertrophied secretory cavities contained low lipophylic content. This gall does not form nutritive tissue, but salivary sheaths left by the inducers were observed near the parenchyma, vascular bundles and secretory cavities. This study complements our current knowledge of gall biology and sheds further light on the plasticity of plant tissues stimulated by biotic factors.

  17. The Complete Mitochondrial Genome of Corizus tetraspilus (Hemiptera: Rhopalidae) and Phylogenetic Analysis of Pentatomomorpha

    Science.gov (United States)

    Guo, Zhong-Long; Wang, Juan; Shen, Yu-Ying

    2015-01-01

    Insect mitochondrial genome (mitogenome) are the most extensively used genetic information for molecular evolution, phylogenetics and population genetics. Pentatomomorpha (>14,000 species) is the second largest infraorder of Heteroptera and of great economic importance. To better understand the diversity and phylogeny within Pentatomomorpha, we sequenced and annotated the complete mitogenome of Corizus tetraspilus (Hemiptera: Rhopalidae), an important pest of alfalfa in China. We analyzed the main features of the C. tetraspilus mitogenome, and provided a comparative analysis with four other Coreoidea species. Our results reveal that gene content, gene arrangement, nucleotide composition, codon usage, rRNA structures and sequences of mitochondrial transcription termination factor are conserved in Coreoidea. Comparative analysis shows that different protein-coding genes have been subject to different evolutionary rates correlated with the G+C content. All the transfer RNA genes found in Coreoidea have the typical clover leaf secondary structure, except for trnS1 (AGN) which lacks the dihydrouridine (DHU) arm and possesses a unusual anticodon stem (9 bp vs. the normal 5 bp). The control regions (CRs) among Coreoidea are highly variable in size, of which the CR of C. tetraspilus is the smallest (440 bp), making the C. tetraspilus mitogenome the smallest (14,989 bp) within all completely sequenced Coreoidea mitogenomes. No conserved motifs are found in the CRs of Coreoidea. In addition, the A+T content (60.68%) of the CR of C. tetraspilus is much lower than that of the entire mitogenome (74.88%), and is lowest among Coreoidea. Phylogenetic analyses based on mitogenomic data support the monophyly of each superfamily within Pentatomomorpha, and recognize a phylogenetic relationship of (Aradoidea + (Pentatomoidea + (Lygaeoidea + (Pyrrhocoroidea + Coreoidea)))). PMID:26042898

  18. Corixidae (Hemiptera, Heteroptera en el lago urbano del parque Tezozomoc, Azcapotzalco, México, D. F.

    Directory of Open Access Journals (Sweden)

    G. Contreras-Rivero

    2005-01-01

    Full Text Available Los estudios ecológicos sobre la familia Corixidae (Hemiptera en México son escasos y fragmentados, por lo que se analiza su variación espacial y temporal en un lago urbano con algunas variables ambientales. Los muestreos se realizaron mensualmente, de julio de 2000 a junio de 2001, ubicando tres estaciones litorales de muestreo; en cada una se determinó: profundidad, transparencia, temperatura, oxígeno, pH, conductividad, dureza y alcalinidad. Los coríxidos se capturaron con red de cuchara de forma rectangular. Se efectuó un análisis de correlación simple entre la abundancia total de los coríxidos y las variables físicas y químicas registradas. Se registraron tres especies: Graptocorixa abdominalis (Say, 1832, con 53% de abundancia; Corisella edulis (Champion, 1901 con 43% y Krizousacorixa femorata (Guérin, 1857 con 1%. De un total de 2423 organismos capturados, la mayor abundancia se registró en marzo, junto con los valores más altos de profundidad y oxígeno. La menor abundancia se presentó en junio, con los valores más bajos de alcalinidad. La correlación de variables y abundancia total fue positiva y significativa con profundidad, oxígeno y conductividad. La Estación I presentó la mayor abundancia de coríxidos y la estación III la menor abundancia. Las variaciones registradas en la abundancia se deben al aporte de agua y a la ubicación de las estaciones de muestreo.

  19. Experimental Infection of Rhodnius prolixus (Hemiptera, Triatominae with Mycobacterium leprae Indicates Potential for Leprosy Transmission.

    Directory of Open Access Journals (Sweden)

    Arthur da Silva Neumann

    Full Text Available Leprosy is a chronic dermato-neurological disease caused by infection with Mycobacterium leprae. In 2013 almost 200,000 new cases of leprosy were detected around the world. Since the first symptoms take from years to decades to appear, the total number of asymptomatic patients is impossible to predict. Although leprosy is one of the oldest records of human disease, the mechanisms involved with its transmission and epidemiology are still not completely understood. In the present work, we experimentally investigated the hypothesis that the mosquitoes Aedes aegypti and Culex quinquefasciatus and the hemiptera Rhodnius prolixus act as leprosy vectors. By means of real-time PCR quantification of M. leprae 16SrRNA, we found that M. leprae remained viable inside the digestive tract of Rhodnius prolixus for 20 days after oral infection. In contrast, in the gut of both mosquito species tested, we were not able to detect M. leprae RNA after a similar period of time. Inside the kissing bug Rhodnius prolixus digestive tract, M. leprae was initially restricted to the anterior midgut, but gradually moved towards the hindgut, in a time course reminiscent of the life cycle of Trypanosoma cruzi, a well-known pathogen transmitted by this insect. The maintenance of M. leprae infectivity inside the digestive tract of this kissing bug is further supported by successful mice footpad inoculation with feces collected 20 days after infection. We conclude that Rhodnius prolixus defecate infective M. leprae, justifying the evaluation of the presence of M. leprae among sylvatic and domestic kissing bugs in countries endemic for leprosy.

  20. Experimental Infection of Rhodnius prolixus (Hemiptera, Triatominae) with Mycobacterium leprae Indicates Potential for Leprosy Transmission.

    Science.gov (United States)

    Neumann, Arthur da Silva; Dias, Felipe de Almeida; Ferreira, Jéssica da Silva; Fontes, Amanda Nogueira Brum; Rosa, Patricia Sammarco; Macedo, Rafael Enrique; Oliveira, José Henrique; Teixeira, Raquel Lima de Figueiredo; Pessolani, Maria Cristina Vidal; Moraes, Milton Ozório; Suffys, Philip Noel; Oliveira, Pedro L; Sorgine, Marcos Henrique Ferreira; Lara, Flavio Alves

    2016-01-01

    Leprosy is a chronic dermato-neurological disease caused by infection with Mycobacterium leprae. In 2013 almost 200,000 new cases of leprosy were detected around the world. Since the first symptoms take from years to decades to appear, the total number of asymptomatic patients is impossible to predict. Although leprosy is one of the oldest records of human disease, the mechanisms involved with its transmission and epidemiology are still not completely understood. In the present work, we experimentally investigated the hypothesis that the mosquitoes Aedes aegypti and Culex quinquefasciatus and the hemiptera Rhodnius prolixus act as leprosy vectors. By means of real-time PCR quantification of M. leprae 16SrRNA, we found that M. leprae remained viable inside the digestive tract of Rhodnius prolixus for 20 days after oral infection. In contrast, in the gut of both mosquito species tested, we were not able to detect M. leprae RNA after a similar period of time. Inside the kissing bug Rhodnius prolixus digestive tract, M. leprae was initially restricted to the anterior midgut, but gradually moved towards the hindgut, in a time course reminiscent of the life cycle of Trypanosoma cruzi, a well-known pathogen transmitted by this insect. The maintenance of M. leprae infectivity inside the digestive tract of this kissing bug is further supported by successful mice footpad inoculation with feces collected 20 days after infection. We conclude that Rhodnius prolixus defecate infective M. leprae, justifying the evaluation of the presence of M. leprae among sylvatic and domestic kissing bugs in countries endemic for leprosy.

  1. The Secondary Contact Zone of Phylogenetic Lineages of the Philaenus spumarius (Hemiptera: Aphrophoridae): An Example of Incomplete Allopatric Speciation

    Science.gov (United States)

    Lis, Agata; Maryańska-Nadachowska, Anna; Lachowska-Cierlik, Dorota; Kajtoch, Łukasz

    2014-01-01

    Abstract Previous studies on the phylogeography of the meadow spittlebug Philaenus spumarius (L.) (Hemiptera: Aphrophoridae) suggest the existence of a contact zone of its main phylogenetic lineages along mountain chains in Europe and western Asia. This study presents a detailed examination of the population genetics of P. spumarius within the Carpathian Mountains. The main objective was to determine whether the populations inhabiting that area consist of individuals belonging to different genetic units and whether the observed pattern could be an example of secondary contact zone which formed after incomplete allopatric speciation. Specimens from six transects across the Carpathian arc were examined. The mitochondrial phylogeography of the meadow spittlebug in the examined area clearly shows that individuals from both main clades meet and mix there. Representatives of all three main EF1-α clades were also found. The present distribution of the main clades with a zone of overlap along the mountain ranges may suggest that these phylogenetic lineages form a young hybrid zone. Moreover, a limited number of individuals were shown to possess heteroplasmic mitochondrial DNA, which gives additional support to intraspecific hybridization. P. spumarius could be used in future work as an excellent model species in investigating population genetics, intraspecific hybridization, and speciation in progress. PMID:25500280

  2. Influence of mating disruption on the reproductive biology of the vine mealybug, Planococcus ficus (Hemiptera: Pseudococcidae), under field conditions.

    Science.gov (United States)

    Cocco, Arturo; Muscas, Enrico; Mura, Alessandra; Iodice, Andrea; Savino, Francesco; Lentini, Andrea

    2018-05-08

    Although mating disruption is increasingly being used to control the worldwide grapevine pest vine mealybug, Planococcus ficus (Signoret) (Hemiptera: Pseudococcidae), its mode of action remains unclear. A three-year field experiment was carried out to investigate the effects of mating disruption on the development and reproduction of the vine mealybug. The influence of mating disruption applied over consecutive years on the pest population density was also evaluated. The percentage of ovipositing females was significantly reduced in disrupted plots by 18.8-66.2%, depending on the year. The absence of ovipositing females in disrupted plots in the autumn of the second and third year indicates the effectiveness of mating disruption throughout the whole growing season. Mating disruption consistently prolonged the pre-oviposition period in all years by up to 12.5 days. Our findings provide new insights into the mechanisms underlying the pheromone-based control of the vine mealybug and indicate that the reduction of the pest population density is due to both a decrease and delay in female mating. In addition, the population density of vine mealybugs under mating disruption decreased over years, indicating that consecutive applications of this control strategy would significantly increase the effectiveness of controlling the vine mealybug by mating disruption. This article is protected by copyright. All rights reserved.

  3. Chlorotic feeding injury by the black pecan aphid (hemiptera: aphididae) to pecan foliage promotes aphid settling and nymphal development.

    Science.gov (United States)

    Cottrell, Ted E; Wood, Bruce W; Ni, Xinzhi

    2009-04-01

    The nature of the interaction between the black pecan aphid, Melanocallis caryaefoliae (Davis) (Hemiptera: Aphididae), and the chlorosis it causes to foliage of its pecan [Carya illinoinensis (Wangenh.) K. Koch)] host is poorly understood. Laboratory experiments were conducted on the settling behavior of the black pecan aphid, when provided chlorotic pecan leaf discs resulting from previous black pecan aphid feeding and nonchlorotic leaf discs, under a normal photoperiod and constant dark. Additionally, aphid development from the first instar to the adult stage was examined when nymphs were either allowed to feed on the same leaf disc or moved daily to a new, nondamaged, same age leaf disc. After 24 h, a significantly higher percentage of black pecan aphids settled on chlorotic than on nonchlorotic leaf discs, regardless of photoperiod. When starting from the first instar, nymphs that were prevented from inducing leaf chlorosis by moving daily to new, same-age leaf discs took approximately 5 d longer to complete development, had a shorter body length, and had higher mortality than when aphids remained on the same leaf disc. These results show that black pecan aphid-induced leaf chlorosis plays an important role in the interaction of the black pecan aphid with its pecan host.

  4. Parasitoids associated with the black scale Saissetia oleae(Olivier (Hemiptera: Coccidae in olive trees in Minas Gerais State, Brazil

    Directory of Open Access Journals (Sweden)

    Ernesto Prado

    2015-10-01

    Full Text Available Black scale, Saissetia oleae (Olivier (Hemiptera: Coccidae is an important pest of olive trees (Olea europaea L. that requires the use insecticides for its control. Parasitoids are important regulating agents of this pest, but currently, no information on its complex of natural enemies and their impact on black scale in Brazilian conditions exists. This study focused on identifying parasitoid wasps that were associated with the black scale on olive trees to establish their relative abundance and rate of parasitism. Samplings were maintained in an olive orchard located in Maria da Fe, south of the state of Minas Gerais, Brazil, and infested branches were stored in emergence containers to recover parasitoids. Another group was kept in Flanders batteries to evaluate the rate of parasitism in approximately 100 scales. Sixteen parasitoid species were collected during the sampling period, and the most common species were Coccophagus caridei (Brèthes (Hymenoptera: Aphelinidae, Diversinervus elegans Silvestri (Hymenoptera: Encyrtidae, and Mesopeltita truncatipennis (Waterston (Hymenoptera: Pteromalidae, the latter of which was most abundant and frequent. Parasitism ranged from 3 to 31% with peaks in summer and autumn. This level could be considered insufficient to hold the black scale under the economic injury level; however, these parasitoids should be preserved for contributions to population regulation.

  5. 77 FR 67366 - Federal Acquisition Regulation; Information Collection; Quality Assurance Requirements

    Science.gov (United States)

    2012-11-09

    .... Glover, Sr., Procurement Analyst, Contract Policy Division, GSA (202) 501-1448 or email [email protected] . SUPPLEMENTARY INFORMATION: A. Purpose Supplies and services acquired under Government contracts..., acceptance, warranty, and other measures associated with quality requirements. Standard clauses related to...

  6. 2528-IJBCS-Article-Cocou A Djihinto

    African Journals Online (AJOL)

    hp

    (endosulfan 700 g/ha) pour le contrôle des populations de Aphis gossypii, Pectinophora gossypiella et .... chaque ligne mesure 20 mètres de longeur. .... performance de Fanga 500 EC en milieu réel ..... fenêtre et gestion de Helicoverpa.

  7. Field and laboratory evaluations of soybean lines against soybean aphid (Hemiptera: Aphididae).

    Science.gov (United States)

    Hesler, Louis S; Prischmann, Deirdre A; Dashiell, Kenton E

    2012-04-01

    The soybean aphid, Aphis glycines Matsumura (Hemiptera: Aphididae), is a major pest of soybean, Glycine max (L.). Merr., that significantly reduces yield in northern production areas of North America. Insecticides are widely used to control soybean aphid outbreaks, but efforts are underway to develop host plant resistance as an effective alternative management strategy. Here, previously identified resistant lines were evaluated in laboratory tests against field-collected populations of soybean aphid and in field-plot tests over 2 yr in South Dakota. Six lines previously identified with resistance to soybean aphid--Jackson, Dowling, K1639, Cobb, Palmetto and Sennari--were resistant in this study, but relatively high aphid counts on Tie-feng 8 in field plots contrasted with its previously reported resistance. Bhart-PI 165989 showed resistance in one of two laboratory tests, but it had relatively large aphid infestations in both years of field tests. Intermediate levels of soybean aphid occurred in field plots on lines previously shown to have strong (Sugao Zairai, PI 230977, and D75-10169) or moderate resistance to soybean aphid (G93-9223, Bragg, Braxton, and Tracy-M). Sugao Zairai also failed to have a significant proportion of resistant plants in two laboratory tests against aphids field-collected in 2008, but it was resistant in laboratory tests with aphids collected in 2002, 2005, and 2006. Overall, results showed that lines with Rag (i.e., Jackson) or Rag1 gene (i.e., Dowling) had low aphid numbers, whereas lines with Rag2 (i.e., Sugao Zairai, Sennari) had mixed results. Collectively, responses of soybean aphid populations in laboratory and field tests in 2008 resembled a virulence pattern reported previously for biotype 3 soybean aphids, but virulence in soybean aphid populations was variable and dynamic over years of the study. These results, coupled with previous reports of biotypes virulent to Rag1, suggest that deployment of lines with a single aphid

  8. Infeksi Cucumber mosaic virus dan Chilli veinal mottle virus pada Cabai di Kabupaten Rejang Lebong, Bengkulu

    Directory of Open Access Journals (Sweden)

    Mimi Sutrawati

    2013-04-01

    Full Text Available Mosaic disease caused by Cucumber mosaic virus (CMV and Chilli veinal mottle Virus (ChiVMV has been distributed widely in chilli in Indonesia and considered as important disease. A research was conducted to investigate the spread and incidence of CMV and ChiVMV in Rejang Lebong, Bengkulu and to identify its insect vector. Symptomatic and asymptomatic leaf samples were collected systematically from several chillipepper fields for further detection by DAS-ELISA (Double antibody sandwich-enzyme linked immunosorbant assay using specific antibody for CMV and ChiVMV. The result showed that infection of both CMV and ChiVMV was found with disease incidence reached 20-50%, whereas infection only by ChiVMV or CMV were 50-80% and 20-50%, respectively. One species of aphid, i.e. Aphis gossypii was found from the fields.Key words: Aphis gossypii, CMV, ChiVMV, disease incidence

  9. Evaluation of acute toxicity of essential oil of garlic (Allium sativum) and its selected major constituent compounds against overwintering Cacopsylla chinensis (Hemiptera: Psyllidae).

