Energy Technology Data Exchange (ETDEWEB)
Khorshidi, Abdollah, E-mail: abkhorshidi@yahoo.com
2016-11-01
Medical nano-gold radioisotopes is produced regularly using high-flux nuclear reactors, and an accelerator-driven neutron activator can turn out higher yield of {sup 197}Au(n,γ){sup 196,198}Au reactions. Here, nano-gold production via radiative/neutron capture was investigated using irradiated Tehran Research Reactor flux and also simulated proton beam of Karaj cyclotron in Iran. {sup 197}Au nano-solution, including 20 nm shaped spherical gold and water, was irradiated under Tehran reactor flux at 2.5E + 13 n/cm{sup 2}/s for {sup 196,198}Au activity and production yield estimations. Meanwhile, the yield was examined using 30 MeV proton beam of Karaj cyclotron via simulated new neutron activator containing beryllium target, bismuth moderator around the target, and also PbF{sub 2} reflector enclosed the moderator region. Transmutation in {sup 197}Au nano-solution samples were explored at 15 and 25 cm distances from the target. The neutron flux behavior inside the water and bismuth moderators was investigated for nano-gold particles transmutation. The transport of fast neutrons inside bismuth material as heavy nuclei with a lesser lethargy can be contributed in enhanced nano-gold transmutation with long duration time than the water moderator in reactor-based method. Cyclotron-driven production of βeta-emitting radioisotopes for brachytherapy applications can complete the nano-gold production technology as a safer approach as compared to the reactor-based method. - Graphical abstract: This figure describes gold nanoparticles production via cyclotron based method. The aim of investigating is to estimate activity and saturation yield of {sup 197}Au(n,γ){sup 198}Au and {sup 197}Au(n,2n){sup 196}Au reactions using Karaj cyclotron available in Iran. The feasibility of a cyclotron-driven production of βeta-emitting radioisotopes was investigated for therapeutic applications via a new neutron activator design. - Highlights: • Nano-gold radioisotope production
International Nuclear Information System (INIS)
Nat, A.; Ene, A.; Lupu, R.
2004-01-01
The nuclear and spectral interferences in the 14 MeV neutron activation analysis (NAA) of gold from Romanian auriferous alluvial sands, concentrates and rocks have been studied and the optimum of activation, cooling and measuring times was determined for a maximum peak-to-background ratio for gold. The contribution of the nuclear interfering elements in the samples, Hg and Pt, to the concentration of gold has been calculated and, concluded that the nuclear reactions 197 Au(n,2n) 196 Au, 197 Au(n,2n) 196 mAu and 197 Au(n,n') 197 mAu can be used for gold determination, with minimal errors. Using the nuclear reactions 197 Au(n,n') 197 mAu and 197 Au(n,2n) 196 Au the spectral interferences are minimal and are due to Rb, Ti and V for a short irradiation and to Se for a long one. Two methods of fast gold determination were proposed for auriferous alluvial sands and rocks in the range of 20-2500 ppm, under the optimum conditions established so that the systematic errors of analysis due to the gold accompanying elements can be considerably diminished. For measuring the induced gamma-radioactivity in the samples either a short irradiation (25 seconds) with a NaI(Tl) detector or a long irradiation (3000 seconds) with a Ge(Li) detector were used. (author)
2010-07-01
... 32 National Defense 2 2010-07-01 2010-07-01 false Recruitment. 196.310 Section 196.310 National... Discrimination on the Basis of Sex in Admission and Recruitment Prohibited § 196.310 Recruitment. (a) Nondiscriminatory recruitment. A recipient to which §§ 196.300 through 196.310 apply shall not discriminate on the...
Determination of gold in auriferous alluvial sands and rocks by 14 MeV neutron activation analysis
International Nuclear Information System (INIS)
Ene, A.; Nat, A.; Lupu, R.; Popescu, I.V.
2004-01-01
In this work a complex study of the interferences which appear in gold determination by 14 MeV neutron activation analysis of some Romanian auriferous alluvial sands and rocks has been carried out. The contribution of the nuclear interfering elements - Hg and Pt - to the concentration of gold in the samples is minimum in the case of the nuclear reactions 197 Au (n, 2n) 196 Au, 197 Au (n, 2n) 196m Au and 197 Au (n, n') 197m Au. As regards the spectral interferences, these are minimum in the case of using the reactions 197 Au (n, n') 197m Au and 197 Au (n, 2n) 196 Au and are due to Rb, Ti and V for short irradiation and to Se for long irradiation. We propose two methods of gold determination in auriferous alluvial sands and rocks in the range 20-2500 ppm - the minimum value of 20 ppm being at the level of an economic extraction - in the optimum conditions established by us so that the systematic errors of analysis due to the gold accompanying elements should be considerably diminished: a method using short irradiation (25s) and NaI(Tl) spectrometry for measuring the induced gamma radioactivity in the samples and a method using long irradiation (3000s) and Ge(Li) spectrometry. The data presented in this paper can be adapted by other analysts to the rapid determination of gold in a variety of alluvial sands and rocks. (authors)
International Nuclear Information System (INIS)
Lupu, Roxana; Nat, Alexandrina; Ene, Antoaneta
2004-01-01
In this work a complex study of the nuclear and spectral interferences which appear in gold determination by 14 MeV neutron activation analysis of Romanian auriferous alluvial sands and rocks has been accomplished. The contribution of the nuclear interfering elements - Hg and Pt - to the concentration of gold in the samples is minimum in the case of the nuclear reactions 197 Au(n, 2n) 196 Au, 197 Au (n,2n) 196m Au and 197 Au(n, n ' ) 197m Au. As regards the spectral interferences, these are minimum in the case of using the reactions 197 Au(n, n ' ) 197m Au and 197 Au (n, 2n) 196 Au and are due to Rb, Ti and V for the short irradiation and to Se for the long irradiation. We propose two methods of gold determination in auriferous alluvial sands and rocks in the range 20-2500 ppm - the minimum value of 20 ppm being at the level of an economic extraction - in the optima conditions established by us so that the systematic errors of analysis due to the gold accompanying elements should be considerably diminished: a method using short irradiation (25 s) and NaI(Tl) spectrometry for the measuring of the induced gamma radioactivity in the samples and a method using long irradiation (3000 s) and Ge(Li) spectrometry. The data presented in this paper can be adapted by other analysts to the rapid determination of gold in a variety of alluvial sands and rocks
2010-07-01
... 32 National Defense 2 2010-07-01 2010-07-01 false Housing. 196.405 Section 196.405 National... Discrimination on the Basis of Sex in Education Programs or Activities Prohibited § 196.405 Housing. (a... different fees or requirements, or offer different services or benefits related to housing, except as...
2010-07-01
... 32 National Defense 2 2010-07-01 2010-07-01 false Employment. 196.500 Section 196.500 National... Discrimination on the Basis of Sex in Employment in Education Programs or Activities Prohibited § 196.500 Employment. (a) General. (1) No person shall, on the basis of sex, be excluded from participation in, be...
22 CFR 196.4 - Administering office.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Administering office. 196.4 Section 196.4... AFFAIRS/GRADUATE FOREIGN AFFAIRS FELLOWSHIP PROGRAM § 196.4 Administering office. The Department of State's Bureau of Human Resources, Office of Recruitment is responsible for administering the Thomas R...
Lifescience Database Archive (English)
Full Text Available VS (Link to library) VSK196 (Link to dictyBase) - - - Contig-U10274-1 VSK196P (Link... to Original site) VSK196F 423 VSK196Z 453 VSK196P 876 - - Show VSK196 Library VS (Link to library) Clone ID VSK196 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10274-1 Original site URL http://dict...TTATNAACAATTAAAAAAAA sequence update 2001. 3.22 Translated Amino Acid sequence kdgklvslkdfikdqkpivlyfypkdetsict...*NKIX--- ---KLKVGDQAPDFTCPDKDGKLVSLKDFIKDQKPIVLYFYPKDETSICTKEACEFRDKY QKFIEAGADVI
32 CFR 196.525 - Fringe benefits.
2010-07-01
... 32 National Defense 2 2010-07-01 2010-07-01 false Fringe benefits. 196.525 Section 196.525... Prohibited § 196.525 Fringe benefits. (a) “Fringe benefits” defined. For purposes of these Title IX regulations, fringe benefits means: Any medical, hospital, accident, life insurance, or retirement benefit...
21 CFR 211.196 - Distribution records.
2010-04-01
...: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR FINISHED PHARMACEUTICALS Records and Reports § 211.196 Distribution records. Distribution records shall contain the name and strength of the product and description... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Distribution records. 211.196 Section 211.196 Food...
46 CFR 196.15-10 - Sanitation.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Sanitation. 196.15-10 Section 196.15-10 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS OPERATIONS Test, Drills, and Inspections § 196.15-10 Sanitation. (a) It shall be the duty of the master and chief engineer...
Nuclear Data Sheets for A = 196
International Nuclear Information System (INIS)
Huang Xiaolong
2007-01-01
The 1998 version of nuclear data sheets for A = 196 has been revised and updated on the basis of the experimental results from various decay and reaction studies before January 2006. The experimental data for all known nuclei of A = 196 (Os,Ir,Pt,Au,Hg, Tl,Pb,Bi,Po,At,Rn) have been reevaluated. The experimental methods, references,Jπ arguments,and necessary comments are given in the text. Summary band structure drawings and level schemes from both radioactive decay and reaction studies are presented. Also of special interest are the new identification of superdeformed bands in 196 Pb and 196 Bi
2010-07-01
... 32 National Defense 2 2010-07-01 2010-07-01 false Advertising. 196.540 Section 196.540 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS... Advertising. A recipient shall not in any advertising related to employment indicate preference, limitation...