    Science.gov (United States)

    Zhao, Na Na; Zhang, Hang; Zhang, Xue Chang; Luan, Xiao Bing; Zhou, Cheng; Liu, Qi Zhi; Shi, Wang Peng; Liu, Zhi Long

    2013-06-01

    In our screening program for insecticidal activity of the essential oils/extracts derived from some Chinese medicinal herbs and spices, garlic (Allium sativum L.) essential oil was found to possess strong insecticidal activity against overwintering adults of Cacopsylla chinensis Yang et Li (Hemiptera: Psyllidae). The commercial essential oil of A. sativum was analyzed by gas chromatography-mass spectrometry. Sixteen compounds, accounting for 97.44% of the total oil, were identified, and the main components of the essential oil of A. sativum were diallyl trisulfide (50.43%), diallyl disulfide (25.30%), diallyl sulfide (6.25%), diallyl tetrasulfide (4.03%), 1,2-dithiolane (3.12%), allyl methyl disulfide (3.07%), 1,3-dithiane (2.12%), and allyl methyl trisulfide (2.08%). The essential oil of A. sativum possessed contact toxicity against overwintering C. chinensis, with an LC50 value of 1.42 microg per adult. The two main constituent compounds, diallyl trisulfide and diallyl disulfide, exhibited strong acute toxicity against the overwintering C. chinensis, with LC50 values of 0.64 and 11.04 /g per adult, respectively.

  10. Distribution and infestation levels of Crypticerya multicicatrices Kondo and Unruh (Hemiptera: Monophlebidae on San Andrés island

    Directory of Open Access Journals (Sweden)

    Takumasa Kondo Kondo

    2014-01-01

    Full Text Available The fluted scale Crypticerya multicicatrices (Hemiptera: Monophlebidae is an invasive insect that became a major pest on the island of San Andrés. To generate control strategies for this insect, its distribution and infestation levels on palm species, fruit trees, leguminous trees and other plant species were determined during January 14–18, 2013. A total of 96 points were sampled in order to determine the distribution of the insect on the island. During the study, the fluted scale was found distributed throughout the island of San Andrés, including Haynes Cay and Johnny Cay. The palms were the plants with the highest levels of infestation, 70.8% had some degree of infestation (37.5% high infestation levels; followed by fruit trees which had 65.6% with some degree of infestation (30.2% high infestation levels; followed by leguminous trees which had 59.6% with some degree of infestation (13.5% high infestation levels and finally “other hosts” which had 51.1% with some level of infestation (11.5% high infestation levels. This study is the first detailed mapping of C. multicicatrices on the island of San Andrés which will become the basis for future work on the population dynamics of the fluted scale and its distribution on the island.

  11. Revision of the Malagasy lanternfly genus Belbina Stål, 1863, with two new species (Hemiptera: Fulgoromorpha: Fulgoridae

    Directory of Open Access Journals (Sweden)

    Jérôme Constant

    2014-11-01

    Full Text Available The Malagasy genus Belbina Stål, 1863 (Hemiptera: Fulgoridae is revised, transferred from the Enchophorinae Haupt, 1829 to the Aphaeninae Blanchard, 1847, and two new species, B. bourgoini sp. nov. and B. laetitiae sp. nov., are described. The genus Cornelia Stål, 1866 is proposed as a junior synonym of Belbina. The following new combinations are proposed: Belbina bergrothi (Schmidt, 1911 comb. nov. and B. nympha (Stål, 1866 comb. nov. The combination Belbina foliacea Lallemand, 1950 is restored. Aphana madagascariensis Westwood, 1851 is redescribed, transferred to Belbina and the new combination B. madagascariensis (Westwood, 1851 comb. nov. is proposed. Belbina vicina Lallemand, 1959 is proposed as a junior synonym of B. falleni Stål, 1863 and Cornelia atomaria (Brancsik, 1893 as a junior synonym of Belbina nympha (Stål, 1866. Neotypes are designated for B. madagascariensis (Westwood, 1851 and B. servillei (Spinola, 1839. The genus now comprises 12 species from Madagascar. A list of diagnostic characters, an identification key, illustrations of the male genitalia and distribution maps are provided. The falleni+ species group is defined based on characters of the male genitalia and contains the following 5 species: B. bloetei Lallemand, 1959, B. falleni Stål, 1863, B. laetitiae sp. nov., B. lambertoni Lallemand, 1922 and B. pionneaui Lallemand, 1922.

  12. Phylogeny and niche conservatism in North and Central American triatomine bugs (Hemiptera: Reduviidae: Triatominae), vectors of Chagas' disease.

    Science.gov (United States)

    Ibarra-Cerdeña, Carlos N; Zaldívar-Riverón, Alejandro; Peterson, A Townsend; Sánchez-Cordero, Víctor; Ramsey, Janine M

    2014-10-01

    The niche conservatism hypothesis states that related species diverge in niche characteristics at lower rates than expected, given their lineage divergence. Here we analyze whether niche conservatism is a common pattern among vector species (Hemiptera: Reduviidae: Triatominae) of Trypanosoma cruzi that inhabit North and Central America, a highly heterogeneous landmass in terms of environmental gradients. Mitochondrial and nuclear loci were used in a multi-locus phylogenetic framework to reconstruct phylogenetic relationships among species and estimate time of divergence of selected clades to draw biogeographic inferences. Then, we estimated similarity between the ecological niche of sister species and tested the niche conservatism hypothesis using our best estimate of phylogeny. Triatoma is not monophyletic. A primary clade with all North and Central American (NCA) triatomine species from the genera Triatoma, Dipetalogaster, and Panstrongylus, was consistently recovered. Nearctic species within the NCA clade (T. p. protracta, T. r. rubida) diverged during the Pliocene, whereas the Neotropical species (T. phyllosoma, T. longipennis, T. dimidiata complex) are estimated to have diverged more recently, during the Pleistocene. The hypothesis of niche conservatism could not be rejected for any of six sister species pairs. Niche similarity between sister species best fits a retention model. While this framework is used here to infer niche evolution, it has a direct impact on spatial vector dynamics driven by human population movements, expansion of transportation networks and climate change scenarios.

  13. An assessment of interspecific competition between two introduced parasitoids of Diaphorina citri (Hemiptera: Liviidae) on caged citrus plants.

    Science.gov (United States)

    Vankosky, Meghan A; Hoddle, Mark S

    2017-06-07

    Two parasitoids attacking nymphs of Asian citrus psyllid, Diaphorina citri Kuwayama (Hemiptera: Liviidae), Tamarixia radiata (Waterston) (Hymenoptera: Eulophidae) and Diaphorencyrtus aligarhensis (Shafee, Alam & Agarwal) (Hymenoptera: Encyrtidae) are being released in California, USA in a classical biological control program. To evaluate the effect of multiple parasitoid species on D. citri mortality, we conducted mesocosm experiments under controlled conditions using a complete block design with 6 treatments (D. citri nymphs exposed to: no parasitoids; D. aligarhensis or T. radiata alone; D. aligarhensis or T. radiata released first (by 48 h); and both species released simultaneously). Parasitism of D. citri nymphs by T. radiata exceeded 60% and was unchanged when D. aligarhensis were present. Parasitism by D. aligarhensis was greatest when T. radiata was absent (∼28%) and was reduced in all treatments with T. radiata present (citri mortality and parasitoid-related mortality of D. citri was consistent across parasitoid treatments. Laboratory results suggest that competition between D. aligarhensis and T. radiata is asymmetric and favors T. radiata. It may be difficult for D. aligarhensis to contribute significantly to D. citri biological control where T. radiata is present. However, results reported here suggest that competition between T. radiata and D. aligarhensis is not likely to reduce parasitism by T. radiata or reduce parasitoid-induced mortality of D. citri. © 2017 Institute of Zoology, Chinese Academy of Sciences.

  14. Optical illusions in scanning electron micrographs: the case of the eggshell of Acrosternum (Chinavia) marginatum (Hemiptera: Pentatomidae).

    Science.gov (United States)

    Wolf, Klaus W; Reid, Walton; Schrauf, Michael

    2003-01-01

    Scanning electron microscopy revealed that-as is common in this family of the Hemiptera-the eggs of the green stink bug Acrosternum (Chinavia) marginatum are roughly barrel-shaped and possess at their apical pole a row of slender extensions, the aero-micropylar processes. The outer surface of the eggshell carries hexagonally arranged pits. The analysis of cross-fractured eggshells showed that the pits have slender basal extensions with transverse diaphragms. When scanning electron micrographs of the egg surface of A. marginatum are viewed upside down, the perception flips and the pits appear as elevations to all observers addressed. Thus, we are dealing with an optical illusion, which is known as the 'shape-from-shading effect'. The perceived dents remain robust to changes in the angle of recording (zero to ca. 60 degrees tilt), the magnification (ca. x100 to x1400), and the number of pits included in the micrograph (one to several hundred). When through appropriate positioning of the specimen under the electron beam, contrast is significantly reduced and the distinct shadows at the slope of the pits are eliminated, the optical illusion does not appear. It is inferred that shades provide the decisive clue that determines whether bumps or dents will be perceived. Owing to the low resolution of their compound eyes, the shape-from-shading effect on the eggshell of the bug is in all likelihood not perceived by insects.

  15. ASPECTOS BIOLÓGICOS DE Euborellia annulipes (DERMAPTERA: ANISOLABIDIDAE ALIMENTADA COM O PULGÃO Hyadaphis foeniculi (HEMIPTERA: APHIDIDAE

    Directory of Open Access Journals (Sweden)

    ALDENI BARBOSA DA SILVA

    2010-01-01

    Full Text Available The cultivation of sweet herb of great economic importance for small farmers in the micro and Agrest Swamp of Paraíba and also in the state of Pernambuco. Among the natural enemies, the scissors Euborellia annulipes proves to be a voracious predator, that is, with high ability to attack and feed on different prey, particularly of eggs and immature stages of insects of Lepidoptera, Hemiptera, Coleoptera and Diptera. The objective of this research was to study the biological aspects of E. annulipes on H. foeniculi laboratory. The study was conducted at the Entomology Laboratory, Department of Plant Protection at the UFPB in a climatic chamber, at 25 ± 1 ºC, relative humidity of 70 ± 10% RH and 12 hours. Scissors were selected in adulthood from rearing on artificial diet in the laboratory. From these insects have made observations of posture, viability and morphology of eggs of E. annulipes. Fifty nymphs were selected for each stage of development (1, 2, 3, 4 and 5 of the scissors and fed separately with aphids (1st-2nd, 3rd and 4th instar. There has been evaluation regarding the number and duration of instars. There are five instars to the nymphal stage of E. annulipes, the average incubation period was 12.9 days, pre-oviposition period of 18.2 days and 46.75 eggs per clutch, there was an increase of nymphal E. annulipes in that it offered up more aphids developed.

  16. Comparative Mitogenomics of Plant Bugs (Hemiptera: Miridae): Identifying the AGG Codon Reassignments between Serine and Lysine

    Science.gov (United States)

    Wang, Pei; Song, Fan; Cai, Wanzhi

    2014-01-01

    Insect mitochondrial genomes are very important to understand the molecular evolution as well as for phylogenetic and phylogeographic studies of the insects. The Miridae are the largest family of Heteroptera encompassing more than 11,000 described species and of great economic importance. For better understanding the diversity and the evolution of plant bugs, we sequence five new mitochondrial genomes and present the first comparative analysis of nine mitochondrial genomes of mirids available to date. Our result showed that gene content, gene arrangement, base composition and sequences of mitochondrial transcription termination factor were conserved in plant bugs. Intra-genus species shared more conserved genomic characteristics, such as nucleotide and amino acid composition of protein-coding genes, secondary structure and anticodon mutations of tRNAs, and non-coding sequences. Control region possessed several distinct characteristics, including: variable size, abundant tandem repetitions, and intra-genus conservation; and was useful in evolutionary and population genetic studies. The AGG codon reassignments were investigated between serine and lysine in the genera Adelphocoris and other cimicomorphans. Our analysis revealed correlated evolution between reassignments of the AGG codon and specific point mutations at the antidocons of tRNALys and tRNASer(AGN). Phylogenetic analysis indicated that mitochondrial genome sequences were useful in resolving family level relationship of Cimicomorpha. Comparative evolutionary analysis of plant bug mitochondrial genomes allowed the identification of previously neglected coding genes or non-coding regions as potential molecular markers. The finding of the AGG codon reassignments between serine and lysine indicated the parallel evolution of the genetic code in Hemiptera mitochondrial genomes. PMID:24988409

  17. Methyl salicylate attracts natural enemies and reduces populations of soybean aphids (Hemiptera: Aphididae) in soybean agroecosystems.

    Science.gov (United States)

    Mallinger, Rachel E; Hogg, David B; Gratton, Claudio

    2011-02-01

    Methyl salicylate, an herbivore-induced plant volatile, has been shown to attract natural enemies and affect herbivore behavior. In this study, methyl salicylate was examined for its attractiveness to natural enemies of the soybean aphid, Aphis glycines Matsumura (Hemiptera: Aphididae), and for its direct effects on soybean aphid population growth rates. Methyl salicylate lures were deployed in plots within organic soybean [Glycine max (L.) Merr.] fields. Sticky card traps adjacent to and 1.5 m from the lure measured the relative abundance of natural enemies, and soybean aphid populations were monitored within treated and untreated plots. In addition, exclusion cage studies were conducted to determine methyl salicylate's effect on soybean aphid population growth rates in the absence of natural enemies. Significantly greater numbers of syrphid flies (Diptera: Syrphidae) and green lacewings (Neuroptera: Chrysopidae) were caught on traps adjacent to the methyl salicylate lure, but no differences in abundance were found at traps 1.5 m from the lure. Furthermore, abundance of soybean aphids was significantly lower in methyl salicylate-treated plots. In exclusion cage studies, soybean aphid numbers were significantly reduced on treated soybean plants when all plants were open to natural enemies. When plants were caged, however, soybean aphid numbers and population growth rates did not differ between treated and untreated plants suggesting no effect of methyl salicylate on soybean aphid reproduction and implicating the role of natural enemies in depressing aphid populations. Although aphid populations were reduced locally around methyl salicylate lures, larger scale studies are needed to assess the technology at the whole-field scale.