2010-07-01
... 32 National Defense 2 2010-07-01 2010-07-01 false Recruitment. 196.510 Section 196.510 National... Recruitment. (a) Nondiscriminatory recruitment and hiring. A recipient shall not discriminate on the basis of sex in the recruitment and hiring of employees. Where a recipient has been found to be presently...
46 CFR 196.40-5 - Hull markings.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Hull markings. 196.40-5 Section 196.40-5 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS OPERATIONS Markings on Vessels § 196.40-5 Hull markings. Vessels shall be marked as required by parts 67 and 69 of this chapter...
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFI196 (Link to dictyBase) - - - Contig-U16512-1 - (Link to Or...iginal site) - - VFI196Z 168 - - - - Show VFI196 Library VF (Link to library) Clone ID VFI196 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16512-1 Original site URL http://dictycdb.b...ces. 40 8.8 1 CK407044 |CK407044.1 AUF_IfLvr_212_p04 Ictalurus furcatus liver cDNA library Ictalurus furcatu...%: nuclear 36.0 %: mitochondrial 16.0 %: cytoplasmic 4.0 %: cytoskeletal >> prediction for VFI196 is nuc 5'
32 CFR 196.520 - Job classification and structure.
2010-07-01
... 32 National Defense 2 2010-07-01 2010-07-01 false Job classification and structure. 196.520 Section 196.520 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE... Activities Prohibited § 196.520 Job classification and structure. A recipient shall not: (a) Classify a job...
27 CFR 28.196 - Consignment, shipment, and delivery.
2010-04-01
... delivery. 28.196 Section 28.196 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE... Benefit of Drawback Filing of Notice and Removal § 28.196 Consignment, shipment, and delivery. The consignment, shipment, and delivery of distilled spirits removed under this subpart for export, use on vessels...
32 CFR 196.410 - Comparable facilities.
2010-07-01
... 32 National Defense 2 2010-07-01 2010-07-01 false Comparable facilities. 196.410 Section 196.410....410 Comparable facilities. A recipient may provide separate toilet, locker room, and shower facilities on the basis of sex, but such facilities provided for students of one sex shall be comparable to such...
46 CFR 196.37-47 - Portable magazine chests.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Portable magazine chests. 196.37-47 Section 196.37-47... Markings for Fire and Emergency Equipment, etc. § 196.37-47 Portable magazine chests. (a) Portable magazine chests shall be marked in letters at least 3 inches high: PORTABLE MAGAZINE CHEST — FLAMMABLE — KEEP...
46 CFR 196.95-1 - Pilot boarding operations.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Pilot boarding operations. 196.95-1 Section 196.95-1... Pilot Boarding Operations § 196.95-1 Pilot boarding operations. (a) The master shall ensure that pilot boarding equipment is maintained as follows: (1) The equipment must be kept clean and in good working order...
46 CFR 196.37-9 - Carbon dioxide alarm.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Carbon dioxide alarm. 196.37-9 Section 196.37-9 Shipping... Markings for Fire and Emergency Equipment, etc. § 196.37-9 Carbon dioxide alarm. (a) All carbon dioxide alarms shall be conspicuously identified: “WHEN ALARM SOUNDS—VACATE AT ONCE. CARBON DIOXIDE BEING...
46 CFR 196.30-5 - Accidents to machinery.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Accidents to machinery. 196.30-5 Section 196.30-5... Reports of Accidents, Repairs, and Unsafe Equipment § 196.30-5 Accidents to machinery. (a) In the event of an accident to a boiler, unfired pressure vessel, or machinery tending to render the further use of...
Lu, Ya-Ching; Chang, Joseph Tung-Chieh; Huang, Yu-Chen; Huang, Chi-Che; Chen, Wen-Ho; Lee, Li-Yu; Huang, Bing-Shen; Chen, Yin-Ju; Li, Hsiao-Fang; Cheng, Ann-Joy
2015-02-01
The aim of this study was to determine whether the oncogenic microRNA family members miR-196a and miR-196b can be circulating biomarkers for the early detection of oral cancer. To determine the stability of circulating miRNA, the blood sample was aliquot and stored at different temperature conditions for analysis. To assess the diagnostic efficacy, we determined the levels of miR-196s in plasma samples, including 53 from healthy individuals, 16 from pre-cancer patients, and 90 from oral cancer patients. In general, circulating miRNA was very stable when storing plasma samples at -20°C or below. In clinical study, both circulating miR-196a and miR-196b were substantially up-regulated in patients with oral pre-cancer lesions (5.9- and 14.8-fold, respectively; P oral cancer patients (9.3- and 17.0-fold, respectively; P cancer patients (AUC = 0.764 or 0.840, miR-196a or miR-196b, respectively), and between normal and cancer patients (AUC = 0.864 or 0.960, miR-196a or miR-196b, respectively). The combined determination of miR-196a and miR-196b levels produces excellent sensitivity and specificity in the diagnosis of patients with oral pre-cancer (AUC = 0.845) or oral cancer (AUC = 0.963), as well as in the prediction of potential malignancy (AUC = 0.950, sensitivity = 91%, specificity = 85%). Combined determination of circulating miR-196a and miR-196b levels may serve as panel plasma biomarkers for the early detection of oral cancer. Copyright © 2014 The Canadian Society of Clinical Chemists. Published by Elsevier Inc. All rights reserved.
The role of waste sorting in the South African gold-mining industry
International Nuclear Information System (INIS)
Freer, J.S.; Boehme, R.C.
1985-01-01
The absolute potential for sorting waste from run-of-mine Witwatersrand gold ores normally lies between 60 and 90 per cent by mass. At present, the practical potential lies between 40 and 50 per cent. Yet few mines achieve a waste rejection of even 30 per cent. The average waste rejection for industry, including underground sorting, fell from 19,6 per cent in 1959 to 10,1 per cent in 1983, as industry moved from labour-intensive, multistage comminution, incorporating washing, screening, and sorting, to single-stage run-of-mine milling. Most of the sorting is still being done by hand; yet photometric and radiometric sorting machines of high capacity are available. More recently, a sorter based on neutron activation and the subsequent isomeric radioactive decay of gold itself was designed. This paper examines the case for an increased role for sorting in the South African gold-mining industry brought about by the increasing cost of power for milling and the possibility of extracting gold from low-grade reject fractions by heap leaching
Prehospital Emergencies in Illegal Gold Mining Sites in French Guiana.
Egmann, Gérald; Tattevin, Pierre; Palancade, Renaud; Nacher, Matthieu
2018-03-01
Illegal gold mining is flourishing in French Guiana, existing outside the law due to both the high cost of gold mining permits and the challenges of law enforcement within the Amazon forest. We report the characteristics of, and the medical responses to, medical emergencies in illegal gold mining sites. We performed a retrospective study of all medical emergencies reported from illegal gold mining sites to the centralized call office of SAMU 973 from 1998 through 2000 and from 2008 through 2010. According to the national health care system, any medical emergency within the territory is handled by the prehospital emergency medical service (SAMU 973), irrespective of the patients' legal status. Data were extracted from the SAMU 973 notebook registry (1998-2000) or the SAMU 973 computerized database (2008-2010) and werre collected using a standardized questionnaire. Of 71,932 calls for medical emergencies in French Guiana during the study periods, 340 (0.5%) originated from illegal gold mining sites. Of these, 196 (58%) led to medical evacuation by helicopter, whereas the overall rate of evacuation by helicopter after placing a call to SAMU 973 was only 4% (3020/71,932; PAmazon forest mostly include infectious diseases, followed by trauma, and often require medical evacuation by helicopter. Our study suggests that implementation of preventive medicine within gold mining sites, irrespective of their legal status, could be cost-effective and reduce morbidity. Copyright © 2017 Wilderness Medical Society. Published by Elsevier Inc. All rights reserved.
22 CFR 19.6 - Court orders and divorce decrees.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Court orders and divorce decrees. 19.6 Section 19.6 Foreign Relations DEPARTMENT OF STATE PERSONNEL BENEFITS FOR SPOUSES AND FORMER SPOUSES OF PARTICIPANTS IN THE FOREIGN SERVICE RETIREMENT AND DISABILITY SYSTEM § 19.6 Court orders and divorce decrees. ...
40 CFR 98.196 - Data reporting requirements.
2010-07-01
... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Data reporting requirements. 98.196 Section 98.196 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS... use in a purification process). If CO2 was used on-site, provide the information in paragraphs (b)(17...
16 CFR 1.96 - Compromise of penalty.
2010-01-01
... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Compromise of penalty. 1.96 Section 1.96 Commercial Practices FEDERAL TRADE COMMISSION ORGANIZATION, PROCEDURES AND RULES OF PRACTICE GENERAL... may compromise any penalty or proposed penalty at any time, with leave of court when necessary, taking...
46 CFR 196.85-1 - Magazine operation and control.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Magazine operation and control. 196.85-1 Section 196.85... OPERATIONS Magazine Control § 196.85-1 Magazine operation and control. (a) Keys to magazine spaces and magazine chests shall be kept in the sole control or custody of the Master or one delegated qualified...
Laser spectroscopy of laser-desorbed gold isotopes
International Nuclear Information System (INIS)
Savard, G.; Crawford, J.E.; Lee, J.K.P.; Thekkadath, G.