  18. Biology of Blepyrus clavicornis (Compere (Hymenoptera: Encyrtidae, a parasitoid of Pseudococcus viburni (Signoret (Hemiptera: Pseudococcidae

    Directory of Open Access Journals (Sweden)

    Vitor Pacheco da Silva

    Full Text Available Abstract Encyrtids (Hymenoptera: Encyrtidae are the most important and diverse group of natural enemies of mealybugs (Hemiptera: Pseudococcidae. Blepyrus clavicornis (Compere is the most common parasitoid associated with Pseudococcus viburni (Signoret in the Serra Gaúcha region, Brazil. We conducted laboratory studies to assess the development time, sex ratio, adult longevity, host stage selection for parasitism, and effect of food on the longevity of adult females of B. clavicornis. The experiments were conducted in a climate chamber at 25 ± 1 °C, 70 ± 10% RH and 12:12 L:D photoperiod. The solitary parasitoid B. clavicornis parasitized third-instar and adult female stages of P. viburni. The development time was more than 30 days (31.75 ± 0.38 for females and 30.02 ± 0.34 for males when B. clavicornis laid eggs in adult mealybug females, and 35 days (36.50 ± 0.50 for females and 34.24 ± 0.43 for males on third-instar mealybug nymphs. The wasps did not survive longer than four days when they were fed only water, while females survived for about 30 days when fed with honey. The lifespan of females is about 20 days longer than the lifespan of males. Although B. clavicornis can provide significant natural control, reducing the number of individuals in the next generation by parasitizing advanced mealybug instars, we consider it unpromising for use in applied biological-control programs. Furthermore, the predominance of males in the progeny observed here suggests that P. viburni may not be the most suitable or preferred host for B. clavicornis.

  19. Populations of Rice Grain Bug, Paraeuscosmetus pallicomis, (Hemiptera: Lygaeidae) in Weed-free Paddy Field, Weedy Paddy Field and Paddy Dykes.

    Science.gov (United States)

    Abdullah, Tamrin; Nasruddin, Andi; Agus, Nurariaty

    2017-07-01

    Research on the populations of rice grain bug Paraeuscosmetus pallicomis Dallas (Hemiptera: Lygaeidae) in paddy field ecosystems was performed with the aim to determine the populations of rice grain bug in weed-free paddy field, weedy paddy field, and paddy dykes. Experiment was carried out in the village of Paccellekang in the district of Patallasang of Gowa Regency in South Sulawesi, Indonesia. Observations were performed during the milky grain stage (85 days after planting), the mature grain stage (105 days after planting), and one day after harvest (115 days after transplanting). Results showed that 85 days after the transplanting, the populations of rice grain bug was significantly higher in the weedy paddy field compared to weed-free field and paddy dykes with total numbers of 1.75, 3.53, and 0.31 insects per 2 hills, respectively. Similarly, 105 days after the transplanting, 2.53, 5.53, and 0.11 insects per hill, respectively. However, one day after the harvest (115 days after transplanting) the number of insects in weed-free field decreased, while in the dykes increased, and the weedy plot still had the highest number of insects per 2 hills. Our results suggested that weeds played an important role in regulating the bug population by providing alternative shelter and foods for the insect.

  20. Registros de ocorrência e novos hospedeiros de Gargaphia lunulata (Mayr (Hemiptera: Tingidae nos estados do Acre e Paraná

    Directory of Open Access Journals (Sweden)

    Rodrigo Santos

    2017-12-01

    Abstract. The occurrence of Gargaphia lunulata (Mayr (Hemiptera: Tingidae was observed in leaves of four host plants: rue (Ruta graveolens L. and jack bean (Canavalia ensiformis (L. DC in an urban residential garden, in the municipality of Rio Branco, Acre State, Brazil and Crotalaria spectabilis (L., jack bean and okra (Abelmoschus esculentus L. Moench in a greenhouse, in the municipality of Londrina, Paraná State, Brazil. The colonies were found exclusively on the abaxial face of the leaves, causing chlorosis, wilting and early senescence of the same. Because G. lunulata is considered to be an important passion fruit pest in Brazil, the planting of the mentioned plant species, in intercropping or near to passion fruit crops, would not be recommended, since they could serve as plant species inoculum to passion fruit cultivation. Therefore, the occurrence of G. lunulata associated to R. graveolens and jack bean in Acre State; and C. spectabilis, jack bean, and okra, in Paraná State is record for the first time. In addition, the present work reports the first occurrence of this tingid to the States of Acre and Paraná and reports two new hosts for this insect, R. graveolens and C. spectabillis in Brazil.

  1. Atração e desenvolvimento de Leptoglossus gonagra (Fabr. (Hemiptera: Coreidae em cultivares de abóbora e moranga

    Directory of Open Access Journals (Sweden)

    Baldin Edson Luiz Lopes

    2002-01-01

    Full Text Available As plantas da família Cucurbitaceae são seriamente prejudicadas pelo ataque de insetos, sendo que os danos ocorrem desde a germinação até a colheita e podem ser observados em todas as partes da planta. Dentre os insetos sugadores que atacam a abóbora (Cucurbita moschata e a moranga (C. maxima, as formas jovens e adultas do percevejo Leptoglossus gonagra (Fabr. (Hemiptera: Coreidae merecem destaque por sugarem a seiva das folhas, ramos e frutos novos, nos quais causam necroses, reduzindo a produção. Visando comparar a atratividade de plântulas de cultivares de abóbora e moranga a adultos deste percevejo e os efeitos desses materiais sobre a biologia de ninfas dessa espécie, realizaram-se ensaios sob condições de laboratório. Em teste de atratividade, o cultivar de abóbora BRA015113 destacou-se como o menos atrativo em relação ao cultivar de moranga Exposição, enquanto que o cultivar de abóbora BRA003531 foi o mais atrativo. Todos os cultivares provocaram 100% de mortalidade das ninfas, indicando a presença de componentes antibióticos, adversos ao desenvolvimento de L. gonagra.

  2. Putting scales into evolutionary time: the divergence of major scale insect lineages (Hemiptera) predates the radiation of modern angiosperm hosts

    Science.gov (United States)

    Vea, Isabelle M.; Grimaldi, David A.

    2016-01-01

    The radiation of flowering plants in the mid-Cretaceous transformed landscapes and is widely believed to have fuelled the radiations of major groups of phytophagous insects. An excellent group to test this assertion is the scale insects (Coccomorpha: Hemiptera), with some 8,000 described Recent species and probably the most diverse fossil record of any phytophagous insect group preserved in amber. We used here a total-evidence approach (by tip-dating) employing 174 morphological characters of 73 Recent and 43 fossil taxa (48 families) and DNA sequences of three gene regions, to obtain divergence time estimates and compare the chronology of the most diverse lineage of scale insects, the neococcoid families, with the timing of the main angiosperm radiation. An estimated origin of the Coccomorpha occurred at the beginning of the Triassic, about 245 Ma [228–273], and of the neococcoids 60 million years later [210–165 Ma]. A total-evidence approach allows the integration of extinct scale insects into a phylogenetic framework, resulting in slightly younger median estimates than analyses using Recent taxa, calibrated with fossil ages only. From these estimates, we hypothesise that most major lineages of coccoids shifted from gymnosperms onto angiosperms when the latter became diverse and abundant in the mid- to Late Cretaceous. PMID:27000526

  3. [Potential of Metarhizium anisopliae and Beauveria bassiana isolates and neem oil to control the Aphid Lipaphis erysimi (Kalt.) (Hemiptera: Aphididae)].

    Science.gov (United States)

    de Araujo, José M; Marques, Edmilson J; de Oliveira, José V

    2009-01-01

    This work aimed to determine the efficiency of the entomopathogenic fungi Metarhizium anisopliae and Beauveria bassiana to control the aphid Lipaphis erysimi (Kalt.) (Hemiptera: Aphididae) in kale Brassica oleracea var acephala D.C., as well as their compatibility with a neem oil formulation (Neemseto). Ten isolates of both fungi were tested and the most pathogenic ones were B. bassiana CG001 and M. anisopliae CG30 with 90% and 4.4 days, and 64% and 3.8 days of mortality and median lethal time, respectively. Bioassays with neem at concentrations of 0.5, 1.0 and 2.0% were done either by leaf discs dipping or spraying the aphids on the leaf discs. The neem spraying treatment at 2.0% provided 90% mortality. The use of B. bassiana isolate CG001 or M. anisopliae isolate CG30 with neem at 0.125, 0.25, and 0.5%, demonstrated that these isolates could have their spore viability or colony growth affected when exposed to neem concentrations higher than 0.25%. In absolute values, the isolates B. bassiana CG001 and M. anisopliae CG30 are the most virulent to L. erysimi, and could be utilized in the management of this pest.

  4. Potential of Metarrhizium anisopliae and Beauveria bassiana isolates and Neem oil to control the aphid Lipaphis erysimi (Kalt.) (Hemiptera: Aphididae)

    International Nuclear Information System (INIS)

    Araujo Junior, Jose M. de; Marques, Edmilson J.; Oliveira, Jose V. de

    2009-01-01

    This work aimed to determine the efficiency of the entomopathogenic fungi Metarrhizium anisopliae and Beauveria bassiana to control the aphid Lipaphis erysimi (Kalt.) (Hemiptera:Aphididae) in kale Brassica oleracea var acephala D.C., as well as their compatibility with a neem oil formulation (Neemseto R ). Ten isolates of both fungi were tested and the most pathogenic ones were B. bassiana CG001 and M. anisopliae CG30 with 90% and 4.4 days, and 64% and 3.8 days of mortality and median lethal time, respectively. Bioassays with neem at concentrations of 0.5, 1.0 and 2.0% were done either by leaf discs dipping or spraying the aphids on the leaf discs. The neem spraying treatment at 2.0% provided 90% mortality. The use of B. bassiana isolate CG001 or M. anisopliae isolate CG30 with neem at 0.125, 0.25, and 0.5%, demonstrated that these isolates could have their spore viability or colony growth affected when exposed to neem concentrations higher than 0.25%. In absolute values, the isolates B. bassiana CG001 and M. anisopliae CG30 are the most virulent to L. erysimi, and could be utilized in the management of this pest. (author)

  5. High-resolution melt and morphological analyses of mealybugs (Hemiptera: Pseudococcidae) from cacao: tools for the control of Cacao swollen shoot virus spread.

    Science.gov (United States)

    Wetten, Andy; Campbell, Colin; Allainguillaume, Joël

    2016-03-01

    Mealybugs (Hemiptera: Coccoidea: Pseudococcidae) are key vectors of badnaviruses, including Cacao swollen shoot virus (CSSV), the most damaging virus affecting cacao (Theobroma cacao L.). The effectiveness of mealybugs as virus vectors is species dependent, and it is therefore vital that CSSV resistance breeding programmes in cacao incorporate accurate mealybug identification. In this work, the efficacy of a CO1-based DNA barcoding approach to species identification was evaluated by screening a range of mealybugs collected from cacao in seven countries. Morphologically similar adult females were characterised by scanning electron microscopy, and then, following DNA extraction, were screened with CO1 barcoding markers. A high degree of CO1 sequence homology was observed for all 11 individual haplotypes, including those accessions from distinct geographical regions. This has allowed the design of a high-resolution melt (HRM) assay capable of rapid identification of the commonly encountered mealybug pests of cacao. HRM analysis readily differentiated between mealybug pests of cacao that cannot necessarily be identified by conventional morphological analysis. This new approach, therefore, has potential to facilitate breeding for resistance to CSSV and other mealybug-transmitted diseases. © 2015 Society of Chemical Industry.

  6. Anagrus nedotepae sp. n. (Hymenoptera: Mymaridae), an egg parasitoid of Nedotepa curta (Hemiptera: Cicadellidae), a pest of coconut palm in West Africa.

    Science.gov (United States)

    Triapitsyn, Serguei V; Kwadjo, K Eric; Rosete, Yaima Arocha

    2017-06-09

    A new Afrotropical species of Anagrus Haliday (Hymenoptera: Mymaridae), A. nedotepae Triapitsyn sp. n., is described and illustrated. The type series was reared from parasitized eggs of the leafhopper Nedotepa curta Dmitriev (Hemiptera: Cicadellidae) during a survey for its natural enemies in Côte d'Ivoire. This peculiar leafhopper, recently described from Ghana (Dmitriev 2016), lays its eggs on leaflets of coconut palm, and could be an economically important pest of this crop in West Africa, particularly because it is a suspected vector of the phytoplasma associated with the Côte d'Ivoire Lethal Yellowing disease of coconut, as characterized by Arocha-Rosete et al. (2014). Coconut lethal yellowing diseases cause severe economic losses to the very important coconut growing industry in several West African countries and elsewhere, being considered a threat of global economic and social significance (Gurr et al. 2016). Thus, the parasitoid may be of potential importance for natural biological control of this pest and urgently needs a scientific name to be used in further publications on its biology and ecology. Such studies are currently underway by the second author, who collected the type series of the new species.

  7. A review and critical analysis of how cognitive neuroscientific investigations using dance can contribute to sport psychology

    NARCIS (Netherlands)

    Cross, E.S.; Acquah, D.; Ramsey, R.

    2014-01-01

    Whether watching Michael Jackson moonwalk or Savion Glover tap dance, it is striking how skilfully some people can move their bodies. The emerging field of cognitive neuroscience has produced important advances in understanding the control and perception of complex action. Here we outline the merits

  8. Revision of the Neotropical treehopper genus Tolania (Hemiptera, Membracidae

    Directory of Open Access Journals (Sweden)

    Jesse L. Albertson

    2006-12-01

    Full Text Available The treehopper genus Tolania Stål (Hemiptera: Membracidae: Nicomiinae: Nicomiini and 69 valid species (59 new are described and illustrated based on adult morphology. Ten informal species groups are recognized based on a previously published phylogenetic analysis: (1 the dira species group comprising T. calista sp. nov., T. dira sp. nov., T. inca sp. nov., T. macaria sp. nov., T. secoya sp. nov., and T. zaparo sp. nov.; (2 the fasciata species group comprising T. fasciata (Walker, T. gracilis sp. nov., and T. laticlava sp. nov.; (3 the femoralis species group comprising T. femoralis Stål, T. fraterna Stål, and T. roberti sp. nov.; (4 the furcata species group comprising T. furcata sp. nov., T. tryphena sp. nov., and T. venezuelensis sp. nov.; (5 the hispida species group comprising T. alida sp. nov., T. hispida sp. nov., and T. periculosa sp. nov.; (6 the malefica species group comprising T. cactina sp. nov., T. curvata sp. nov., T. grallator sp. nov., T. jocosa sp. nov., T. mackameyi sp. nov., T. malefica sp. nov., T. obliqua (Walker, and T. terencia sp. nov.; (7 the obtusa species group comprising T. obtusa Fowler, T. obunca sp. nov., and T. torosa sp. nov.; (8 the opponens species group comprising T. alvira sp. nov., T. arcuata sp. nov., T. damia sp. nov., T. insolita sp. nov., T. lunata sp. nov., T. lurida sp. nov., T. opponens (Walker, T. oriana sp. nov., T. reflexa sp. nov., T. risa sp. nov., T. sinuata sp. nov., T. trilobata sp. nov., T. tumida sp. nov., T. umbella sp. nov., T. vitocensis sp. nov., T. woodi sp. nov., and T. xantha sp. nov.; (9 the peltacauda species group comprising T. brasiliensis sp. nov., T. iratafelis sp. nov., T. modesta sp. nov., T. peltacauda sp. nov., T. picta sp. nov., and T. thyrea sp. nov.; and (10 the semipellucida species group comprising T. atrata sp. nov., T. fimbriata sp. nov., T. nicia sp. nov., and T. semipellucida Stål. The following new species are not placed in species groups: T. anomala sp. nov

  9. In field damage of high and low cyanogenic cassava due to a generalist insect herbivore Cyrtomenus bergi (Hemiptera: Cydnidae).

    Science.gov (United States)

    Riis, Lisbeth; Bellotti, Anthony Charles; Castaño, Oscar

    2003-12-01

    The hypothesis that cyanogenic potential in cassava roots deters polyphagous insects in the field is relevant to current efforts to reduce or eliminate the cyanogenic potential in cassava. To test this hypothesis, experiments were conducted in the field under natural selection pressure of the polyphagous root feeder Cyrtomenus bergi Froeschner (Hemiptera: Cydnidae). A number of cassava varieties (33) as well as 13 cassava siblings and their parental clone, each representing a determined level of cyanogenic potential (CNP), were scored for damage caused by C. bergi and related to CNP and nonglycosidic cyanogens, measured as hydrogen cyanide. Additionally, 161 low-CNP varieties (Agricultura Tropical (CIAT) were screened for resistance/tolerance to C. bergi. Low root damage scores were registered at all levels of CNP. Nevertheless, CNP and yield (or root size) partly explained the damage in cassava siblings (r2 = 0.82) and different cassava varieties (r2 = 0.42), but only when mean values of damage scores were used. This relation was only significant in one of two crop cycles. A logistic model describes the underlying negative relation between CNP and damage. An exponential model describes the underlying negative relation between root size and damage. Damage, caused by C. bergi feeding, released nonglycosidic cyanogens, and an exponential model fits the underlying positive relation. Fifteen low-CNP clones were selected for potential resistance/tolerance against C. bergi.

  10. The influence of Lasius neoniger (Hymenoptera: Formicidae) on population growth and biomass of Aphis glycines (Hemiptera: Aphididae) in soybeans.

    Science.gov (United States)

    Schwartzberg, Ezra G; Johnson, D W; Brown, G C

    2010-12-01

    In the United States, the soybean aphid, Aphis glycines Matsumura (Hemiptera: Aphididae), are often tended by the aphid-tending ant, Lasius neoniger Emery (Hymenoptera: Formicidae). In this study, we examined the effects of tending by ants on the density and biomass of soybean aphids on soybeans in Kentucky. We performed cage studies that limited access by ants and/or natural enemies. We used a split-plot design with natural enemy access as the main plot and ant attendance as the sub plot. We found that natural enemy access negatively affected aphid population density in the presence of tending ants, seen as a three- to four-fold increase in aphid density when natural enemies were excluded. In addition, we found that ant tending positively affected aphid biomass, both when natural enemies were given access to aphids or when natural enemies were excluded, seen by a two-fold increase in aphid biomass when ants tended aphids, both in the presence or absence of natural enemies. Biomass accumulation is seen as an important measurement for assessing aphid performance, and we argue that aphid-tending by ants can have an influence on natural field populations of soybean aphids. Agronomic practices that affect ant abundance in soybeans may influence the performance and hence pest outbreaks for this economically important pest. © 2010 Entomological Society of America

  11. The secondary contact zone of phylogenetic lineages of the Philaenus spumarius (Hemiptera: Aphrophoridae): an example of incomplete allopatric speciation.

    Science.gov (United States)

    Lis, Agata; Maryańska-Nadachowska, Anna; Lachowska-Cierlik, Dorota; Kajtoch, Lukasz

    2014-01-01

    Previous studies on the phylogeography of the meadow spittlebug Philaenus spumarius (L.) (Hemiptera: Aphrophoridae) suggest the existence of a contact zone of its main phylogenetic lineages along mountain chains in Europe and western Asia. This study presents a detailed examination of the population genetics of P. spumarius within the Carpathian Mountains. The main objective was to determine whether the populations inhabiting that area consist of individuals belonging to different genetic units and whether the observed pattern could be an example of secondary contact zone which formed after incomplete allopatric speciation. Specimens from six transects across the Carpathian arc were examined. The mitochondrial phylogeography of the meadow spittlebug in the examined area clearly shows that individuals from both main clades meet and mix there. Representatives of all three main EF1-α clades were also found. The present distribution of the main clades with a zone of overlap along the mountain ranges may suggest that these phylogenetic lineages form a young hybrid zone. Moreover, a limited number of individuals were shown to possess heteroplasmic mitochondrial DNA, which gives additional support to intraspecific hybridization. P. spumarius could be used in future work as an excellent model species in investigating population genetics, intraspecific hybridization, and speciation in progress. © The Author 2014. Published by Oxford University Press on behalf of the Entomological Society of America.

  12. Military Housing Privatization Initiative (MHPI), Eglin AFB, Florida and Hurlburt Field, Florida. Final Environmental Impact Statement

    Science.gov (United States)

    2011-05-01

    Gene G. Sanderson George E. Cox Gerald A. Rush* Gerald Goodson Ginny Graybiel Glenda L. Glover Gordon Eldridge Gordon Goodin Greg Artabasy Greg... Fanc ~np. Thank you very much. COLONEL CUMBIE: Thank you, sir. !Vlr. Robert Larson . MR. LARSON: My name is Robert Larson . The Military Housing

  13. 77 FR 66464 - Federal Acquisition Regulation; Submission for OMB Review; Value Engineering Requirements

    Science.gov (United States)

    2012-11-05

    ...; whether our estimate of the public burden of this collection of information is accurate, and based on... provided. FOR FURTHER INFORMATION CONTACT: Mr. Curtis E. Glover, Sr., Procurement Analyst, Contract Policy Division, GSA, (202) 501-1448 or email at [email protected] . A. Purpose Per Federal Acquisition...

  14. A reassessment of the early archaeological record at Leang Burung 2, a Late Pleistocene rock-shelter site on the Indonesian island of Sulawesi

    NARCIS (Netherlands)

    Brumm, Adam; Hakim, Budianto; Ramli, Muhammad; Aubert, Maxime; van den Bergh, Gerrit D.; Li, Bo; Burhan, Basran; Saiful, Andi Muhammad; Siagian, Linda; Sardi, Ratno; Jusdi, Andi; Said, Abdullah; Mubarak, Andi Pampang; Moore, Mark W.; Roberts, Richard G.; Zhao, Jian-xin; McGahan, David; Jones, Brian G.; Perston, Yinika; Szabó, Katherine; Mahmud, M. Irfan; Westaway, Kira; [Unknown], Jatmiko; Saptomo, E. Wahyu; van der Kaars, Sander; Grün, Rainer; Wood, Rachel; Dodson, John; Morwood, Michael J.

    2018-01-01

    This paper presents a reassessment of the archaeological record at Leang Burung 2, a key early human occupation site in the Late Pleistocene of Southeast Asia. Excavated originally by Ian Glover in 1975, this limestone rock-shelter in the Maros karsts of Sulawesi, Indonesia, has long held

  15. Toxicity, repellency and flushing out in Triatoma infestans (Hemiptera: Reduviidae exposed to the repellents DEET and IR3535

    Directory of Open Access Journals (Sweden)

    Mercedes M.N. Reynoso

    2017-05-01

    Full Text Available DEET and IR3535 are insect repellents present worldwide in commercial products; their efficacy has been mainly evaluated in mosquitoes. This study compares the toxicological effects and the behavioral responses induced by both repellents on the blood-sucking bug Triatoma infestans Klug (Hemiptera: Reduviidae, one of the main vectors of Chagas disease. When applied topically, the Median Lethal Dose (72 h for DEET was 220.8 µg/insect. Using IR3535, topical application of 500 µg/insect killed no nymphs. The minimum concentration that produced repellency was the same for both compounds: 1,15 µg/cm2. The effect of a mixture DEET:IR3535 1:1 was similar to that of their pure components. Flushing out was assessed in a chamber with a shelter containing groups of ten nymphs. The repellents were aerosolized on the shelter and the number of insects leaving it was recorded for 60 min. During that time, 0.006 g/m3 of the positive control tetramethrin flushed out 76.7% of the nymphs, while 1.76 g/m3 of DEET or IR3535 flushed out 30 and 0%, respectively. The concentrations required for both compounds to produce toxicity or flushing out are too high to have any practical applications. However, they showed a promising repellency. Additional research should be done to evaluate their possible use for personal protection against T. infestans bites.

  16. Brown Marmorated Stink Bug (Hemiptera: Pentatomidae) Infestations in Tree Borders and Subsequent Patterns of Abundance in Soybean Fields.

    Science.gov (United States)

    Aigner, B L; Kuhar, T P; Herbert, D A; Brewster, C C; Hogue, J W; Aigner, J D

    2017-04-01

    The invasive brown marmorated stink bug, Halyomorpha halys (Stål) (Hemiptera: Pentatomidae), is an important pest of soybean (Glycine max L. Merr.) in the Mid-Atlantic United States. In order to assess the influence of nonmanaged wooded borders on H. halys infestation patterns in soybean, 12 soybean fields in Orange and Madison Counties, VA, were sampled each week from July to October in 2013 or 2014 for H. halys. At each location, five 2-min visual counts of H. halys life stages were made on tree of heaven (Ailanthus altissima Mill.) and other favorable host trees along a wooded border, on the adjacent soybean edge, 15 m into the soybean field, and 30 m into the field. Seasonal data showed a clear trend at all locations of H. halys densities building up on A. altissima-dominated wooded borders in July, then, gradually moving into adjacent soybean field edges later in the summer. Halyomorpha halys did not move far from the invading field edge, with approximately half as many bugs being present at 15 m into the field and very few being detected 30 m into the field. These results have implications for continued monitoring and management using field border sprays, particularly on edges adjacent to woods. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  17. Identification and Function Analysis of enolase Gene NlEno1 from Nilaparvata lugens (Stål) (Hemiptera:Delphacidae)

    Science.gov (United States)

    Wang, Wei-Xia; Li, Kai-Long; Chen, Yang; Lai, Feng-Xiang; Fu, Qiang

    2015-01-01

    The enolase [EC 4.2.1.11] is an essential enzyme in the glycolytic pathway catalyzing the conversion of 2-phosphoglycerate (2-PGE) to phosphoenolpyruvate (PEP). In this study, a full-length cDNA encoding α-enolase was cloned from rice brown planthopper (Nilaparvata lugens) and is provisionally designated as NlEno1. The cDNA sequence of NlEno1 was 1,851 bp with an open reading frame (ORF) of 1,305 bp and encoding 434 amino acids. The deduced protein shares high identity of 80–87% with ENO1-like protein from Hemiptera, Diptera, and Lepidoptera speices. The NlEno1 showed the highest mRNA expression level in hemolymph, followed by fat body, salivary gland, ovaries and egg, and showed trace mRNA levels in testis. The mRNA of NlEno1 showed up-regulated level in virulent N. lugens population Mudgo, IR56 and IR42 when compared with TN1 population. Injection of double-stranded RNA (dsRNA) of NlEno1 into the adults significantly down-regulated the NlEno1 mRNA level along with decreased eggs and offspring. Moreover, injection of NlEno1-dsRNA decreased mRNA level of Vitellogenin (Vg) gene. These results showed that the NlEno1, as a key glycolytic enzyme, may play roles in regulation of fecundity and adaptation of N. lugens to resistant rice varieties. PMID:26056319

  18. Handbook of metaheuristics

    CERN Document Server

    Potvin, Jean-Yves

    2010-01-01

    “… an excellent book if you want to learn about a number of individual metaheuristics." (U. Aickelin, Journal of the Operational Research Society, Issue 56, 2005, on the First Edition) The first edition of the Handbook of Metaheuristics was published in 2003 under the editorship of Fred Glover and Gary A. Kochenberger. Given the numerous developments observed in the field of metaheuristics in recent years, it appeared that the time was ripe for a second edition of the Handbook. When Glover and Kochenberger were unable to prepare this second edition, they suggested that Michel Gendreau and Jean-Yves Potvin should take over the editorship, and so this important new edition is now available. Through its 21 chapters, this second edition is designed to provide a broad coverage of the concepts, implementations and applications in this important field of optimization. Original contributors either revised or updated their work, or provided entirely new chapters. The Handbook now includes updated chapters on the b...

  19. Members of Bemisia tabaci (Hemiptera: Aleyrodidae) Cryptic Species and the Status of Two Invasive Alien Species in the Yunnan Province (China)

    Science.gov (United States)

    Hu, Jian; Jiang, Zhi-Lin; Nardi, Francesco; Liu, Yuan-Yuan; Luo, Xiao-Rong; Li, Hong-Xiang; Zhang, Zhong-Kai

    2014-01-01

    Abstract Bemisia tabaci (Gennadius) (Hemiptera: Aleyrodidae) is a cryptic species complex that includes some of the most significant pests of agriculture and horticulture worldwide. To understand the diversity and distribution of B. tabaci cryptic species in Yunnan, a famous biodiversity hotspot in China, a large-scale sampling was conducted from year 2010 to 2013 in 10 prefectures. Mitochondrial cytochrome oxidase I gene sequences were used to identify different cryptic species. Phylogenetic analyses were performed using Bayesian methods to assess the position of a new B. tabaci cryptic species in the context of the B. tabaci diversity in Asia. The survey indicates at least eight B. tabaci cryptic species are present in Yunnan, two invasive (MEAM1 and MED) and six indigenous (China 2, China3, China 4, Asia I, Asia II 1, and Asia II 6), MEAM1, MED, and Asia I being the three predominant cryptic species in Yunnan. Compared with MEAM1, MED has a wider distribution. Based on molecular data, a new cryptic species, here named China 4, was identified that appears to be related to China 1, China 2, and China 3. Future efforts should focus on the interactions between predominant B. tabaci cryptic species and begomoviruses and on the development of effective control strategies. PMID:25502045

  20. Estimation of the number of aphids carrying Citrus tristeza virus that visit adult citrus trees.

    Science.gov (United States)

    Marroquín, Carlos; Olmos, Antonio; Teresa Gorris, María; Bertolini, Edson; Carmen Martínez, M; Carbonell, Emilio A; Hermoso de Mendoza, Alfonso; Cambra, Mariano

    2004-03-01

    Aphid species were counted on citrus trees in orchards in Valencia, Spain, in the spring and autumn of 1997, 1998 and 1999. Moericke yellow water traps, the 'sticky shoot' method and counts of established colonies were used in extensive surveys in which 29,502 aphids were recorded and identified. Aphis spiraecola and Aphis gossypii were the most abundant aphid species. The numbers of aphid species landing on mature trees of grapefruit, sweet orange, lemon and clementine and satsuma mandarins, were estimated by counting the numbers of young shoots/tree and aphids trapped on sticky shoots. The proportions of the different aphid species captured were: A. gossypii (53%), A. spiraecola (32%), Toxoptera aurantii (11%), Myzus persicae (1%), Aphis craccivora (1%) and other species (2%). Clementine was the most visited species with 266,700 aphids landing/tree in spring 2000, followed by lemon (147,000), sweet orange (129,150), grapefruit (103,200), and satsuma (92,400). The numbers and relative percentages of aphids carrying Citrus tristeza virus (CTV) were assessed by nested RT-PCR in single closed tubes and analysed by extraction of RNA-CTV targets from trapped aphids. An average of 37,190 CTV-carrying aphids visited each tree in spring 2000 (29 per shoot). The percentage detection of viral RNA in the aphid species that landed were 27% for A. gossypii, 23% for A. spiraecola and 19% for T. aurantii. This high incidence of aphids carrying CTV is consistent with the high prevalence and rapid spread of CTV in sweet orange, clementine, and satsuma mandarins in recent years in the region. The infection rate was proportional to the number of aphids landing/tree.

  1. Development of ovary structures in the last larval and adult stages of psyllids (Insecta, Hemiptera, Sternorrhyncha: Psylloidea).

    Science.gov (United States)

    Kot, Marta; Büning, Jürgen; Jankowska, Władysława; Drohojowska, Jowita; Szklarzewicz, Teresa

    2016-07-01

    The development and organization of the ovaries of ten species from four Psylloidea families (Psyllidae, Triozidae, Aphalaridae and Liviidae) have been investigated. The ovaries of the last larval stage (i.e. fifth instar) of all examined species are filled with numerous clusters of cystocytes which undergo synchronous incomplete mitotic division. Cystocytes of the given cluster are arranged into a rosette with polyfusome in the centre. These clusters are associated with single somatic cells. At the end of the fifth instar, the clusters begin to separate from each other, forming spherical ovarioles which are surrounded by a single layer of somatic cells. In the ovarioles of very young females all cystocytes enter the prophase of meiosis and differentiate shortly thereafter into oocytes and trophocytes (nurse cells). Meanwhile, somatic cells differentiate into cells of the inner epithelial sheath surrounding the trophocytes and into the prefollicular cells that encompass the oocytes. During this final differentiation, the trophocytes lose their cell membranes and become syncytial. Oocytes remain cellular and most of them (termed arrested oocytes) do not grow. In the ovarioles of older females, one oocyte encompassed by its follicle cells starts growing, still connected to the syncytial tropharium by a nutritive cord. After the short phase of previtellogenesis alone, the oocyte enters its vitellogenic the growth phase in the vitellarium. At that time, the second oocyte may enter the vitellarium and start its previtellogenic growth. In the light of the obtained results, the phylogeny of psyllids, as well as phylogenetic relationships between taxa of Hemiptera: Sternorrhyncha are discussed. Copyright © 2016 Elsevier Ltd. All rights reserved.