1990-01-01
Changes in mean-square charge radius δ 2 >, and magnetic dipole moments μ I have been measured for a series of neutron-deficient gold isotopes between A=186 and 196, and for neutron-rich 198,199 Au, using the PILIS system on-line with the ISOCELE mass separator. These measurements confirm the existence of the shape transition between A=186 and 187. The measured μ I values have been compared with calculations using Nilsson, and symmetric-rotor-plus-quasiparticle models. The results are consistent with the interpretation that 186 Au is prolate, and that the heavier isotopes have oblate, or possibly triaxial deformation. (orig.)
32 CFR 196.440 - Health and insurance benefits and services.
2010-07-01
... 32 National Defense 2 2010-07-01 2010-07-01 false Health and insurance benefits and services. 196... Activities Prohibited § 196.440 Health and insurance benefits and services. Subject to § 196.235(d), in providing a medical, hospital, accident, or life insurance benefit, service, policy, or plan to any of its...
Energy Technology Data Exchange (ETDEWEB)
Gardner, C.J.
2010-08-01
A Gold ion with charge eQ has N = 197 Nucleons, Z = 79 Protons, and (Z-Q) electrons. (Here Q is an integer and e is the charge of a single proton.) The mass is m = au - Qm{sub e} + E{sub b}/c{sup 2} (1) where a = 196.966552 is the relative atomic mass [1, 2] of the neutral Gold atom, u = 931.494013 MeV/c{sup 2} is the unified atomic mass unit [3], and m{sub e}c{sup 2} = .510998902 MeV is the electron mass [3]. E{sub b} is the binding energy of the Q electrons removed from the neutral Gold atom. This amounts to 0.332 MeV for the helium-like gold ion (Q = 77) and 0.517 MeV for the fully stripped ion. For the Au{sup 31+} ion we have E{sub b} = 13.5 keV. These numbers are given in Ref. [4].
21 CFR 19.6 - Code of ethics for government service.
2010-04-01
... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Code of ethics for government service. 19.6 Section 19.6 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL STANDARDS OF CONDUCT AND CONFLICTS OF INTEREST General Provisions § 19.6 Code of ethics for government...
27 CFR 44.196a - To a foreign-trade zone.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false To a foreign-trade zone. 44.196a Section 44.196a Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE... Shipment § 44.196a To a foreign-trade zone. Where tobacco products, and cigarette papers and tubes are...
32 CFR 196.455 - Textbooks and curricular material.
2010-07-01
... 32 National Defense 2 2010-07-01 2010-07-01 false Textbooks and curricular material. 196.455 Section 196.455 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Discriminatio...
International Nuclear Information System (INIS)
Gardner, C.J.
2010-01-01
A Gold ion with charge eQ has N = 197 Nucleons, Z = 79 Protons, and (Z-Q) electrons. (Here Q is an integer and e is the charge of a single proton.) The mass is m = au - Qm e + E b /c 2 (1) where a = 196.966552 is the relative atomic mass (1, 2) of the neutral Gold atom, u = 931.494013 MeV/c 2 is the unified atomic mass unit (3), and m e c 2 = .510998902 MeV is the electron mass (3). E b is the binding energy of the Q electrons removed from the neutral Gold atom. This amounts to 0.332 MeV for the helium-like gold ion (Q = 77) and 0.517 MeV for the fully stripped ion. For the Au 31+ ion we have E b = 13.5 keV. These numbers are given in Ref. (4). The deuteron mass (3) is 1875.612762(75) MeV/c 2 .
Geochemistry of the Dashui gold deposit in west Qinling mountains, Gansu
International Nuclear Information System (INIS)
Han Chunming; Yuan Wanming; Yu Fusheng; Tang Yunhui; Bao Zengkuan
2003-01-01
Dashui large gold deposit is located in the south of western Qinling Moutains between Qinling orogenic zone and Songpan-Ganzi orogenic zone. It was controlled by NWW-trending fault zone. The host rocks of the gold mineralization is mainly Triassic altered limestone and adamellite dikes. The σ 34 S values of pyrite range from -1.8 to +4.5 per mil with a mean of 2.40‰, reflecting a deep source of sulfur. Oxygen isotope data of calcite in ores indicates that calcite has σ 18 O values ranging from -22.4 to -11.1 per mil The calculated σ 18 O water values of calcite range from -4.32 to +8.33 per mil and the σD values range from -61.1 to -101 per mil, σD and σ 18 O water values suggesting that the ore fluids were mainly derived from magma in the early stage of mineralization. However, the values in the late mineralization stage decrease, indicating mixing of meteoric waters at the time of the mineralization. Homogenization temperatures of fluid inclusions are relatively low, falling between 100 and 400℃ and mostly between 150 and 200℃, with a peak value of 175℃. Salinities exhibit a wide range from 2.70 to 9.10 wt.% NaCl equiv , with a mean of 4.88 wt.% NaCl equiv In addition, the early gold mineralization occurred from 196 Ma to 182.8 Ma, and late gold mineralization took place range from 72.15 Ma to 41.21 Ma, based on the Rb-Sr isochron dating of inclusions from calcite in ores, it means that the Dashui gold deposit at least has twice gold mineralization. (authors)
2010-07-01
... NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Discrimination on the Basis of Sex in Education Programs or Activities Prohibited § 196.450 Athletics. (a... time; (iv) Travel and per diem allowance; (v) Opportunity to receive coaching and academic tutoring...
28 CFR 0.196 - Procedures for resolving disagreements concerning mail or case assignments.
2010-07-01
... concerning mail or case assignments. 0.196 Section 0.196 Judicial Administration DEPARTMENT OF JUSTICE ORGANIZATION OF THE DEPARTMENT OF JUSTICE Jurisdictional Disagreements § 0.196 Procedures for resolving... assigned, the disagreement, together with a statement of the view of the unit or units involved, shall be...
Energy Technology Data Exchange (ETDEWEB)
Gardner, C.J.
2010-08-01
A Gold ion with charge eQ has N = 197 Nucleons, Z = 79 Protons, and (Z-Q) electrons. (Here Q is an integer and e is the charge of a single proton.) The mass is m = au - Qm{sub e} + E{sub b}/c{sup 2} (1) where a = 196.966552 is the relative atomic mass [1, 2] of the neutral Gold atom, u = 931.494013 MeV/c{sup 2} is the unified atomic mass unit [3], and m{sub e}c{sup 2} = .510998902 MeV is the electron mass [3]. E{sub b} is the binding energy of the Q electrons removed from the neutral Gold atom. This amounts to 0.332 MeV for the helium-like gold ion (Q = 77) and 0.517 MeV for the fully stripped ion. For the Au{sup 31+} ion we have E{sub b} = 13.5 keV. These numbers are given in Ref. [4]. The deuteron mass [3] is 1875.612762(75) MeV/c{sup 2}.
Gold film with gold nitride - A conductor but harder than gold
International Nuclear Information System (INIS)
Siller, L.; Peltekis, N.; Krishnamurthy, S.; Chao, Y.; Bull, S.J.; Hunt, M.R.C.
2005-01-01
The formation of surface nitrides on gold films is a particularly attractive proposition, addressing the need to produce harder, but still conductive, gold coatings which reduce wear but avoid the pollution associated with conventional additives. Here we report production of large area gold nitride films on silicon substrates, using reactive ion sputtering and plasma etching, without the need for ultrahigh vacuum. Nanoindentation data show that gold nitride films have a hardness ∼50% greater than that of pure gold. These results are important for large-scale applications of gold nitride in coatings and electronics
46 CFR 196.15-15 - Examination of boilers and machinery.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Examination of boilers and machinery. 196.15-15 Section... VESSELS OPERATIONS Test, Drills, and Inspections § 196.15-15 Examination of boilers and machinery. (a) It shall be the duty of the chief engineer when he assumes charge of the boilers and machinery of a vessel...
46 CFR 196.45-1 - Master and chief engineer responsible.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Master and chief engineer responsible. 196.45-1 Section... VESSELS OPERATIONS Carrying of Excess Steam § 196.45-1 Master and chief engineer responsible. (a) It shall be the duty of the master and the engineer in charge of the boilers of any vessel to require that a...
Determination of gold in gold ores
International Nuclear Information System (INIS)
Keedy, C.R.; Parson, L.; Shen, J.
1989-01-01
The gold content of placer gold flakes and gold bearing ores was determined by instrumental and radiochemical neutron activation analysis, respectively. It was discovered that significant errors result in the instrumental method for gold flakes as small as 10 mg due to sample self-absorption of neutrons during irradiation. Reliable results were obtained for both ore samples and gold flakes by dissolving the samples in aqua regia prior to irradiation. (author) 7 refs.; 3 tabs
46 CFR 196.13-1 - Muster lists, emergency signals, and manning.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Muster lists, emergency signals, and manning. 196.13-1... VESSELS OPERATIONS Station Bills § 196.13-1 Muster lists, emergency signals, and manning. The requirements for muster lists, emergency signals, and manning must be in accordance with subchapter W (Lifesaving...
46 CFR 196.30-1 - Repairs to boilers and pressure vessels.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Repairs to boilers and pressure vessels. 196.30-1... VESSELS OPERATIONS Reports of Accidents, Repairs, and Unsafe Equipment § 196.30-1 Repairs to boilers and pressure vessels. (a) Before making any repairs to boilers or unfired pressure vessels, the Chief Engineer...
Fawzy, Manal S.; Hussein, Mohammad H.; Abdelaziz, Eman Z.; Yamany, Hussain A.; Ismail, Hussein M.; Toraih, Eman A.