  2. Categories and inheritance of resistance to Nilaparvata lugens (Hemiptera: Delphacidae) in mutants of indica rice 'IR64'.

    Science.gov (United States)

    Sangha, Jatinder Singh; Chen, Yolanda H; Palchamy, Kadirvel; Jahn, Gary C; Maheswaran, M; Adalla, Candida B; Leung, Hei

    2008-04-01

    Varietal mutants can be useful for developing durable resistance, understanding categories of resistance, and identifying candidate genes involved in defense responses. We used mutants of rice 'IR64' to isolate new sources of resistance to the planthopper Nilaparvata lugens (Stål) (Hemiptera: Delphacidae). We compared two mutants that showed a gain and loss of resistance to N. lugens, to determine the categories of resistance to this pest. Under choice tests, female planthoppers avoided settling and laid fewer eggs on the resistant mutant 'D518' than on the susceptible mutant D1131, susceptible check 'TN1', and wild-type IR64, indicating that antixenosis was the resistance category. Similarly, under no-choice conditions, planthoppers laid 29% fewer eggs in D518 than in IR64, but they oviposited more in 'D1131' and TN1. Honeydew excretion was greater on D1131 seedlings but slightly lower on D518 than on IR64. Nymphal survival and adult female weight did not differ among rice cultivars. D518 showed higher tolerance of N. lugens infestations than IR64. Genetic analysis of the F1, F2, and F3 populations derived from D518 x IR64 revealed that resistance in D518 is dominant and controlled by a single gene. Despite the variation in resistance to N. lugens, both mutants and IR64 performed similarly in the field. The mutant D518 is a new source of durable resistance to N. lugens, mainly due to enhanced antixenosis to female hoppers for settling and oviposition.

  3. [Development of Rhodnius pictipes Stal, 1872 fed on mice and through a silicone membrane (Hemiptera, Reduviidae, Triatominae)].

    Science.gov (United States)

    Rocha, D da S; da Fonseca, A H; Costa, F A; Jurberg, J; Galvão, C

    1997-01-01

    Rhodnius pictipes (Hemiptera, Reduviidae) from Serra Norte, State of Pará, Brazil, acclimatized in an insectary at the Laboratório Nacional e Internacional de Referência em Taxonomia de Triatomíneos, Departamento de Entomologia, Instituto Oswaldo Cruz, were fed through a silicone membrane. In order to know the viability and the efficiency of this membrane compared with insects fed on mice, the number of bloodmeals taken, period of development of the five nymphal instars, longevity of adults, average amount of blood intake in each meal and percent of mortality were observed. A total of 310 insects, were used, comprising 50 nymphs of each instar, as well as 30 male and 30 female adults. Insects fed artificially had reduced minimal and maximal periods of development than the group fed on mice. The largest relative increase of body weight was observed in the 2nd instar followed by the 1st, and the amount of blood ingested increased during the development, to the 5th instar for both groups. There were no significant differences between the groups fed artificially and in vivo according to Tukey's test for p > 0.05. The percent of mortality in the 1st instar was 18% for artificially fed and 16% for the group fed on mice; these percentages decreased as insects developed until the 4th instar, without mortality, returning to increase in the 5th instar. R. pictipes was shown to be easily adaptable to artificial feeding, and could be considered as an important and viable experimental model.

  4. Evaluation of six different groups of insecticides for the control of citrus psylla Diaphorina citri (Hemiptera: Psyllidae

    Directory of Open Access Journals (Sweden)

    Rakhmin Gul

    2005-01-01

    Full Text Available Studies on the efficacy of different insecticides against citrus psylla, Diaphorina citri (Hemiptera: Psyllidae were carried out at Agricultural Research Institute, Tarnab, Peshawar, Pakistan. Six insecticides viz. Actara 25 WG, (thiamethoxam Cascade 10 DC (Flufenoxuron, Match 050 EC (lufenuron, Thiodan 35 EC (endosulfan, Karate 2.5 EC (α-cyhalothrin, and Supracide 40 EC (methidathion, were tested for their effectiveness against D. citri. After first spray overall mean population of D. citri was 3.63, 4.75, 5.59, 6.66, 7.47, 8.11 per six inches tender shoot on Actara 25 WG, Cascade 10 DC, Match 050 EC, Thiodan 35 EC, Karate 2.5 EC and Supracide 40 EC treated plants respectively, while on control plants the population was 12.39. Similarly, after the second spray of each of the same insecticides the population of D. citri was 2.65, 4.23, 5.61, 6.41, 7.35 and 8.73 respectively. Where in controls there were 15.18 psyllids. Percent decrease of D. citri population in comparison to control after the first spray was highest in Actara 25 WG (72.20 followed by Cascade 10 DC (62.91, Match 050 EC (54.07, Thiodan 35 EC (47.61, Karate 2.5 EC (38.94 and Supracide 40 EC (35.74. After the second spray percent decrease over control recorded was highest in Actara 25 WG (83.54, followed by Cascade 10 DC (71.08, Match 050 EC (63.94, Thiodan 35 EC (60.79, Karate 2.5 EC (52.52 and Supracide 40 EC (45.62.

  5. Horizontal Transmission of "Candidatus Liberibacter solanacearum" by Bactericera cockerelli (Hemiptera: Triozidae) on Convolvulus and Ipomoea (Solanales: Convolvulaceae)

    Science.gov (United States)

    Torres, Glenda L.; Cooper, W. Rodney; Horton, David R.; Swisher, Kylie D.; Garczynski, Stephen F.; Munyaneza, Joseph E.; Barcenas, Nina M.

    2015-01-01

    “Candidatus Liberibacter solanacearum” (Proteobacteria) is an important pathogen of solanaceous crops (Solanales: Solanaceae) in North America and New Zealand, and is the putative causal agent of zebra chip disease of potato. This phloem-limited pathogen is transmitted to potato and other solanaceous plants by the potato psyllid, Bactericera cockerelli (Hemiptera: Triozidae). While some plants in the Convolvulaceae (Solanales) are also known hosts for B. cockerelli, previous efforts to detect Liberibacter in Convolvulaceae have been unsuccessful. Moreover, studies to determine whether Liberibacter can be acquired from these plants by B. cockerelli are lacking. The goal of this study was to determine whether horizontal transmission of Liberibacter occurs among potato psyllids on two species of Convolvulaceae, sweet potato (Ipomoea batatas) and field bindweed (Convolvulus arvensis), which grows abundantly in potato growing regions of the United States. Results indicated that uninfected psyllids acquired Liberibacter from both I. batatas and C. arvensis if infected psyllids were present on plants concurrently with the uninfected psyllids. Uninfected psyllids did not acquire Liberibacter from plants if the infected psyllids were removed from the plants before the uninfected psyllids were allowed access. In contrast with previous reports, PCR did detect the presence of Liberibacter DNA in some plants. However, visible amplicons were faint and did not correspond with acquisition of the pathogen by uninfected psyllids. None of the plants exhibited disease symptoms. Results indicate that horizontal transmission of Liberibacter among potato psyllids can occur on Convolvulaceae, and that the association between Liberibacter and Convolvulaceae merits additional attention. PMID:26555359

  6. Distribuição Geográfica e Dispersão Alti-latitudinal de Alguns Gêneros e Espécies da Tribo Triatomini Jeannel, 1919 (Hemiptera, Reduviidae, Triatominae

    Directory of Open Access Journals (Sweden)

    Galvão Cleber

    1998-01-01

    Full Text Available Geographical Distribution and Alti-latitudinal Dispersion of Some Genera and Species of the Tribe Triatomini Jeannel, 1919 (Hemiptera, Reduviidae, Triatominae - With the currently known distribution of genera and species of the tribe Triatomini Jeannel, 1919, maps and diagrams were prepared, showing the geographical area occupied by the species and their respective dispersion in grades of latitude and altitude. Two genera are not treated: Panstrongylus Berg, 1879, already published and Triatoma Laporte, 1832, that is being published partially in several articles. Genus Eratyrus Stal, 1859, has two species, while Dipetalogaster Usinger, 1939, Mepraia Mazza, Gajardo & Joerg, 1940, Paratriatoma Barber, 1938 and recently created genus Hermanlentia Jurberg & Galvão, 1997, have only one each. The study of these maps and diagrams permits a better knowledge about some ecological requirements of Chagas' disease vectors and detects gaps in the geographical distribution, where the species were not found but probably they could be prevalent

  7. Ultrastructure of the salivary glands, alimentary canal and bacteria-like organisms in the Asian citrus psyllid, vector of citrus huanglongbing-disease bacteria

    Science.gov (United States)

    Several psyllids (Hemiptera: Psylloidea) are known as vectors of some economically important viral and bacterial plant pathogens. The Asian citrus psyllid (ACP, Diaphorina citri, Hemiptera, Liviidae) is the principal vector of ‘Candidatus Liberibacter asiaticus’ (Las), the putative bacterial causal ...

  8. Impacto do algodoeiro Bt na dinâmica populacional do pulgão-do-algodoeiro em casa de vegetação Impact of Bt cotton on the population dynamics of the cotton aphid in greenhouse

    Directory of Open Access Journals (Sweden)

    Edison Ryoiti Sujii

    2008-10-01

    Full Text Available O objetivo deste trabalho foi desenvolver um protocolo experimental para avaliar o impacto do algodoeiro Bt na bionomia e na escolha de plantas para colonização pelo pulgão-do-algodoeiro (Aphis gossypii. A bionomia do pulgão foi avaliada em casa de vegetação com insetos criados em gaiolas individuais com plantas de algodão Bt, da variedade DP 404 BG (Bollgard, ou sua isolinha não transformada DP 4049. Gaiolas contendo vasos com plantas de algodoeiro Bt e não-Bt foram usadas como arena de escolha, para a avaliação de preferência de adultos alados. O período pré-reprodutivo e reprodutivo, a longevidade, a curva de sobrevivência, a produção de prole total e diária por fêmea e a curva acumulada de produção de prole da população não apresentaram diferenças significativas. Não foi observada diferença na escolha de plantas para colonização por indivíduos alados, o que indica taxas equivalentes de colonização nas populações iniciais. O algodoeiro Bt não afeta a dinâmica populacional de A. gossypii e não aumenta seu potencial de risco como praga.The objective of this work was to develop an experimental protocol to assess the impact of Bt cotton on bionomics and on plant choice for Aphis gossypii colonization. The bionomics of the cotton aphid was assessed in greenhouse with insects reared in individual cages containing Bt cotton plants of the variety DP 404 BG (Bollgard or its nontransformed isoline DP 4049. Cages with Bt cotton and non-Bt cotton were used as choosing arena for evaluation of winged adults preference. There was no significant difference for pre-reproduction period (immature phase, reproduction period, longevity, survivorship curve total and daily production of offspring by female, and curve of accumulated production of offspring by the population. There was no preference of colonization for any plant by winged adults, which indicates equivalent rates of colonization of the initial populations. Bt

  9. Spatial Distribution and Coexisting Patterns of Adults and Nymphs of Tibraca limbativentris (Hemiptera: Pentatomidae) in Paddy Rice Fields.

    Science.gov (United States)

    Alves, Tavvs M; Maia, Aline H N; Barrigossi, José A F

    2016-12-01

    The rice stem stink bug, Tibraca limbativentris Stål (Hemiptera: Pentatomidae), is a primary insect pest of paddy rice in South America. Knowledge of its spatial distribution can support sampling plans needed for timely decisions about pest control. This study aimed to investigate the spatial distribution of adults and nymphs of T. limbativentris and determine the spatial coexistence of these stages of development. Fifteen paddy rice fields were scouted once each season to estimate insect densities. Scouting was performed on regular grids with sampling points separated by ∼50 m. Moran's I and semivariograms were used to determine spatial distribution patterns. Spatial coexistence of nymphs and adults was explored via spatial point process. Here, adults and nymphs had typically contrasting spatial distribution patterns within the same field; however, the frequency of aggregation was not different between these developmental stages. Adults and nymphs were aggregated in seven fields and randomly distributed in the other eight fields. Uniform distribution of adults or nymphs was not observed. The study-wide semivariogram ranges were ∼40 m for adults and ∼55 m for nymphs. Nymphs and adults spatially coexisted on 67% of the fields. Coexisting patterns were classified using one of the following processes: stage-independent, bidirectional attractive, unidirectional attractive, bidirectional inhibiting, or unidirectional inhibiting. The information presented herein can be important for developing sampling plans for decision-making, implementing tactics for site-specific management, and monitoring areas free of T. limbativentrisResumoO percevejo-do-colmo Tibraca limbativentris Stål (Hemiptera: Pentatomidae) é uma praga primária na cultura do arroz irrigado na América do Sul. O conhecimento de sua distribuição espacial é essencial para desenvolver planos de amostragem e para o controle desta praga. Nosso objetivo foi investigar a distribuição espacial de

  10. Host range findings on Beauveria bassiana and Metarhizium anisopliae (Ascomycota: Hypocreales in Argentina Espectro de hospedadores hallado en Beauveria bassiana y Metarhizium anisopliae (Ascomycota: Hypocreales en Argentina

    Directory of Open Access Journals (Sweden)

    A. V. Toledo

    2008-12-01

    Full Text Available The natural insect host range of the entomopathogenic fungi (EPF Beauveria bassiana (Bb and Metarhizium anisopliae (Ma was investigated in Argentina during the winter of 2003 through spring of 2004. Fungi- infected insect samples (153 were collected from cornfields and the surrounding uncultivated areas in different localities of Buenos Aires (7, Tucumán (2, and Corrientes (3 provinces. The rates of Bb-infected host range varied among the Coleoptera (37%, Hemiptera (27% and Dermaptera (1.3%. While the rates of Ma-infected host range varied between the Coleoptera (0.7% and Hemiptera (34%. The greater host range resulted with B. bassiana found from eight species of Coleoptera (four families, one species of Dermaptera and four species of Hemiptera (three families, than the host range of M. anisopliae found infecting one species of Coleoptera and three species of Hemiptera (two families. We obtained 75 pure fungal isolates (48 Bb-isolates and 27 to Ma-isolates, and 56 of them (33 Bb-isolates and 23 Ma-isolates were morphologically characterized.El espectro natural de hospedadores de los hongos entomopatógenos (HEP Beauveria bassiana (Bb y Metarhizium anisopliae (Ma fue investigado en Argentina desde el invierno de 2003 hasta la primavera de 2004. Las muestras de insectos con infecciones fúngicas (153 fueron recolectadas a partir de campos de maíz y las áreas no cultivadas circundantes a los mismos, en diferentes localidades de las provincias de Buenos Aires (7, Tucumán (2 y Corrientes (3. El espectro de hospedadores infectados con Bb varió entre los Coleoptera (37%, Hemiptera (27% y Dermaptera (1,3%. Mientras que el espectro de hospedadores infectados con Ma varió entre los Coleoptera (0,7% y los Hemiptera (34%. El mayor espectro lo presentó Bb, encontrado en ocho especies de Coleoptera (cuatro familias, una especie de Dermaptera y cuatro especies de Hemiptera (tres familias, mientras que Ma fue encontrado infectando una especie de

  11. The secondary contact zone of phylogenetic lineages of the Philaenus spumarius (Hemiptera: Aphrophoridae: Cercopidae): an example of incomplete allopatric speciation.