2016-01-01
Chronic obstructive pulmonary disease (COPD) is a multifactorial chronic respiratory disease, characterized by an obstructive pattern. Understanding the genetic predisposition of COPD is essential to develop personalized treatment regimens. MicroRNAs (miRNAs) are small, endogenous, non-coding RNAs that modulate the expression levels of specific proteins based on sequence complementarity with their target mRNA molecules. Emerging evidences demonstrated the potential use of miRNAs as a disease biomarker. This pilot study aimed to investigate the association of the MIR-196a2 rs11614913 (C/T) polymorphism with COPD susceptibility, the clinical outcome and bronchodilator response to short-acting β2-agonist. Genotyping of rs11614913 polymorphism was determined in 108 COPD male patients and 116 unrelated controls using real-time polymerase chain reaction technology. In silico target prediction and network core analysis were performed. COPD patients did not show significant differences in the genotype distribution (p = 0.415) and allele frequencies (p = 0.306) of the studied miRNA when compared with controls. There were also no associations with GOLD stage, dyspnea grade, disease exacerbations, COPD assessment test for estimating impact on health status score, or the frequency of intensive care unit admission. However, COPD patients with CC genotype corresponded to the smallest bronchodilator response after Salbutamol inhalation, the heterozygotes (CT) had an intermediate response, while those with the TT genotype showed the highest response (p < 0.001). In conclusion MIR-196a2 rs11614913 polymorphism is associated with the bronchodilator response of COPD in our sample of the Egyptian population, generating hypothesis of the potential use of MIR-196a2 variant as a pharmacogenetic marker for COPD. PMID:27043015
Biosynthesis of gold nanoparticles using diatoms-silica-gold and EPS-gold bionanocomposite formation
Schröfel, Adam; Kratošová, Gabriela; Bohunická, Markéta; Dobročka, Edmund; Vávra, Ivo
2011-01-01
Novel synthesis of gold nanoparticles, EPS-gold, and silica-gold bionanocomposites by biologically driven processes employing two diatom strains (Navicula atomus, Diadesmis gallica) is described. Transmission electron microscopy (TEM) and electron diffraction analysis (SAED) revealed a presence of gold nanoparticles in the experimental solutions of the diatom culture mixed with tetrachloroaureate. Nature of the gold nanoparticles was confirmed by X-ray diffraction studies. Scanning electron m...
2010-03-29
... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [Order No. 1671] Approval for Processing Authority, Foreign-Trade Zone 196, ATC Logistics & Electronics (Personal Navigation Devices), Fort Worth... & Electronics, an operator of Foreign-Trade Zone 196, has requested processing authority within FTZ 196 in Fort...
miR-196a targets netrin 4 and regulates cell proliferation and migration of cervical cancer cells
International Nuclear Information System (INIS)
Zhang, Jie; Zheng, Fangxia; Yu, Gang; Yin, Yanhua; Lu, Qingyang
2013-01-01
Highlights: •miR-196a was overexpressed in cervical cancer tissue compared to normal tissue. •miR-196a expression elevated proliferation and migration of cervical cancer cells. •miR-196a inhibited NTN4 expression by binding 3′-UTR region of NTN4 mRNA. •NTN4 inversely correlated with miR-196a expression in cervical tissue and cell line. •NTN4 expression was low in cervical cancer tissue compared to normal tissue. -- Abstract: Recent research has uncovered tumor-suppressive and oncogenic potential of miR-196a in various tumors. However, the expression and mechanism of its function in cervical cancer remains unclear. In this study, we assess relative expression of miR-196a in cervical premalignant lesions, cervical cancer tissues, and four cancer cell lines using quantitative real-time PCR. CaSki and HeLa cells were treated with miR-196a inhibitors, mimics, or pCDNA/miR-196a to investigate the role of miR-196a in cancer cell proliferation and migration. We demonstrated that miR-196a was overexpressed in cervical intraepithelial neoplasia 2–3 and cervical cancer tissue. Moreover, its expression contributes to the proliferation and migration of cervical cancer cells, whereas inhibiting its expression led to a reduction in proliferation and migration. Five candidate targets of miR-196a chosen by computational prediction and Cervical Cancer Gene Database search were measured for their mRNA in both miR-196a-overexpressing and -depleted cancer cells. Only netrin 4 (NTN4) expression displayed an inverse association with miR-196a. Fluorescent reporter assays revealed that miR-196a inhibited NTN4 expression by targeting one binding site in the 3′-untranslated region (3′-UTR) of NTN4 mRNA. Furthermore, qPCR and Western blot assays verified NTN4 expression was downregulated in cervical cancer tissues compared to normal controls, and in vivo mRNA level of NTN4 inversely correlated with miR-196a expression. In summary, our findings provide new insights about the
International Nuclear Information System (INIS)
Lawrie, J. J.; Lawrie, E. A.; Newman, R. T.; Sharpey-Schafer, J. F.; Smit, F. D.; Msezane, B.; Benatar, M.; Mabala, G. K.; Mutshena, K. P.; Federke, M.; Mullins, S. M.; Ncapayi, N. J.; Vymers, P.
2011-01-01
High spin states in 196 Hg have been populated in the 198 Pt(α,6n) reaction at 65 MeV and the level scheme has been extended. A new dipole band has been observed and a previously observed dipole has been confirmed. Excitation energies, spins and parities of these bands were determined from DCO ratio and linear polarization measurements. Possible quasiparticle excitations responsible for these structures are discussed.
Acalabrutinib (ACP-196: a selective second-generation BTK inhibitor
Directory of Open Access Journals (Sweden)
Jingjing Wu
2016-03-01
Full Text Available Abstract More and more targeted agents become available for B cell malignancies with increasing precision and potency. The first-in-class Bruton’s tyrosine kinase (BTK inhibitor, ibrutinib, has been in clinical use for the treatment of chronic lymphocytic leukemia, mantle cell lymphoma, and Waldenstrom’s macroglobulinemia. More selective BTK inhibitors (ACP-196, ONO/GS-4059, BGB-3111, CC-292 are being explored. Acalabrutinib (ACP-196 is a novel irreversible second-generation BTK inhibitor that was shown to be more potent and selective than ibrutinib. This review summarized the preclinical research and clinical data of acalabrutinib.
INFRARED AND KINEMATIC PROPERTIES OF THE SUBSTELLAR OBJECT G 196-3 B
International Nuclear Information System (INIS)
Zapatero Osorio, M. R.; Caballero, J. A.; Rebolo, R.; Bihain, G.; Bejar, V. J. S.; Alvarez, C.
2010-01-01
We report unusual near- and mid-infrared photometric properties of G 196-3 B, the young substellar companion at 16'' from the active M2.5-type star G 196-3 A, using data taken with the IRAC and MIPS instruments onboard Spitzer. G 196-3 B shows markedly redder colors at all wavelengths from 1.6 up to 24 μm than expected for its spectral type, which is determined at L3 from optical and near-infrared spectra. We discuss various physical scenarios to account for its reddish nature and conclude that a low-gravity atmosphere with enshrouded upper atmospheric layers and/or a warm dusty disk/envelope provides the most likely explanations, the two of them consistent with an age in the interval 20-300 Myr. We also present new and accurate separate proper motion measurements for G 196-3 A and B confirming that both objects are gravitationally linked and share the same motion within a few mas yr -1 . After integration of the combined spectrophotometric spectral energy distributions, we obtain the result that the difference in the bolometric magnitudes of G 196-3 A and B is 6.15 ± 0.10 mag. Kinematic consideration of the Galactic space motions of the system for distances in the interval 15-30 pc suggests that the pair is a likely member of the Local Association and that it lies near the past positions of young star clusters like α Persei less than 85 Myr ago, where the binary might have originated. At these young ages, the mass of G 196-3 B would be in the range 12-25 M Jup , close to the frontier between planets and brown dwarfs.
Down-regulation of microRNA-196a in the sera and involved skin of localized scleroderma patients.
Makino, Takamitsu; Jinnin, Masatoshi; Etoh, Mitsuhiko; Yamane, Keitaro; Kajihara, Ikko; Makino, Katsunari; Ichihara, Asako; Igata, Toshikatsu; Sakai, Keisuke; Fukushima, Satoshi; Ihn, Hironobu
2014-01-01
Localized scleroderma (LSc) exhibits fibrosis of the skin and subcutaneous tissue. LSc shows an excessive deposition of type 1 collagen. To elucidate the mechanism of type 1 collagen overexpression in LSc, we investigated the epigenetics, focusing on microRNA (miRNA). miRNA expression profile was determined by PCR array analysis. The expression of microRNA-196a (miR-196a) in the skin tissue was examined by in situ hybridization or real-time PCR. The serum levels of miR-196a were measured by real-time PCR. PCR array analysis demonstrated that the miR-196a level was markedly decreased in LSc skin tissue in vivo. The transfection of specific inhibitor for miR-196a into normal cultured human dermal fibroblasts led to the up-regulation of type 1 collagen protein in vitro. Furthermore, the serum levels of miR-196a were significantly decreased in LSc patients. Down-regulation of miR-196a and subsequent overexpression of type 1 collagen in dermal fibroblasts may play a key role in the pathogenesis of LSc. The serum levels of miR-196a may be useful as a diagnostic marker of LSc.
Gold monetization and gold discipline
Robert P. Flood; Peter M. Garber
1981-01-01
The paper is a study of the price level and relative price effects of a policy to monetize gold and fix its price at a given future time and at the then prevailing nominal price. Price movements are analyzed both during the transition to the gold standard and during the post-monetization period. The paper also explores the adjustments to fiat money which are necessary to ensure that this type of gold monetization is non-inflationary. Finally, some conditions which produce a run on the governm...