    Science.gov (United States)

    Lis, Agata; Maryańska-Nadachowska, Anna; Lachowska-Cierlik, Dorota; Kajtoch, Łukasz

    2014-01-01

    Previous studies on the phylogeography of the meadow spittlebug Philaenus spumarius (L.) (Hemiptera: Aphrophoridae: Cercopidae) suggest the existence of a contact zone of its main phylogenetic lineages along mountain chains in Europe and western Asia. This study presents a detailed examination of the population genetics of P. spumarius within the Carpathian Mountains. The main objective was to determine whether the populations inhabiting that area consist of individuals belonging to different genetic units and whether the observed pattern could be an example of secondary contact zone which formed after incomplete allopatric speciation. Specimens from six transects across the Carpathian arc were examined. The mitochondrial phylogeography of the meadow spittlebug in the examined area clearly shows that individuals from both main clades meet and mix there. Representatives of all three main EF1-α clades were also found. The present distribution of the main clades with a zone of overlap along the mountain ranges may suggest that these phylogenetic lineages form a young hybrid zone. Moreover, a limited number of individuals were shown to possess heteroplasmic mitochondrial DNA, which gives additional support to intraspecific hybridization. P. spumarius could be used in future work as an excellent model species in investigating population genetics, intraspecific hybridization, and speciation in progress. © The Author 2014. Published by Oxford University Press on behalf of the Entomological Society of America.

  12. A Technical and Practical Study of Composting as a Solid Waste Management Alternative for the Air Force

    Science.gov (United States)

    1992-09-01

    52 0C Phvsoderma zeae- Brown spot of corn > 80C maydis Giberella zeae Seedling blight of corn > 651C ascospores Glomeralla gossypii Cotton anthracnose ...Pyrenophora teres Net blotch, barley 45°C conidia 55°C mycelium Septoria lycopersici Leafspot, tomatoes 43°C spores (2:221) 44 The extent of

  13. Children's Use of Allocentric Cues in Visually- and Memory-Guided Reach Space

    Science.gov (United States)

    Cordova, Alberto; Gabbard, Carl

    2012-01-01

    Theory suggests that the vision-for-perception and vision-for-action processing streams operate under very different temporal constraints (Glover, 2004; Goodale, Jackobson, & Keillor, 1994; Graham, Bradshaw, & Davis, 1998; Hu, Eagleson, & Goodale, 1999). With the present study, children and young adults were asked to estimate how far a cued target…

  14. Phytophagy on eucalyptus plants increases the development and reproduction of the predator Podisus nigrispinus (Hemiptera: Pentatomidae = Fitofagia em plantas de eucaliptos aumenta o desenvolvimento e a reprodução do predador Podisus nigrispinus (Hemiptera: Pentatomidae.

    Directory of Open Access Journals (Sweden)

    Anderson Mathias Holtz

    2011-04-01

    Full Text Available The effect of plant feeding on biological aspects of Podisus nigrispinus (Dallas (Heteroptera: Pentatomidae was evaluated. Nymphs and adults of this predator were fed with Tenebrio molitor L. (Coleoptera: Tenebrionidae pupae on Eucalyptus urophylla plants inthe field or only with pupae of this prey in the laboratory. The development and nymphal survival, as well as the pre-oviposition period, number of egg masses, number, fertility and viability of eggs and the longevity of females of this predator were evaluated. The eucalyptus plants improved the development of P. nigrispinus. This demonstrates that this predator can present higher population growth with eucalyptus plants and T. molitor pupae than in the laboratory (controlled conditions only with this prey. These plants can supply nutrients that can the population growth and efficiency of P. nigrispinus for biological control in eucalyptus plantations.O efeito da alimentação em plantas sobre os aspectos biológicos de Podisus nigrispinus (Hemiptera: Pentatomidae foi avaliado. Ninfas e adultos desse predador foram alimentados com pupas de Tenebrio molitor L. (Coleotpera: Tenebrionidae em plantas de Eucalyptus urophylla no campo ou, apenas, em laboratório. O desenvolvimento e a sobrevivência ninfal desse predador, além do período de pré-oviposição, número de posturas, viabilidade dos ovos e afertilidade e longevidade de fêmeas foram avaliados. A planta de eucalipto proporcionou um incremento no desenvolvimento de P. nigrispinus. Isto demonstra que esse predador pode apresentar maior crescimento populacional com plantas de eucalipto e pupas de T. molitor alimentado com apenas a presa (condições controladas. A planta pode fornecer nutrientes que aumentam o crescimento populacional e a eficiência de P. nigrispinus para o controle biológico em plantios de eucalipto.

  15. Parâmetros biológicos e tabela de vida de fertilidade de Neopamera bilobata (Hemiptera: Rhyparochromidae em morangueiro

    Directory of Open Access Journals (Sweden)

    Taciana Melissa de Azevedo Kuhn

    2014-06-01

    Full Text Available O objetivo deste trabalho foi avaliar os parâmetros biológicos e determinar a tabela de vida de fertilidade de Neopamera bilobata (Hemiptera: Rhyparochromidae em morangueiro. O experimento foi realizado no Laboratório de Entomologia da Embrapa Uva e Vinho, em Bento Gonçalves, RS, em câmara climatizada (a 23±1°C, 70±10% UR e fotófase de 12 horas. Utilizaram-se folíolos, flores, frutos verdes e maduros de morangueiro 'Aromas' como alimento para os percevejos. O desenvolvimento das fases imaturas e os parâmetros biológicos dos adultos foram monitorados diariamente. O percevejo N. bilobata não completou o ciclo biológico em folíolos e flores de morangueiro. Em frutos maduros e verdes, o tempo de desenvolvimento da ninfa ao adulto foi de 32,8±9,12 e 36,7±6,80 dias, com viabilidade de 27,3 e 51%, respectivamente. O período de oviposição foi de 34,7±21,2 dias, com 319,1±262,7 ovos em frutos maduros, e de 43,9±18,3 dias, com 318,2±144,7 ovos em frutos verdes. Neopamera bilobata completa seu ciclo biológico na cultura do morangueiro. Frutos verdes de morangueiro são mais adequados ao desenvolvimento deste inseto do que frutos maduros.

  16. Seasonal Effects on the Population, Morphology and Reproductive Behavior of Narnia femorata (Hemiptera: Coreidae).

    Science.gov (United States)

    Cirino, Lauren A; Miller, Christine W

    2017-01-17

    Many insects are influenced by the phenology of their host plants. In North Central Florida, Narnia femorata (Hemiptera: Coreidae) spends its entire life cycle living and feeding on Opuntia mesacantha ssp. lata . This cactus begins producing flower buds in April that lead to unripe green fruit in June that ripen into red fruit through December. Many morphological and behavioral characteristics of N. femorata are known to be affected by cactus phenology in a controlled laboratory setting, including the degree of sexual dimorphism and mating behavior. Our goal with this study was to determine if similar phenotypic changes of N. femorata occurred over time in the wild, and the extent to which these changes were concordant with phenological changes in its host plant. Further, we investigate the length of the insect mouthparts (beak) over time. Ongoing work has suggested that beak length may change across cohorts of developing insects in response to feeding deep within cactus fruit where seed and pulp depth decrease as the fruit ripens. Our results revealed a drop in cactus fruit abundance between the months of July through October 2015 as cactus fruits turned red and ripened. Simultaneously, the average body size of both males and females of N. femorata declined at two sampled sites. Male hind femora (a sexually-selected weapon) decreased disproportionately in size over time so that males later in the year had relatively smaller hind femora for their body size. The sex-specific patterns of morphological change led to increased sexual-size dimorphism and decreased sexual dimorphism for hind femora later in the year. Further, we found that beak length decreased across cohorts of insects as cactus fruit ripened, suggesting phenotypic plasticity in mouthpart length. Behavioral studies revealed that female readiness to mate increased as the season progressed. In sum, we found pronounced changes in the phenotypes of these insects in the field. Although this study is far from

  17. Seasonal Effects on the Population, Morphology and Reproductive Behavior of Narnia femorata (Hemiptera: Coreidae

    Directory of Open Access Journals (Sweden)

    Lauren A. Cirino

    2017-01-01

    Full Text Available Many insects are influenced by the phenology of their host plants. In North Central Florida, Narnia femorata (Hemiptera: Coreidae spends its entire life cycle living and feeding on Opuntia mesacantha ssp. lata. This cactus begins producing flower buds in April that lead to unripe green fruit in June that ripen into red fruit through December. Many morphological and behavioral characteristics of N. femorata are known to be affected by cactus phenology in a controlled laboratory setting, including the degree of sexual dimorphism and mating behavior. Our goal with this study was to determine if similar phenotypic changes of N. femorata occurred over time in the wild, and the extent to which these changes were concordant with phenological changes in its host plant. Further, we investigate the length of the insect mouthparts (beak over time. Ongoing work has suggested that beak length may change across cohorts of developing insects in response to feeding deep within cactus fruit where seed and pulp depth decrease as the fruit ripens. Our results revealed a drop in cactus fruit abundance between the months of July through October 2015 as cactus fruits turned red and ripened. Simultaneously, the average body size of both males and females of N. femorata declined at two sampled sites. Male hind femora (a sexually-selected weapon decreased disproportionately in size over time so that males later in the year had relatively smaller hind femora for their body size. The sex-specific patterns of morphological change led to increased sexual-size dimorphism and decreased sexual dimorphism for hind femora later in the year. Further, we found that beak length decreased across cohorts of insects as cactus fruit ripened, suggesting phenotypic plasticity in mouthpart length. Behavioral studies revealed that female readiness to mate increased as the season progressed. In sum, we found pronounced changes in the phenotypes of these insects in the field. Although this

  18. Induction of resistance by silicon in wheat plants to alate and apterous morphs of Sitobion avenae (Hemiptera: Aphididae).

    Science.gov (United States)

    Dias, P A S; Sampaio, M V; Rodrigues, M P; Korndörfer, A P; Oliveira, R S; Ferreira, S E; Korndörfer, G H

    2014-08-01

    Despite the knowledge about the effects of silicon augmenting antibiosis and nonpreference of plants by apterous aphids, few studies exist on such effects with alate aphids. This study evaluated the effects of silicon fertilization on the biology of alate and apterous morphs of Sitobion avenae (F.) (Hemiptera: Aphididae), and the effect on nonpreference by S. avenae alates for wheat plants with or without silicon fertilization. A method for rearing aphids on detached leaves was evaluated comparing the biology of apterous aphids reared on wheat leaf sections and on whole plants with and without silicon fertilization. Because the use of detached leaves was a reliable method, the effect of silicon fertilization on the biology of apterous and alate S. avenae was assessed using wheat leaf sections. Biological data of aphids were used to calculate a fertility life table. Finally, the effect of silicon fertilization on the nonpreference of alate aphids was carried out for both vegetative and reproductive phases of wheat. Thirty alate aphids were released in the center of a cage, and the number of aphids per whole plant with or without silicon fertilization was observed. Silicon fertilization induced antibiosis resistance in wheat plants to apterous morphs as shown by reduced fecundity, reproductive period, longevity, intrinsic rate of increase, and net reproductive rate; however, alates were unaffected. Plants that received silicon fertilization had fewer alate aphids in both the vegetative and reproductive phases. Thus, silicon fertilization can reduce colonization by alates, enhancing nonpreference resistance, and population growth of apterous S. avenae in wheat plants.

  19. Biologia do psilídeo-de-concha Glycaspis brimblecombei Moore (Hemiptera, Psyllidae em Eucalyptus spp. Red gum lerp psyllid Glycaspis brimblecombei Moore (Hemiptera, Psylidae biology in Eucalyptus spp.

    Directory of Open Access Journals (Sweden)

    Daniela Cristina Firmino-Winckler

    2009-01-01

    Full Text Available Biologia do psilídeo-de-concha Glycaspis brimblecombei Moore (Hemiptera, Psyllidae em Eucalyptus spp.. Glycaspis brimblecombei Moore também conhecido por psilídeo-de-concha, se caracteriza por ser uma espécie específica ao gênero Eucalyptus L'Her. Este trabalho teve por objetivo determinar o ciclo biológico de G. brimblecombei em Eucalyptus spp. O trabalho foi conduzido em câmara climatizada (BOD, sob a temperatura de 26 °C e fotofase de 12 horas. As espécies de Eucalyptus utilizadas para o experimento foram: Eucalyptus camaldulensis, E. tereticornis, E. urophylla, E. grandis, Corymbia citriodora e um híbrido de E. grandis x E. urophylla ('urograndis'. Inicialmente foram utilizados 100 repetições (ninfas tratamento (espécies de Eucalyptus. As avaliações foram diárias. Os parâmetros biológicos avaliados foram a duração e viabilidade do estágio ninfal, longevidade dos adultos, número de posturas/fêmea, duração do período embrionário, número e viabilidade ovos, longevidade dos adultos e duração do ciclo total. Os resultados obtidos demonstraram que salvo C. citriodora que apresentou ser letal ao desenvolvimento ninfal de G. brimblecombei as demais espécies de Eucalyptus testadas oferecem condições ao desenvolvimento biológico deste psilídeo, sendo que neste trabalho E. camaldulensis mostrou-se a mais adequada.Glycaspis brimblecombei Moore, also known as red gum lerp psyllid, is characterized to be specific to the genus Eucalyptus. This work aimed to evaluate G. brimblecombei biological cycle in Eucalyptus spp. The work was accomplished in acclimatized chamber (BOD, with temperature of 26 °C and photophase of 12 hours. Eucalyptus species used in this study were: Eucalyptus camaldulensis, E. tereticornis, E. urophylla, E. grandis, Corymbia citriodora and E grandis x E. urophylla hybrid ('urograndis'. Initially 100 replications (nymphs per treatment (Eucalyptus species were prepared. The evaluations were daily and

  20. Modeling Environmental Influences in the Psyllaephagus bliteus (Hymenoptera: Encyrtidae)-Glycaspis brimblecombei (Hemiptera: Aphalaridae) Parasitoid-Host System.

    Science.gov (United States)

    Margiotta, M; Bella, S; Buffa, F; Caleca, V; Floris, I; Giorno, V; Lo Verde, G; Rapisarda, C; Sasso, R; Suma, P; Tortorici, F; Laudonia, S

    2017-04-01

    Glycaspis brimblecombei Moore (Hemiptera: Aphalaridae) is an invasive psyllid introduced into the Mediterranean area, where it affects several species of Eucalyptus. Psyllaephagus bliteus Riek (Hymenoptera: Encyrtidae) is a specialized parasitoid of this psyllid that was accidentally introduced into Italy in 2011. We developed a model of this host-parasitoid system that accounts for the influence of environmental conditions on the G. brimblecombei population dynamics and P. bliteus parasitism rates in the natural ecosystem. The Lotka-Volterra-based model predicts non-constant host growth and parasitoid mortality rates in association with variation in environmental conditions. The model was tested by analyzing sampling data collected in Naples in 2011 (before the parasitoid was present) and defining several environmental patterns, termed Temperature-Rain or T-R patterns, which correspond to the host growth rate. A mean value of the host growth rate was assigned to each T-R pattern, as well as a variation of the parasitoid mortality rate based on temperature thresholds. The proposed model was applied in simulation tests related to T-R patterns carried out with a data series sampled between June 2014 and July 2015 in five Italian sites located in Campania, Lazio, Sicily, and Sardinia regions. The simulation results showed that the proposed model provides an accurate approximation of population trends, although oscillation details may not be apparent. Results predict a 64% reduction in G. brimblecombei population density owing to P. bliteus parasitoid activity. Our results are discussed with respect to features of the host-parasitoid interaction that could be exploited in future biological control programs. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  1. Effect of Mahanarva fimbriolata (Hemiptera: Cercopidae) Attack on Photosynthetic Parameters of Sugarcane Genotypes of Contrasting Susceptibility.