Phenotype-gene: 196 [Arabidopsis Phenome Database[Archive
Lifescience Database Archive (English)
Full Text Available 196 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1194i decreased sensitivity under influence... http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u17347412i decreased sensitivity under influence o
Coal-gold agglomeration: an alternative separation process in gold recovery
Energy Technology Data Exchange (ETDEWEB)
Akcil, A.; Wu, X.Q.; Aksay, E.K. [Suleyman Demirel University, Isparta (Turkey). Dept. of Mining Engineering
2009-07-01
Considering the increasing environmental concerns and the potential for small gold deposits to be exploited in the future, the uses of environmentally friendly processes are essential. Recent developments point to the potential for greatly increased plant performance through a separation process that combines the cyanide and flotation processes. In addition, this kind of alternative treatment processes to the traditional gold recovery processes may reduce the environmental risks of present small-scale gold mining. Gold recovery processes that applied to different types of gold bearing ore deposits show that the type of deposits plays an important role for the selection of mineral processing technologies in the production of gold and other precious metals. In the last 25 years, different alternative processes have been investigated on gold deposits located in areas where environmental issues are a great concern. In 1988, gold particles were first recovered by successful pilot trial of coal-gold agglomeration (CGA) process in Australia. The current paper reviews the importance of CGA in the production of gold ore and identifies areas for further development work.
Phage based green chemistry for gold ion reduction and gold retrieval.
Setyawati, Magdiel I; Xie, Jianping; Leong, David T
2014-01-22
The gold mining industry has taken its toll on the environment, triggering the development of more environmentally benign processes to alleviate the waste load release. Here, we demonstrate the use of bacteriophages (phages) for biosorption and bioreduction of gold ions from aqueous solution, which potentially can be applied to remediate gold ions from gold mining waste effluent. Phage has shown a remarkably efficient sorption of gold ions with a maximum gold adsorption capacity of 571 mg gold/g dry weight phage. The product of this phage mediated process is gold nanocrystals with the size of 30-630 nm. Biosorption and bioreduction processes are mediated by the ionic and covalent interaction between gold ions and the reducing groups on the phage protein coat. The strategy offers a simple, ecofriendly and feasible option to recover of gold ions to form readily recoverable products of gold nanoparticles within 24 h.
2010-06-01
... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [Docket T-2-2010] Foreign-Trade Zone 196 Temporary/Interim Manufacturing Authority ATC Logistics & Electronics (Cell Phone Kitting and Distribution... filed an application submitted by the ATC Logistics & Electronics, operator of Site 2, FTZ 196...
31 CFR 100.4 - Gold coin and gold certificates in general.
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Gold coin and gold certificates in... EXCHANGE OF PAPER CURRENCY AND COIN In General § 100.4 Gold coin and gold certificates in general. Gold coins, and gold certificates of the type issued before January 30, 1934, are exchangeable, as provided...
Gold and gold working in Late Bronze Age Northern Greece
Vavelidis, M.; Andreou, S.
2008-04-01
Numerous objects of gold displaying an impressive variety of types and manufacturing techniques are known from the Late Bronze Age (LBA) contexts of Mycenaean Greece, but very little is known about the origin and processing of gold during the second millennium b.c. Ancient literature and recent research indicate that northern Greece is probably the richest gold-bearing region in Greece, and yet, very little evidence exists regarding the exploitation of its deposits and the production as well as use of gold in the area during prehistory. The unusual find of a group of small stone crucibles at the prehistoric settlement of Thessaloniki Toumba, one with visible traces of gold melting, proves local production and offers a rare opportunity to examine the process of on-site gold working. Furthermore, the comparison of the chemical composition of prehistoric artefacts from two settlements with those of gold deposits in their immediate areas supports the local extraction of gold and opens up the prospect for some of the Mycenaean gold to have originated in northern Greece. The scarcity of gold items in northern Greek LBA contexts may not represent the actual amount of gold produced and consumed, but could be a result of the local social attitudes towards the circulation and deposition of artefacts from precious metals.
DEFF Research Database (Denmark)
Raaballe, J.; Grundy, B.D.
2002-01-01
Based on standard option pricing arguments and assumptions (including no convenience yield and sustainable property rights), we will not observe operating gold mines. We find that asymmetric information on the reserves in the gold mine is a necessary and sufficient condition for the existence...... of operating gold mines. Asymmetric information on the reserves in the mine implies that, at a high enough price of gold, the manager of high type finds the extraction value of the company to be higher than the current market value of the non-operating gold mine. Due to this under valuation the maxim of market...
Laser spectroscopy of neutron deficient gold and platinum isotopes
International Nuclear Information System (INIS)
Savard, G.
1988-03-01
A new method for on-line laser spectroscopy of radioactive atoms based on the resonant ionization spectroscopy of laser-desorbed radioactive samples has been devised. An experimental setup has been installed on-line at the ISOCELE mass separator in Orsay (France) and experiments have been performed on the region of transitional nuclei around Z=79. Isotopic shift measurements on four new isotopes 194 Au, 196 Au, 198 Au, 199 Au have been performed on gold and results on the neutron deficient isotopes down to 186 Au have been obtained confirming the nuclear ground-state shape transition from oblate to prolate between 187 Au and 186 Au. The first isotopic shift measurements on radioactive platinum isotopes have been obtained on 186 Pt, 188 Pt, 189 Pt. Indications of a shape transition have been observed between 186 Pt and 188 Pt. The extracted experimental changes in mean square charge radii δ 2 > A,A' along isotopic chains are compared to self-consistent Hartree-Fock plus BCS calculations
The onset collectivity in {sup 196}Po
Energy Technology Data Exchange (ETDEWEB)
Bernstein, L A; Cizewski, J A; Jin, H Q; Henry, R G; Farris, L P [Rutgers--the State Univ., New Brunswick, NJ (United States); Khoo, T L; Carpenter, M P; Janssens, R V.F.; Lauritsen, T [Argonne National Lab., IL (United States); Bearden, I G [Purdue Univ., Lafayette, IN (United States); Ye, D [Notre Dame Univ., IN (United States)
1992-08-01
We have studied the in-beam {gamma}-ray spectroscopy of {sup 196}Po, which is the first Po isotope to exhibit collective vibrational structure. The onset of collective motion occurs in this isotope because of the large overlap between valence protons in h{sub 9/2} and valence neutrons in i{sub 13/2} orbitals. (author). 7 refs., 2 tabs., 3 figs.
Gold Nanoparticles Obtained by Bio-precipitation from Gold(III) Solutions
International Nuclear Information System (INIS)
Gardea-Torresdey, J.L.; Tiemann, K.J.; Gamez, G.; Dokken, K.; Tehuacanero, S.; Jose-Yacaman, M.
1999-01-01
The use of metal nanoparticles has shown to be very important in recent industrial applications. Currently gold nanoparticles are being produced by physical methods such as evaporation. Biological processes may be an alternative to physical methods for the production of gold nanoparticles. Alfalfa biomass has shown to be effective at passively binding and reducing gold from solutions containing gold(III) ions and resulting in the formation of gold(0) nanoparticles. High resolution microscopy has shown that five different types of gold particles are present after reaction with gold(III) ions with alfalfa biomass. These particles include: fcc tetrahedral, hexagonal platelet, icosahedral multiple twinned, decahedral multiple twinned, and irregular shaped particles. Further analysis on the frequency of distribution has shown that icosahedral and irregular particles are more frequently formed. In addition, the larger particles observed may be formed through the coalescence of smaller particles. Through modification of the chemical parameters, more uniform particle size distribution may be obtained by the alfalfa bio-reduction of gold(III) from solution
Size fraction assaying of gold bearing rocks (for gold extraction) by ...
African Journals Online (AJOL)
A novel method has been developed for processing and extraction of gold from gold bearing rocks for use by small-scale gold miners in Ghana. The methodology involved crushing of gold bearing hard rocks to fine particles to form a composite sample and screening at a range of sizes. Gold distribution in the composite ...
International Nuclear Information System (INIS)
Hecht, Emelia; Zago, Michela; Sarill, Miles; Rico de Souza, Angela; Gomez, Alvin; Matthews, Jason; Hamid, Qutayba; Eidelman, David H.; Baglole, Carolyn J.
2014-01-01
The aryl hydrocarbon receptor (AhR) is a ligand-activated transcription factor implicated in the regulation of apoptosis and proliferation. Although activation of the AhR by xenobiotics such as dioxin inhibits the cell cycle and control apoptosis, paradoxically, AhR expression also promotes cell proliferation and survival independent of exogenous ligands. The microRNA (miRNA) miR-196a has also emerged as a regulator of proliferation and apoptosis but a relationship between the AhR and miR-196a is not known. Therefore, we hypothesized that AhR-dependent regulation of endogenous miR-196a expression would promote cell survival and proliferation. Utilizing lung fibroblasts from AhR deficient (AhR −/− ) and wild-type (AhR +/+ ) mice, we show that there is ligand-independent regulation of miRNA, including low miR-196a in AhR −/− cells. Validation by qRT-PCR revealed a significant decrease in basal expression of miR-196a in AhR −/− compared to AhR +/+ cells. Exposure to AhR agonists benzo[a]pyrene (B[a]P) and FICZ as well as AhR antagonist CH-223191 decreased miR-196a expression in AhR +/+ fibroblasts concomitant with decreased AhR protein levels. There was increased proliferation only in AhR +/+ lung fibroblasts in response to serum, corresponding to a decrease in p27 KIP1 protein, a cyclin-dependent kinase inhibitor. Increasing the cellular levels of miR-196a had no effect on proliferation or expression of p27 KIP1 in AhR −/− fibroblasts but attenuated cigarette smoke-induced apoptosis. This study provides the first evidence that AhR expression is essential for the physiological regulation of cellular miRNA levels- including miR-196a. Future experiments designed to elucidate the functional relationship between the AhR and miR-196a may delineate additional novel ligand-independent roles for the AhR. - Highlights: • The AhR controls proliferation and apoptosis in lung cells. • The AhR regulates the expression of the microRNA miR-196a independent of
Directory of Open Access Journals (Sweden)
Daniel J White
Full Text Available The EVI1 (ecotropic viral integration site 1 gene at 3q26 codes for a transcriptional regulator with an essential role in haematopoiesis. Overexpression of EVI1 in acute myeloid leukaemia (AML is frequently associated with 3q26 rearrangements and confers extremely poor prognosis. EVI1 mediates transcriptional regulation, signalling, and epigenetic modifications by interacting with DNA, proteins and protein complexes. To explore to what extent protein phosphorylation impacts on EVI1 functions, we analysed endogenous EVI1 protein from a high EVI1 expressing Fanconi anaemia (FA derived AML cell line. Mass spectrometric analysis of immunoprecipitated EVI1 revealed phosphorylation at serine 196 (S196 in the sixth zinc finger of the N-terminal zinc finger domain. Mutated EVI1 with an aspartate substitution at serine 196 (S196D, which mimics serine phosphorylation of this site, exhibited reduced DNA-binding and transcriptional repression from a gene promotor selectively targeted by the N-terminal zinc finger domain. Forced expression of the S196D mutant significantly reduced EVI1 mediated transformation of Rat1 fibroblasts. While EVI1-mediated serial replating of murine haematopoietic progenitors was maintained by EVI1-S196D, this was associated with significantly higher Evi1-trancript levels compared with WT-EVI1 or EVI1-S196A, mimicking S196 non-phosphorylated EVI1. These data suggest that EVI1 function is modulated by phosphorylation of the first zinc finger domain.
Joseph G. Haubrich
1998-01-01
The price of gold commands attention because it serves as an indicator of general price stability or inflation. But gold is also a commodity, used in jewelry and by industry, so demand and supply affect its pricing and need to be considered when gold is a factor in monetary policy decisions.
Zagadnienie uczuć religijnych w kontekście art. 196 Kodeksu karnego
Directory of Open Access Journals (Sweden)
Barbara Tryka
2017-01-01
Full Text Available The article analyzes religious feelings in the context of criminal offence against religious feelings in the face of philosophical, psychological and juridical interpretations. According to Article 196 of the Polish Criminal Code from 1997 religious feelings are regarded as protected goods. However, the mentioned term has not been clearly defined, which provokes controversies in legal circles. The paper indicates the exact nature of religious feelings and their relation to religious beliefs. The author argues that Article 196 unnecessarily focuses on the offence of feelings rather than the defence of religion in the public sphere. The application of the expression religious feelings to the Criminal Code grants vast possibilities of its understanding and causes numerous over interpretations of Article 196. To avoid that confusion the law ought to circumscribe the extent to which religion can be protected. The inquiry into specific cases of offence against religious feelings must not be based on the subjective experience of the offended victim because one will never find the ultimate criterion to assess whether someone has actually been hurt. After the prohibited activities/possible offences against religion are defined, the behavior of the offender should be the main point of reference. A propounded amendment might generate other problems such as, for example, the transgression/violation of the neutrality of the state; therefore, Article 196 in its current meaning is unacceptable. Consequently, the religious feelings term should be clarified or removed.
Camargo, Gabriel C; Erthal, Fernanda; Sabioni, Leticia; Penna, Filipe; Strecker, Ralph; Schmidt, Michaela; Zenge, Michael O; Lima, Ronaldo de S L; Gottlieb, Ilan
2017-05-01
Segmented cine imaging with a steady-state free-precession sequence (Cine-SSFP) is currently the gold standard technique for measuring ventricular volumes and mass, but due to multi breath-hold (BH) requirements, it is prone to misalignment of consecutive slices, time consuming and dependent on respiratory capacity. Real-time cine avoids those limitations, but poor spatial and temporal resolution of conventional sequences has prevented its routine application. We sought to examine the accuracy and feasibility of a newly developed real-time sequence with aggressive under-sampling of k-space using sparse sampling and iterative reconstruction (Cine-RT). Stacks of short-axis cines were acquired covering both ventricles in a 1.5T system using gold standard Cine-SSFP and Cine-RT. Acquisition parameters for Cine-SSFP were: acquisition matrix of 224×196, temporal resolution of 39ms, retrospective gating, with an average of 8 heartbeats per slice and 1-2 slices/BH. For Cine-RT: acquisition matrix of 224×196, sparse sampling net acceleration factor of 11.3, temporal resolution of 41ms, prospective gating, real-time acquisition of 1 heart-beat/slice and all slices in one BH. LV contours were drawn at end diastole and systole to derive LV volumes and mass. Forty-one consecutive patients (15 male; 41±17years) in sinus rhythm were successfully included. All images from Cine-SSFP and Cine-RT were considered to have excellent quality. Cine-RT-derived LV volumes and mass were slightly underestimated but strongly correlated with gold standard Cine-SSFP. Inter- and intra-observer analysis presented similar results between both sequences. Cine-RT featuring sparse sampling and iterative reconstruction can achieve spatial and temporal resolution equivalent to Cine-SSFP, providing excellent image quality, with similar precision measurements and highly correlated and only slightly underestimated volume and mass values. Copyright © 2017 Elsevier Inc. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Hecht, Emelia [Department of Medicine, McGill University, Montreal, Quebec (Canada); Zago, Michela [Research Institute of the McGill University Health Centre, McGill University, Montreal, Quebec (Canada); Sarill, Miles [Department of Medicine, McGill University, Montreal, Quebec (Canada); Rico de Souza, Angela [Research Institute of the McGill University Health Centre, McGill University, Montreal, Quebec (Canada); Gomez, Alvin; Matthews, Jason [Department of Pharmacology and Toxicology, University of Toronto, Toronto, ON (Canada); Hamid, Qutayba; Eidelman, David H. [Department of Medicine, McGill University, Montreal, Quebec (Canada); Research Institute of the McGill University Health Centre, McGill University, Montreal, Quebec (Canada); Baglole, Carolyn J., E-mail: Carolyn.baglole@McGill.ca [Department of Medicine, McGill University, Montreal, Quebec (Canada); Research Institute of the McGill University Health Centre, McGill University, Montreal, Quebec (Canada)
2014-11-01
The aryl hydrocarbon receptor (AhR) is a ligand-activated transcription factor implicated in the regulation of apoptosis and proliferation. Although activation of the AhR by xenobiotics such as dioxin inhibits the cell cycle and control apoptosis, paradoxically, AhR expression also promotes cell proliferation and survival independent of exogenous ligands. The microRNA (miRNA) miR-196a has also emerged as a regulator of proliferation and apoptosis but a relationship between the AhR and miR-196a is not known. Therefore, we hypothesized that AhR-dependent regulation of endogenous miR-196a expression would promote cell survival and proliferation. Utilizing lung fibroblasts from AhR deficient (AhR{sup −/−}) and wild-type (AhR{sup +/+}) mice, we show that there is ligand-independent regulation of miRNA, including low miR-196a in AhR{sup −/−} cells. Validation by qRT-PCR revealed a significant decrease in basal expression of miR-196a in AhR{sup −/−} compared to AhR{sup +/+} cells. Exposure to AhR agonists benzo[a]pyrene (B[a]P) and FICZ as well as AhR antagonist CH-223191 decreased miR-196a expression in AhR{sup +/+} fibroblasts concomitant with decreased AhR protein levels. There was increased proliferation only in AhR{sup +/+} lung fibroblasts in response to serum, corresponding to a decrease in p27{sup KIP1} protein, a cyclin-dependent kinase inhibitor. Increasing the cellular levels of miR-196a had no effect on proliferation or expression of p27{sup KIP1} in AhR{sup −/−} fibroblasts but attenuated cigarette smoke-induced apoptosis. This study provides the first evidence that AhR expression is essential for the physiological regulation of cellular miRNA levels- including miR-196a. Future experiments designed to elucidate the functional relationship between the AhR and miR-196a may delineate additional novel ligand-independent roles for the AhR. - Highlights: • The AhR controls proliferation and apoptosis in lung cells. • The AhR regulates the
HPV16 early gene E5 specifically reduces miRNA-196a in cervical cancer cells
Liu, Chanzhen; Lin, Jianfei; Li, Lianqin; Zhang, Yonggang; Chen, Weiling; Cao, Zeyi; Zuo, Huancong; Chen, Chunling; Kee, Kehkooi
2015-01-01
High-risk human papillomavirus (HPV) type 16, which is responsible for greater than 50% of cervical cancer cases, is the most prevalent and lethal HPV type. However, the molecular mechanisms of cervical carcinogenesis remain elusive, particularly the early steps of HPV infection that may transform normal cervical epithelium into a pre-neoplastic state. Here, we report that a group of microRNAs (microRNAs) were aberrantly decreased in HPV16-positive normal cervical tissues, and these groups of microRNAs are further reduced in cervical carcinoma. Among these miRNAs, miR196a expression is the most reduced in HPV16-infected tissues. Interestingly, miR196a expression is low in HPV16-positive cervical cancer cell lines but high in HPV16-negative cervical cancer cell lines. Furthermore, we found that only HPV16 early gene E5 specifically down-regulated miRNA196a in the cervical cancer cell lines. In addition, HoxB8, a known miR196a target gene, is up-regulated in the HPV16 cervical carcinoma cell line but not in HPV18 cervical cancer cell lines. Various doses of miR196a affected cervical cancer cell proliferation and apoptosis. Altogether, these results suggested that HPV16 E5 specifically down-regulates miR196a upon infection of the human cervix and initiates the transformation of normal cervix cells to cervical carcinoma. PMID:25563170
Energy Technology Data Exchange (ETDEWEB)
Lemogne, A [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1965-06-01
Tensile stress tests been carried out at low temperatures (between 20 C and -196 C) on monocrystalline and polycrystalline uranium of various purities. The mechanical properties of the monocrystals have been related, at all temperatures, to plastic flow mechanisms. Below -100 C brittle fracture occurs on the planes making up the twins. A detailed study of the plastic behaviour at -196 C has made it possible to show that all the twin planes except the [176] plane were liable to become privileged planes for brittle fracture. The mechanical properties of the polycrystals, the breaking stress and the elongation at breaking point, decrease as the temperature decreases from 20 to -196 C; they undergo a transition however - not to be confused with the ductile-brittle transition - whose position and strength depend on the grain size and on the purity. It has been verified also that Petch's law is approximately applicable to the plastic flow and rupture stresses; a study has also been made of the influence of temperature and purity on the constants occurring in this equation. Finally, experiments at -196 C on the deformation up to breaking point of polycrystalline samples cold-worked at 20 C have shown the importance of the role played by intergranular cracks in the plastic behaviour of uranium. (author) [French] Des essais de traction ont ete realises a basse temperature (entre 20 C et -196 C, sur des monocristaux et des polycristaux d'uranium de differentes puretes. Les proprietes mecaniques des monocristaux ont ete reliees, a toutes temperatures, aux mecanismes d'ecoulement plastique. Une rupture fragile intervient a partir de -100 C sur les plans de composition de macle. L'etude detaillee du comportement plastique a -196 C a permis de preciser que tous les plans de macle, sauf [176], etaient susceptibles de devenir des plans de rupture fragile privilegies. Les proprietes mecaniques des polycristaux, contrainte de rupture et allongement a la rupture, decroissent quand on
Gold 100: proceedings of the international conference on gold. V. 2
International Nuclear Information System (INIS)
Fivaz, C.E.; King, R.P.