    Science.gov (United States)

    Soares, Bruno Oliveira; Chaves, Vinicius de Vicente; Tomaz, Adriano Cirino; Kuki, Kacilda Naomi; Peternelli, Luiz Alexandre; Barbosa, Márcio Henrique Pereira

    2017-12-05

    The aim of this study was to compare the effect of spittlebug Mahanarva fimbriolata Stål (Hemiptera: Cercopidae) on photosynthetic parameters of both a susceptible (SP81-3250) and a resistant (H.Kawandang) sugarcane genotype. In the first assay, the susceptibility level of genotypes to spittlebug was confirmed by comparing damage score and chlorophyll content of the plants. In the second assay, the effect of spittlebug nymphs on photosynthetic characteristics was assessed using the following parameters: Net photosynthetic rate (A), carboxylation efficiency (A/Ci), stomata conductance (gS), transpiration (E), electron transport rate (ETR), maximum quantum yield of Photosystem 2 (PSII) (FV/FM), effective quantum yield (Y(II)), photochemical quenching (Y(NPQ)), and nonphotochemical quenching (Y(NO)). Spittlebug nymphs affected the photosynthetic process of the susceptible genotype SP81-3250 by decreasing the Chl content, ETR, FV/FM, and Y(II). However, this genotype was able to maintain A probably due to its ability to maintain stomata aperture, increase the carboxylation efficiency of Rubisco, and dissipate excess energy through the xanthophyll cycle, as Y(NPQ) increased under the spittlebug attack. On the other hand, the spittlebug did not affect Chl content and FV/FM of the H.Kawandang genotype. Furthermore, H.Kawandang increased A to compensate for the sink demand by the spittlebug by increasing stomatal aperture and carboxylation efficiency and increasing efficiency of the photochemical apparatus in converting light energy into chemical products. We can conclude that the feeding habits of spittlebug nymphs have different impacts on photosynthesis of susceptible and resistant sugarcane genotypes. © The Author(s) 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  2. Melt With This Kiss: Paralyzing and Liquefying Venom of The Assassin Bug Pristhesancus plagipennis (Hemiptera: Reduviidae).

    Science.gov (United States)

    Walker, Andrew A; Madio, Bruno; Jin, Jiayi; Undheim, Eivind A B; Fry, Bryan G; King, Glenn F

    2017-04-01

    Assassin bugs (Hemiptera: Heteroptera: Reduviidae) are venomous insects, most of which prey on invertebrates. Assassin bug venom has features in common with venoms from other animals, such as paralyzing and lethal activity when injected, and a molecular composition that includes disulfide-rich peptide neurotoxins. Uniquely, this venom also has strong liquefying activity that has been hypothesized to facilitate feeding through the narrow channel of the proboscis-a structure inherited from sap- and phloem-feeding phytophagous hemipterans and adapted during the evolution of Heteroptera into a fang and feeding structure. However, further understanding of the function of assassin bug venom is impeded by the lack of proteomic studies detailing its molecular composition.By using a combined transcriptomic/proteomic approach, we show that the venom proteome of the harpactorine assassin bug Pristhesancus plagipennis includes a complex suite of >100 proteins comprising disulfide-rich peptides, CUB domain proteins, cystatins, putative cytolytic toxins, triabin-like protein, odorant-binding protein, S1 proteases, catabolic enzymes, putative nutrient-binding proteins, plus eight families of proteins without homology to characterized proteins. S1 proteases, CUB domain proteins, putative cytolytic toxins, and other novel proteins in the 10-16-kDa mass range, were the most abundant venom components. Thus, in addition to putative neurotoxins, assassin bug venom includes a high proportion of enzymatic and cytolytic venom components likely to be well suited to tissue liquefaction. Our results also provide insight into the trophic switch to blood-feeding by the kissing bugs (Reduviidae: Triatominae). Although some protein families such as triabins occur in the venoms of both predaceous and blood-feeding reduviids, the composition of venoms produced by these two groups is revealed to differ markedly. These results provide insights into the venom evolution in the insect suborder

  3. Crop Loss Relationships and Economic Injury Levels for Ferrisia gilli (Hemiptera: Pseudococcidae) Infesting Pistachio in California.

    Science.gov (United States)

    Haviland, David R; Beede, Robert H; Daane, Kent M

    2015-12-01

    Ferrisia gilli Gullan (Hemiptera: Pseudococcidae) is a new pest in California pistachios, Pistacea vera L. We conducted a 3-yr field study to determine the type and amount of damage caused by F. gilli. Using pesticides, we established gradients of F. gilli densities in a commercial pistachio orchard near Tipton, CA, from 2005 to 2007. Each year, mealybug densities on pistachio clusters were recorded from May through September and cumulative mealybug-days were determined. At harvest time, nut yield per tree (5% dried weight) was determined, and subsamples of nuts were evaluated for market quality. Linear regression analysis of cumulative mealybug-days against fruit yield and nut quality measurements showed no relationships in 2005 and 2006, when mealybug densities were moderate. However, in 2007, when mealybug densities were very high, there was a negative correlation with yield (for every 1,000 mealybug-days, there was a decrease in total dry weight per tree of 0.105 kg) and percentage of split unstained nuts (for every 1,000 mealybug-days, there was a decrease in the percentage of split unstained of 0.560%), and a positive correlation between the percentage of closed kernel and closed blank nuts (for every 1,000 mealybug-days, there is an increase in the percentage of closed kernel and closed blank of 0.176 and 0.283%, respectively). The data were used to determine economic injury levels, showing that for each mealybug per cluster in May there was a 4.73% reduction in crop value associated with quality and a 0.866 kg reduction in yield per tree (4.75%). © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  4. JSTO Science and Technology Update. Volume 1, Number 2, Winter 2011

    Science.gov (United States)

    2011-01-01

    the organism from lethality. Experimental animal model and techniques to evaluate radioprotective efficacy of GT3 Adult male CD2F1 mice were injected...Pharmac. Biochem. Behav. 27: 573–576. 22. Glover D, Riley LJ Jr, Carmichael K, Spar B, Glick JH, Slatopolsky E, Attie M, Goldfarb S (1983). Hypocalcemia

  5. How to Start with a Clean Crop: Biopesticide Dips Reduce Populations of Bemisia tabaci (Hemiptera: Aleyrodidae on Greenhouse Poinsettia Propagative Cuttings

    Directory of Open Access Journals (Sweden)

    Rosemarije Buitenhuis

    2016-09-01

    Full Text Available (1 Global movement of propagative plant material is a major pathway for introduction of Bemisia tabaci (Hemiptera: Aleyrodidae into poinsettia greenhouses. Starting a poinsettia crop with high pest numbers disrupts otherwise successful biological control programs and widespread resistance of B. tabaci against pesticides is limiting growers’ options to control this pest; (2 This study investigated the use of several biopesticides (mineral oil, insecticidal soap, Beauveria bassiana, Isaria fumosorosea, Steinernema feltiae and combinations of these products as immersion treatments (cutting dips to control B. tabaci on poinsettia cuttings. In addition, phytotoxicity risks of these treatments on poinsettia cuttings, and effects of treatment residues on mortality of commercial whitefly parasitoids (Eretmocerus eremicus and Encarsia formosa were determined; (3 Mineral oil (0.1% v/v and insecticidal soap (0.5% + B. bassiana (1.25 g/L were the most effective treatments; only 31% and 29%, respectively, of the treated B. tabaci survived on infested poinsettia cuttings and B. tabaci populations were lowest in these treatments after eight weeks. Phytotoxicity risks of these treatments were acceptable, and dip residues had little effect on survival of either parasitoid, and are considered highly compatible; (4 Use of poinsettia cutting dips will allow growers to knock-down B. tabaci populations to a point where they can be managed successfully thereafter with existing biocontrol strategies.

  6. Laboratory Evaluation of Acute Toxicity of the Essential Oil of Allium tuberosum Leaves and Its Selected Major Constituents Against Apolygus lucorum (Hemiptera: Miridae).

    Science.gov (United States)

    Shi, Jizhe; Liu, Xinchao; Li, Zhen; Zheng, Yuanyuan; Zhang, Qingwen; Liu, Xiaoxia

    2015-01-01

    The aim of this research was to evaluate acute toxicity of the essential oil of leaves of Chinese chives, Allium tuberosum Rottler ex Spreng (Asparagales: Alliaceae) and its major constituents against Apolygus lucorum Meyer-Dür (Hemiptera: Miridae). The essential oil of A. tuberosum leaves was obtained by hydrodistillation and analyzed by gas chromatography and gas chromatography-mass spectrometry. The major constituents of the oil were sulfur-containing compounds, including allyl methyl trisulfide (36.24%), diallyl disulfide (27.26%), diallyl trisulfide (18.68%), and dimethyl trisulfide (9.23%). The essential oil of A. tuberosum leaves exhibited acute toxicity against Ap. lucorum with an LD50 value of 20.03 μg per adult. Among the main compounds, diallyl trisulfide (LD50 = 10.13 μg per adult) showed stronger acute toxicity than allyl methyl trisulfide (LD50 = 21.10 μg per adult) and dimethyl trisulfide (LD50 = 21.65 μg per adult). The LD50 value of diallyl disulfide against Ap. lucorum was 28.10 μg per adult. The results indicated that the essential oil of A. tuberosum and its major constituents may have a potential to be developed as botanical insecticides against Ap. lucorum. © The Author 2015. Published by Oxford University Press on behalf of the Entomological Society of America.

  7. Building-Up of a DNA Barcode Library for True Bugs (Insecta: Hemiptera: Heteroptera) of Germany Reveals Taxonomic Uncertainties and Surprises

    Science.gov (United States)

    Raupach, Michael J.; Hendrich, Lars; Küchler, Stefan M.; Deister, Fabian; Morinière, Jérome; Gossner, Martin M.

    2014-01-01

    During the last few years, DNA barcoding has become an efficient method for the identification of species. In the case of insects, most published DNA barcoding studies focus on species of the Ephemeroptera, Trichoptera, Hymenoptera and especially Lepidoptera. In this study we test the efficiency of DNA barcoding for true bugs (Hemiptera: Heteroptera), an ecological and economical highly important as well as morphologically diverse insect taxon. As part of our study we analyzed DNA barcodes for 1742 specimens of 457 species, comprising 39 families of the Heteroptera. We found low nucleotide distances with a minimum pairwise K2P distance 2.2% were detected for 16 traditionally recognized and valid species. With a successful identification rate of 91.5% (418 species) our study emphasizes the use of DNA barcodes for the identification of true bugs and represents an important step in building-up a comprehensive barcode library for true bugs in Germany and Central Europe as well. Our study also highlights the urgent necessity of taxonomic revisions for various taxa of the Heteroptera, with a special focus on various species of the Miridae. In this context we found evidence for on-going hybridization events within various taxonomically challenging genera (e.g. Nabis Latreille, 1802 (Nabidae), Lygus Hahn, 1833 (Miridae), Phytocoris Fallén, 1814 (Miridae)) as well as the putative existence of cryptic species (e.g. Aneurus avenius (Duffour, 1833) (Aradidae) or Orius niger (Wolff, 1811) (Anthocoridae)). PMID:25203616

  8. Differential Expression of P450 Genes and nAChR Subunits Associated With Imidacloprid Resistance in Laodelphax striatellus (Hemiptera: Delphacidae).

    Science.gov (United States)

    Zhang, Yueliang; Liu, Baosheng; Zhang, Zhichun; Wang, Lihua; Guo, Huifang; Li, Zhong; He, Peng; Liu, Zewen; Fang, Jichao

    2018-05-28

    Imidacloprid is a key insecticide used for controlling sucking insect pests, including the small brown planthopper (Laodelphax striatellus, Fallén) (Hemiptera: Delphacidae), an important agricultural pest of rice. A strain of L. striatellus (YN-ILR) developed 21-fold resistance when selected with imidacloprid on a susceptible YN strain. An in vitro study on piperonyl butoxide synergism indicated that enhanced detoxification mediated by cytochrome P450s contributed to imidacloprid resistance to some extent, and multiple P450 genes showed altered expression in the imidacloprid-resistant YN-ILR strain compared with the susceptible YN strain (CYP425B1-CYP6BD10 had 1.51- to 11.45-fold higher expression, CYP4CE2-CYP4DD1V2 had 0.12- to 0.57-fold lower expression). While there were no mutations in target nicotinic acetylcholine receptor (nAChR) genes, subunits of Lsα1, Lsβ1, and Lsβ3 in the YN-ILR strain showed 3.86-, 4.39-, and 2.59-fold higher expression and Lsa8 displayed 0.38-fold lower expression than the YN strain. Moreover, 21-fold moderate imidacloprid resistance in individuals of L. striatellus did not produce a fitness cost. The findings suggest that L. striatellus has the capacity to develop resistance to imidacloprid through P450 detoxification and potential target nAChR expression changes, and moderate imidacloprid resistance was not associated with a fitness cost.

  9. Within-field distribution of the damson-hop aphid Phorodon humuli (Schrank) (Hemiptera: Aphididae) and natural enemies on hops in Spain

    Energy Technology Data Exchange (ETDEWEB)

    Lorenzana, A.; Hermoso de Mendoza, A.; Seco, V.; Campelo, P.; Casquero, P.A.

    2017-07-01

    A field trial was performed in a hop yard throughout 2002, 2003 and 2004 in order to determine the within-field distribution of Phorodon humuli (Schrank) (Hemiptera: Aphididae) and its natural enemies. The distribution of P. humuli was directly affected by the position of the hop plants in the garden, with significantly higher concentrations of aphids (p=0.0122 in 2002 and p=0.0006 in 2003) observed along the edge. However, in 2004 the plants located on the marginal plots had similar populations to those on the more inner plots. This can be explained by a higher wind speed which made it more difficult to land on edge plants first. The hop aphid’s main natural enemy was Coccinella septempunctata (Coleoptera: Coccinellidae), whose population was greatest where the aphids were most abundant with a significantly greater number of eggs (p=0.0230) and adults (p=0.0245) in 2003. Lacewing eggs were also frequently observed, with a significantly higher population (p=0.0221 in 2003 and p=0.0046 in 2004) where the aphid numbers were high. The number of winged aphids was greatest towards the margins of the garden in 2003. It is argued that the spatial distribution of the hop aphid and its natural enemies could be used to plan a sampling program and to estimate the population densities of these insects for use in integrated pest management programs.

  10. Influence of Type of Electric Bright Light on the Attraction of the African Giant Water Bug, Lethocerus indicus (Hemiptera: Belostomatidae

    Directory of Open Access Journals (Sweden)

    Luke Chinaru Nwosu

    2012-01-01

    Full Text Available This study investigated the influence of type of electric bright light (produced by fluorescent light tube and incandescent light bulb on the attraction of the African giant water bug, Lethocerus indicus (Hemiptera: Belostomatidae. Four fluorescent light tubes of 15 watts each, producing white-coloured light and four incandescent light bulbs of 60 watts each, producing yellow-coloured light, but both producing the same amount of light, were varied and used for the experiments. Collections of bugs at experimental house were done at night between the hours of 8.30 pm and 12 mid-night on daily basis for a period of four months per experiment in the years 2008 and 2009. Lethocerus indicus whose presence in any environment has certain implications was the predominant belostomatid bug in the area. Use of incandescent light bulbs in 2009 significantly attracted more Lethocerus indicus 103 (74.6% than use of fluorescent light tubes 35 (25.41% in 2008 [4.92=0.0001]. However, bug’s attraction to light source was not found sex dependent [>0.05; (>0.18=0.4286 and >0.28=0.3897]. Therefore, this study recommends the use of fluorescent light by households, campgrounds, and other recreational centres that are potentially exposed to the nuisance of the giant water bugs. Otherwise, incandescent light bulbs should be used when it is desired to attract the presence of these aquatic bugs either for food or scientific studies.

  11. Within-field distribution of the damson-hop aphid Phorodon humuli (Schrank) (Hemiptera: Aphididae) and natural enemies on hops in Spain

    International Nuclear Information System (INIS)

    Lorenzana, A.; Hermoso de Mendoza, A.; Seco, V.; Campelo, P.; Casquero, P.A.