1986-01-01
The proceedings of Gold 100 have been published in three separate volumes. The first deals with the mining of gold, the second with the extractive metallurgy of gold, and the third with industrial uses of gold. In this second volume, the papers on extractive metallurgy presented at the Conference reflect most of the problems that are currently of significant technical interest to the industry. This volume is divided in six main parts covering plant design, carbon-in-pulp technology, refractory gold, new technology, grinding and concentration, and leaching. The part on new technology includes papers on x-ray fluorescence analyzers, Moessbauer spectroscopy and leaching processes for uranium, while the part on grinding and concentration includes papers on nuclear and radiotracer techniques for the recovery of gold as well as various flotation parameters in the flotation behaviour of gold and uranium
Paper Money but a Gold Debt. Italy in the Gold Standard
Giuseppe Tattara; or consequences)
2002-01-01
During the 52 years between the Unification of the Kingdom of Italy and World War 1, the lira was legally convertible into metal for a limited period of time. Although not formally committed to gold, the lira exchange towards the gold standard countries proved remarkably stable, \\223shadowing\\224 gold. It is widely claimed that being one of the successful members of the gold standard circle entailed a number of advantages. If the lira was closely linked to gold, suggesting that there was only...
37 CFR 2.196 - Times for taking action: Expiration on Saturday, Sunday or Federal holiday.
2010-07-01
...: Expiration on Saturday, Sunday or Federal holiday. 2.196 Section 2.196 Patents, Trademarks, and Copyrights... Saturday, Sunday or Federal holiday. Whenever periods of time are specified in this part in days, calendar... taking any action or paying any fee in the Office falls on a Saturday, Sunday, or Federal holiday within...
GOLD IS EARNED FROM THE PRODUCTION OF THAI GOLD LEAF
Directory of Open Access Journals (Sweden)
Dirk Bax
2010-06-01
Full Text Available Thai people like to cover sacred objects or things dear to them with gold leaf.. Statues of Buddha are sometimes covered with so many layers of gold leaf that they become formless figures, that can hardly be recognized. Portraits of beloved ancestors, statues of elephants and grave tombs are often covered with gold leaf. If one considers the number of Thai people and the popularity of the habit, the amount of gold involved could be considerable.
MicroRNA-196a is a putative diagnostic biomarker and therapeutic target for laryngeal cancer.
Directory of Open Access Journals (Sweden)
Koichiro Saito
Full Text Available BACKGROUND: MicroRNA (miRNA is an emerging subclass of small non-coding RNAs that regulates gene expression and has a pivotal role for many physiological processes including cancer development. Recent reports revealed the role of miRNAs as ideal biomarkers and therapeutic targets due to their tissue- or disease-specific nature. Head and neck cancer (HNC is a major cause of cancer-related mortality and morbidity, and laryngeal cancer has the highest incidence in it. However, the molecular mechanisms involved in laryngeal cancer development remain to be known and highly sensitive biomarkers and novel promising therapy is necessary. METHODOLOGY/PRINCIPAL FINDINGS: To explore laryngeal cancer-specific miRNAs, RNA from 5 laryngeal surgical specimens including cancer and non-cancer tissues were hybridized to microarray carrying 723 human miRNAs. The resultant differentially expressed miRNAs were further tested by using quantitative real time PCR (qRT-PCR on 43 laryngeal tissue samples including cancers, noncancerous counterparts, benign diseases and precancerous dysplasias. Significant expressional differences between matched pairs were reproduced in miR-133b, miR-455-5p, and miR-196a, among which miR-196a being the most promising cancer biomarker as validated by qRT-PCR analyses on additional 84 tissue samples. Deep sequencing analysis revealed both quantitative and qualitative deviation of miR-196a isomiR expression in laryngeal cancer. In situ hybridization confirmed laryngeal cancer-specific expression of miR-196a in both cancer and cancer stroma cells. Finally, inhibition of miR-196a counteracted cancer cell proliferation in both laryngeal cancer-derived cells and mouse xenograft model. CONCLUSIONS/SIGNIFICANCE: Our study provided the possibilities that miR-196a might be very useful in diagnosing and treating laryngeal cancer.
Enhancement of gold recovery using bioleaching from gold concentrate
Choi, S. H.; Cho, K. H.; Kim, B. J.; Choi, N. C.; Park, C. Y.
2012-04-01
The gold in refractory ores is encapsulated as fine particles (sometimes at a molecular level) in the crystal structure of the sulfide (typically pyrite with or without arsenopyrite) matrix. This makes it impossible to extract a significant amount of refractory gold by cyanidation since the cyanide solution cannot penetrate the pyrite/arsenopyrite crystals and dissolve gold particles, even after fine grinding. To effectively extract gold from these ores, an oxidative pretreatment is necessary to break down the sulfide matrix. The most popular methods of pretreatment include nitric acid oxidation, roasting, pressure oxidation and biological oxidation by microorganisms. This study investigated the bioleaching efficiency of Au concentrate under batch experimental conditions (adaptation cycles and chemical composition adaptation) using the indigenous acidophilic bacteria collected from gold mine leachate in Sunsin gold mine, Korea. We conducted the batch experiments at two different chemical composition (CuSO4 and ZnSO4), two different adaptation cycles 1'st (3 weeks) and 2'nd (6 weeks). The results showed that the pH in the bacteria inoculating sample decreased than initial condition and Eh increased. In the chemical composition adaptation case, the leached accumulation content of Fe and Pb was exhibited in CuSO4 adaptation bacteria sample more than in ZnSO4 adaptation bacteria samples, possibly due to pre-adaptation effect on chalcopyrite (CuFeS2) in gold concentrate. And after 21 days on the CuSO4 adaptation cycles case, content of Fe and Pb was appeared at 1'st adaptation bacteria sample(Fe - 1.82 and Pb - 25.81 times per control sample) lower than at 2'nd adaptation bacteria sample(Fe - 2.87 and Pb - 62.05 times per control sample). This study indicates that adaptation chemical composition and adaptation cycles can play an important role in bioleaching of gold concentrate in eco-/economic metallurgy process.
Enrichment of Gold in Antimony Matte by Direct Smelting of Refractory Gold Concentrate
Yang, Tianzu; Xie, Boyi; Liu, Weifeng; Zhang, Duchao; Chen, Lin
2018-06-01
Conventional cyanidation technology achieves low gold recovery when used to process refractory gold concentrate. Based on the geochemical characteristics of gold deposit mineralization, a new method is proposed herein for gold enrichment in antimony matte by smelting of refractory gold concentrate. The effects of the FeO/SiO2 and CaO/SiO2 ratios, smelting temperature, and smelting time on the gold recovery were investigated in detail. The optimum conditions were determined to be FeO/SiO2 ratio of 1.2, CaO/SiO2 ratio of 0.4, smelting temperature of 1200°C, and smelting time of 45 min. The gold content in antimony matte and smelting slag was 96.68 and 1.13 g/t, respectively. The gold, antimony, and arsenic recovery was 97.72%, 26.89%, and 6.56%, respectively, with most of the antimony and arsenic volatilized into dust. Mineral liberation analyzer results showed that the antimony matte mainly consisted of FeS and FeO, with three phases, viz. FeAs, SbAs, and AuSb, embedded between them, indicating that gold was easily enriched with antimony and arsenic during smelting of refractory gold concentrate.