    2017-01-01

    A field trial was performed in a hop yard throughout 2002, 2003 and 2004 in order to determine the within-field distribution of Phorodon humuli (Schrank) (Hemiptera: Aphididae) and its natural enemies. The distribution of P. humuli was directly affected by the position of the hop plants in the garden, with significantly higher concentrations of aphids (p=0.0122 in 2002 and p=0.0006 in 2003) observed along the edge. However, in 2004 the plants located on the marginal plots had similar populations to those on the more inner plots. This can be explained by a higher wind speed which made it more difficult to land on edge plants first. The hop aphid’s main natural enemy was Coccinella septempunctata (Coleoptera: Coccinellidae), whose population was greatest where the aphids were most abundant with a significantly greater number of eggs (p=0.0230) and adults (p=0.0245) in 2003. Lacewing eggs were also frequently observed, with a significantly higher population (p=0.0221 in 2003 and p=0.0046 in 2004) where the aphid numbers were high. The number of winged aphids was greatest towards the margins of the garden in 2003. It is argued that the spatial distribution of the hop aphid and its natural enemies could be used to plan a sampling program and to estimate the population densities of these insects for use in integrated pest management programs.

  12. Structure and Sensilla of the Mouthparts of the Spotted Lanternfly Lycorma delicatula (Hemiptera: Fulgoromorpha: Fulgoridae), a Polyphagous Invasive Planthopper

    Science.gov (United States)

    Hao, Yanan; Dietrich, Christopher H.; Dai, Wu

    2016-01-01

    Mouthparts are among the most important sensory and feeding structures in insects and comparative morphological study may help explain differences in feeding behavior and diet breadth among species. The spotted lanternfly Lycorma delicatula (White) (Hemiptera: Fulgoromorpha: Fulgoridae) is a polyphagous agricultural pest originating in China, recently established and becoming widespread in Korea, and more recently introduced into eastern North America. It causes severe economic damage by sucking phloem sap and the sugary excrement produced by nymphs and adults serves as a medium for sooty mold. To facilitate future study of feeding mechanisms in this insect, the fine-structural morphology of mouthparts focusing on the distribution of sensilla located on the labium in adult L. delicatula was observed using a scanning electron microscope. The mouthparts consist of a small cone-shaped labrum, a tubular labium and a stylet fascicle consisting of two inner interlocked maxillary stylets partially surrounded by two shorter mandibular stylets similar to those found in other hemipteran insects. The five-segmented labium is unusual (most other Fulgoromorpha have four segments) and is provided with several types of sensilla and cuticular processes situated on the apex of its distal labial segment. In general, nine types of sensilla were found on the mouthparts. Six types of sensilla and four types of cuticular processes are present on sensory fields of the labial apex. The proposed taxonomic and functional significance of the sensilla are discussed. Morphological similarities in the interlocking mechanism of the stylets suggest a relationship between Fulgoromorpha and Heteroptera. PMID:27253390

  13. A Microsatellite-Based Analysis of House Infestation With Triatoma Infestans (Hemiptera: Reduviidae) After Insecticide Spraying in the Argentine Chaco.

    Science.gov (United States)

    Piccinali, Romina V; Gaunt, Michael W; Gürtler, Ricardo E

    2018-05-04

    Prevention of vector-borne transmission of Chagas disease mainly relies on residual insecticide spraying. Despite significant success at a regional scale, house infestation with Triatoma infestans (Klug) (Hemiptera: Reduviidae) still persists in the Gran Chaco ecoregion. One key aspect is the identification of the sources of reinfestant triatomines. After detecting fine-scale genetic structure in two rural villages of Pampa del Indio, Argentine Chaco, we tested hypotheses on the putative origins of the triatomines collected at 4, 8, and 12 mo after insecticide house spraying. We genotyped 10 microsatellite loci in 262 baseline and 83 postspraying triatomines from different houses. Genetic variability was similar between baseline and postspraying populations, but 13 low-frequency alleles were not detected at postspraying. FSTs were not significant between insects collected before and after insecticide spraying at the same house in all but one case, and they clustered together in a neighbor-joining tree. A clustering algorithm detected seven genetic groups, four of them mainly composed of baseline and postspraying insects from the same house. Assignment tests suggested multiple putative sources (including the house of collection) for most postspraying insects but excluded a house located more than 9 km from the study area. The origin of three triatomines was attributed to immigration from other unaccounted sources. Our study is compatible with the hypothesis that house reinfestations in the Argentine Chaco are mostly related to residual foci (i.e., survival of insects within the same community), in agreement with field observations, spatial analysis, and morphometric studies previously published.

  14. Structure and Sensilla of the Mouthparts of the Spotted Lanternfly Lycorma delicatula (Hemiptera: Fulgoromorpha: Fulgoridae, a Polyphagous Invasive Planthopper.

    Directory of Open Access Journals (Sweden)

    Yanan Hao

    Full Text Available Mouthparts are among the most important sensory and feeding structures in insects and comparative morphological study may help explain differences in feeding behavior and diet breadth among species. The spotted lanternfly Lycorma delicatula (White (Hemiptera: Fulgoromorpha: Fulgoridae is a polyphagous agricultural pest originating in China, recently established and becoming widespread in Korea, and more recently introduced into eastern North America. It causes severe economic damage by sucking phloem sap and the sugary excrement produced by nymphs and adults serves as a medium for sooty mold. To facilitate future study of feeding mechanisms in this insect, the fine-structural morphology of mouthparts focusing on the distribution of sensilla located on the labium in adult L. delicatula was observed using a scanning electron microscope. The mouthparts consist of a small cone-shaped labrum, a tubular labium and a stylet fascicle consisting of two inner interlocked maxillary stylets partially surrounded by two shorter mandibular stylets similar to those found in other hemipteran insects. The five-segmented labium is unusual (most other Fulgoromorpha have four segments and is provided with several types of sensilla and cuticular processes situated on the apex of its distal labial segment. In general, nine types of sensilla were found on the mouthparts. Six types of sensilla and four types of cuticular processes are present on sensory fields of the labial apex. The proposed taxonomic and functional significance of the sensilla are discussed. Morphological similarities in the interlocking mechanism of the stylets suggest a relationship between Fulgoromorpha and Heteroptera.

  15. Bioesai bioinsektisida Beauveria bassiana dari Sumatera Selatan terhadap kutu putih pepaya, Paracoccus marginatus Williams & Granara De Willink (Hemiptera: Pseudococcidae

    Directory of Open Access Journals (Sweden)

    Siti Herlinda

    2015-09-01

    Full Text Available In fresh swamp areas of South Sumatra, papaya mealybug, Paracoccus marginatus (Hemiptera: Pseudococcidae could cause severe damage to young papaya trees and decreased the fruit quality. The objective of this research was to bioassay test of the bioinsecticide Beauveria bassiana againts nymphs of P. marginatus. B. bassiana was conducted on rice medium. The bioinsecticide was formulated using dried compost, compost gram, paddy ash, paddy bran, woody powder, paddy bran mixed with woody powder, compost enriched with Trichoderma virens. Controls used were sterile water (control 1 and isolate of B. bassiana (control 2. Results showed that conidial viability of B. bassiana on control 2 was the highest (46.33%. The viability of control 2 was not significantly different from the formulations with carrier of the paddy bran, the paddy bran mixed with woody powder, and the compost enriched with T. virens. The highest nymph mortality (82.86% was found on formulation of compost enriched with T. virens and was significantly different from other treatments. The lowest visibly (73.48% occured on formulation of paddy ash, and was significantly different from other treatments. Mortality on control 1 on average was 29.52%, whereas control 2 averaged of 75.71%. The shortest median lethal time (LT50 (3.55 days was found on formulation of compost enriched with T. virens but the longest one (3.73 days occured on the formulation of paddy ash. Overall, the most effective bioinsecticide was the formulation of compost enriched with T. virens.

  16. Laboratory bioassays to estimate the lethal and sublethal effects of various insecticides and fungicides on Deraeocoris brevis (Hemiptera: Miridae).

    Science.gov (United States)

    Amarasekare, K G; Shearer, P W

    2013-04-01

    This laboratory bioassay focused on lethal and sublethal effects of five insecticides (chlorantraniliprole, cyantraniliprole, spinetoram, novaluron, and lambda-cyhalothrin) and two fungicide treatments (sulfur and a mixture of copper hydroxide and mancozeb) on the predatory mired bug, Deraeocoris brevis (Uhler) (Hemiptera: Miridae) using second instars and adult males and females. Formulated pesticides were tested using concentrations that were equivalent to the high label rate (1x) (high rate) and 1/10th of that amount (0.1x) (low rate) dissolved in 378.5 liters of water. Lambda-cyhalothrin was highly toxic to D. brevis nymphs and adults at both rates, whereas both rates of novaluron were highly toxic to nymphs. Cyantraniliprole, chlorantraniliprole, and novaluron were less toxic to adults, and chlorantraniliprole and spinetoram were less toxic to nymphs. Both rates of spinetoram caused significant mortality to adults. Fecundity of adult females was affected negatively by the high rates of either novaluron or spinetoram, whereas the fertility was affected only by the high rate of novaluron. The high rate of spinetoram reduced survival of nymphs. Adults treated with spinetoram had reduced longevity. Cyantraniliprole caused some mortality to nymphs and affected their survival. Both rates of sulfur were toxic to nymphs and affected emergence to adults. The mixture of copper hydroxide and mancozeb was less toxic to D. brevis. Neither adult longevity nor sex ratio was affected by the fungicides. The r values for D. brecis treated with lambda-cyhalothrin, novaluron, spinetoram, and sulfur were low, indicating that these products may have negative impact on population growth.

  17. Dinâmica populacional e parasitismo natural de Diaphorina citri Kuwayama (Hemiptera: Liviidae em pomares de citros em Sergipe

    Directory of Open Access Journals (Sweden)

    Adriano Farias

    2018-04-01

    Abstract. The Asian citrus psyllid, Diaphorina citri Kuwayama (Hemiptera: Sternorrhyncha: Liviidae, which is the vector of the Hunglongbing (HLB bacterium, has become a key citrus pest in Brazil. In addition to citrus, the ornamental plant known as Orange Jasmine, Murraya paniculata (L. Jack, also hosts the psyllid. The present work aimed at studying the population dynamics of the psyllid in citrus orchards and its parasitism in citrus and M. paniculata in the state of Sergipe, the fourth largest citrus-producing state in Brazil. The evaluations were performed fortnightly for eleven months in seven Pera Citrus sinensis (L. Osbeck orange orchards located in two municipalities of Sergipe state (Boquim, and Umbauba. The populations of eggs, nymphs and adults of D. citri were compared among all orchards and all developmental stages were related to the abiotic factors temperature, relative humidity and precipitation, in each locality. The psyllid was classified as an accessory species (not very abundant in the orchards of Sergipe, showing a higher population density in November, December and March. Precipitation was the only abiotic factor that contributed to the population increase of adults of the psyllid. High rates of parasitism (55% of psyllid nymphs by the exotic parasitoid Tamarixia radiata Waterston (Hymenoptera: Eulophidae were detected in M. paniculata plants. Based on the results, if the HLB bacterium is detected in Sergipe, shorter samplings should be performed in the spring and summer months aiming at vector management. In addition, T. radiata could be released inundatively in integrated vector management programs.

  18. Effects of Temperatures on Immature Development and Survival of the Invasive Stink Bug (Hemiptera: Pentatomidae).

    Science.gov (United States)

    Reed, Darcy A; Ganjisaffar, Fatemeh; Palumbo, John C; Perring, Thomas M

    2017-12-05

    Bagrada hilaris (Burmeister) (Hemiptera: Pentatomidae) is a non-native stink bug that feeds primarily on cole crops and wild mustards. Its invasion into desert agriculture in California and Arizona presents a conundrum between rapid pest development at warm temperatures and severe damage to cool season crops. In this study, the development and survival of B. hilaris were determined at nine constant temperatures (ranging from 20-42°C) when reared on organically grown broccoli florets. Egg hatching was greatly delayed at 20°C, and first instar nymphs did not survive at this temperature. No eggs hatched at 42°C. The highest survival rates (70.0-86.7%) of B. hilaris were observed at temperatures ranging from 24 to 35°C. The total developmental rate of B. hilaris from egg to adult increased from 0.027 to 0.066/d from 24 to 35°C, and then slightly dropped to 0.064/d at 39°C. Based on the linear model, B. hilaris requires 285.4 degree-days to complete its development. The Briere 1 model predicted the lower and upper temperature thresholds as 16.7 and 42.7°C, respectively. The optimal temperature for development (TOpt) was estimated as 36°C. According to the results, B. hilaris is well adapted to warm conditions, and temperatures of 33-39°C are well suited for B. hilaris development. Information from this study helps explain the rapid range expansion of B. hilaris across the southern United States and will be instrumental in predicting future expansion across the rest of the country and in other parts of the world. The relationship between thermal thresholds and invasion dynamics of this pest are discussed. © The Author(s) 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  19. Silencing of ACO decreases reproduction and energy metabolism in triazophos-treated female brown plant hoppers, Nilaparvata lugens Stål (Hemiptera: Delphacidae).

    Science.gov (United States)

    Liu, Zong-Yu; Jiang, Yi-Ping; Li, Lei; You, Lin-Lin; Wu, You; Xu, Bin; Ge, Lin-Quan; Wu, Jin-Cai

    2016-03-01

    The brown plant hopper (BPH), Nilaparvata lugens Stål (Hemiptera: Delphacidae), is a major pest affecting rice in Asia, and outbreaks of this pest are closely linked to pesticide-induced stimulation of reproduction. Therefore, the BPH is a classic example of a resurgent pest. However, the effects of different genes on the regulation of pesticide-induced reproductive stimulation in the BPH are unclear. In this study, the regulatory effects of acyl-coenzyme A oxidase (ACO) on the reproduction and biochemistry of the BPH were investigated with gene silencing. The number of eggs laid per female by triazophos (TZP)+dsACO BPH females was significantly lower than those of TZP-treated (without ACO silencing) or TZP+GFP females (negative control), with the number of eggs decreasing by 30.8% (from 529.5 to 366.3) and 32.0% (from 540.5 to 366.3), respectively. The preoviposition period, oviposition period, and longevity of the TZP-treated females were also influenced by dsACO treatment. Additionally, the amounts of crude fat, protein, and some fatty acids (oleic acid, palmitic acid, linoleic acid, stearic acid, and myristoleic acid) in TZP+dsACO females were significantly lower than in TZP-treated females. Thus, ACO is one of the key genes regulating the TZP-induced stimulation of reproduction in BPH females. Copyright © 2015 Elsevier Inc. All rights reserved.

  20. DNA Barcode Reference Library for the African Citrus Triozid, Trioza erytreae (Hemiptera: Triozidae): Vector of African Citrus Greening.

    Science.gov (United States)

    Khamis, F M; Rwomushana, I; Ombura, L O; Cook, G; Mohamed, S A; Tanga, C M; Nderitu, P W; Borgemeister, C; Sétamou, M; Grout, T G; Ekesi, S

    2017-12-05

    Citrus (Citrus spp.) production continues to decline in East Africa, particularly in Kenya and Tanzania, the two major producers in the region. This decline is attributed to pests and diseases including infestation by the African citrus triozid, Trioza erytreae (Del Guercio) (Hemiptera: Triozidae). Besides direct feeding damage by adults and immature stages, T. erytreae is the main vector of 'Candidatus Liberibacter africanus', the causative agent of Greening disease in Africa, closely related to Huanglongbing. This study aimed to generate a novel barcode reference library for T. erytreae in order to use DNA barcoding as a rapid tool for accurate identification of the pest to aid phytosanitary measures. Triozid samples were collected from citrus orchards in Kenya, Tanzania, and South Africa and from alternative host plants. Sequences generated from populations in the study showed very low variability within acceptable ranges of species. All samples analyzed were linked to T. erytreae of GenBank accession number KU517195. Phylogeny of samples in this study and other Trioza reference species was inferred using the Maximum Likelihood method. The phylogenetic tree was paraphyletic with two distinct branches. The first branch had two clusters: 1) cluster of all populations analyzed with GenBank accession of T. erytreae and 2) cluster of all the other GenBank accession of Trioza species analyzed except T. incrustata Percy, 2016 (KT588307.1), T. eugeniae Froggatt (KY294637.1), and T. grallata Percy, 2016 (KT588308.1) that occupied the second branch as outgroups forming sister clade relationships. These results were further substantiated with genetic distance values and principal component analyses. © The Author(s) 2017. Published by Oxford University Press on behalf of Entomological Society of America.