Enrichment of Gold in Antimony Matte by Direct Smelting of Refractory Gold Concentrate
Yang, Tianzu; Xie, Boyi; Liu, Weifeng; Zhang, Duchao; Chen, Lin
2018-04-01
Conventional cyanidation technology achieves low gold recovery when used to process refractory gold concentrate. Based on the geochemical characteristics of gold deposit mineralization, a new method is proposed herein for gold enrichment in antimony matte by smelting of refractory gold concentrate. The effects of the FeO/SiO2 and CaO/SiO2 ratios, smelting temperature, and smelting time on the gold recovery were investigated in detail. The optimum conditions were determined to be FeO/SiO2 ratio of 1.2, CaO/SiO2 ratio of 0.4, smelting temperature of 1200°C, and smelting time of 45 min. The gold content in antimony matte and smelting slag was 96.68 and 1.13 g/t, respectively. The gold, antimony, and arsenic recovery was 97.72%, 26.89%, and 6.56%, respectively, with most of the antimony and arsenic volatilized into dust. Mineral liberation analyzer results showed that the antimony matte mainly consisted of FeS and FeO, with three phases, viz. FeAs, SbAs, and AuSb, embedded between them, indicating that gold was easily enriched with antimony and arsenic during smelting of refractory gold concentrate.
The geology of the gold deposits of Prestea gold belt of Ghana ...
African Journals Online (AJOL)
This paper presents the geology of the gold deposits along the Prestea gold belt of Ghana to assist exploration work for new orebodies along the belt. Prestea district is the third largest gold producer in West Africa after Obuasi and Tarkwa districts (over 250 metric tonnes Au during the last century). The gold deposits are ...
Gold Leaching Characteristics and Intensification of a High S and As-Bearing Gold Concentrate
Yang, Yong-bin; Liu, Xiao-liang; Jiang, Tao; Li, Qian; Xu, Bin; Zhang, Yan
Some high sulfur and arsenic-bearing gold concentrate has a gold leaching rate less than 80% by oxidation roasting-pickling-cyanidation process. The characteristics and intensification of gold leaching were studied systemically. By combining chemical composition and phase analysis, the low gold leaching rate was found to lie in the capsulation of gold by iron-containing phases including iron oxides, arsenopyrite and pyrite. 96.66% of gold in the industrial leaching residue was capsulated and 95.88% of the capsulated turned out to be in the iron-containing phases. The results of laboratory pickling-cyanidation experiments on the calcine and industrial leaching residue presented further demonstration for the fact that gold capsulated in the iron-containing phases was hard to be leached. However, the gold cyanide leaching rate of calcine could be raised over 95% by a reduction roasting-pickling pretreatment which played such a significant role in exposing the capsulated gold that gold leaching was intensified remarkably.
Oxidation state of gold and arsenic in gold-bearing arsenian pyrite
Energy Technology Data Exchange (ETDEWEB)
Simon, G.; Huang, H.; Penner-Hahn, J.E.; Kesler, S.E.; Kao, L.S. [Univ. of Michigan, Ann Arbor, MI (United States)
1999-07-01
XANES measurements on gold-bearing arsenian pyrite from the Twin Creeks Carlin-type gold deposits show that gold is present as both Au{sup 0} and Au{sup 1+} and arsenic is present as As{sup 1{minus}}. Au{sup 0} is attributed to sub-micrometer size inclusions of free gold, whereas Au{sup 1+} is attributed to gold in the lattice of the arsenian pyrite. STEM observations suggest that As{sup 1{minus}} is probably concentrated in angstrom-scale, randomly distributed layers with a marcasite or arsenopyrite structure. Ionic gold (Au{sup 1+}) could be concentrated in these layers as well, and is present in both twofold- and fourfold-coordinated forms, with fourfold-coordinated Au{sup 1+} more abundant. Twofold-coordinated Au{sup 1+} is similar to gold in Au{sub 2}S in which it is linearly coordinated to two sulfur atoms. The nature of fourfold-coordinated Au{sup 1+} is not well understood, although it might be present as an Au-As-S compound where gold is bonded in fourfold coordination to sulfur and arsenic atoms, or in vacancy positions on a cation site in the arsenian pyrite. Au{sup 1+} was probably incorporated into arsenian pyrite by adsorption onto pyrite surfaces during crystal growth. The most likely compound in the case of twofold-coordinated Au{sup 1+} was probably a tri-atomic surface complex such as S{sub pyrite}-Au{sup 1+}-S{sub bi-sulfide}H or Au{sup 1+}-S-Au{sup 1+}. The correlation between gold and arsenic might be related to the role of arsenic in enhancing the adsorption of gold complexes of this type on pyrite surfaces, possibly through semiconductor effects.
Yang, Guang
2014-01-23
BackgroundRecent studies have revealed that miR-196a is upregulated in glioblastoma multiforme (GBM) and that it correlates with the clinical outcome of patients with GBM. However, its potential regulatory mechanisms in GBM have never been reported.MethodsWe used quantitative real-time PCR to assess miR-196a expression levels in 132 GBM specimens in a single institution. Oncogenic capability of miR-196a was detected by apoptosis and proliferation assays in U87MG and T98G cells. Immunohistochemistry was used to determine the expression of IκBα in GBM tissues, and a luciferase reporter assay was carried out to confirm whether IκBα is a direct target of miR-196a. In vivo, xenograft tumors were examined for an antiglioma effect of miR-196a inhibitors.ResultsWe present for the first time evidence that miR-196a could directly interact with IκBα 3′-UTR to suppress IκBα expression and subsequently promote activation of NF-κB, consequently promoting proliferation of and suppressing apoptosis in GBM cells both in vitro and in vivo. Our study confirmed that miR-196a was upregulated in GBM specimens and that high levels of miR-196a were significantly correlated with poor outcome in a large cohort of GBM patients. Our data from human tumor xenografts in nude mice treated with miR-196 inhibitors demonstrated that inhibition of miR-196a could ameliorate tumor growth in vivo.ConclusionsMiR-196a exerts its oncogenic effect in GBM by inhibiting IκBα both in vitro and in vivo. Our findings provide new insights into the pathogenesis of GBM and indicate that miR-196a may predict clinical outcome of GBM patients and serve as a new therapeutic target for GBM. © 2014 © The Author(s) 2014. Published by Oxford University Press on behalf of the Society for Neuro-Oncology. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Robert J. Barro; Sanjay P. Misra
2013-01-01
From 1836 to 2011, the average real rate of price change for gold in the United States is 1.1% per year and the standard deviation is 13.1%, implying a one-standard-deviation confidence band for the mean of (0.1%, 2.1%). The covariances of gold's real rate of price change with consumption and GDP growth rates are small and statistically insignificantly different from zero. These negligible covariances suggest that gold's expected real rate of return--which includes an unobserved dividend yiel...
Coal-oil gold agglomeration assisted flotation to recover gold from refractory ore
Otsuki, A.; Yue, C.
2017-07-01
This study aimed to investigate the applicability of coal-oil gold agglomeration (CGA) assisted flotation to recover gold from a refractory ore. The ore with the grade of 2-5 g/t was tested with the CGA-flotation process in six different size fractions from 38 to 300 urn using different collector types and dosages. In addition, the flotation without CGA was performed under the same condition for comparison. The results showed that the higher gold grade and recovery were achieved by applying the CGA-flotation, compared with the flotation without CGA. More than 20-60 times grade increase from the head grade was obtained with CGA-flotation. The elemental analysis of gold and sulphur explained their relationship with gold recovery. The results well indicated the applicability of CGA to upgrade the refractory gold ore.
Gold and gold-copper nanoparticles in 2-propanol: A radiation chemical study
International Nuclear Information System (INIS)
Dey, G.R.
2011-01-01
The studies on the reduction of Au 3+ to gold nanoparticles in presence and absence of Cu 2+ under deoxygenated conditions in 2-propanol by radiolytic method have been carried out. On γ-radiolysis, preliminary yellow colored solution of Au 3+ changed to purple color owing to gold nanoparticles formation, which exhibits an absorption peak at around 540 nm. In the presence of Cu 2+ , absorption of gold-copper nanoparticles, which was also produced during γ-radiolysis, was red shifted in contrast to the system containing no Cu 2+ . Under DLS studies the sizes of gold nanoparticles in the absence and the presence of Cu 2+ were found to be larger (>400 nm). However, in presence of polyethylene glycol, a stabilizer the nanoparticle sizes became smaller, sizes measured for gold and gold-copper nanoparticles are 40 and 140 nm, respectively. Moreover, the change in UV-vis spectra in the Cu 2+ and Au 3+ mixed system highlights the formation of gold-copper nanoparticles in core-shell type arrangement. - Highlights: → Present radiation chemical study highlights high reactivity of Au ·2+ with Cu 2+ . → Absorption of gold-copper nanoparticles is blue shifted as compared to copper nanoparticles. → Change in UV-vis spectra with dose emphasizes core-shell type arrangement of Au-Cu nanoparticles.
International Nuclear Information System (INIS)
Girling, C.A.; Peterson, P.J.
1980-01-01
Many plants have the ability to take up gold from the soil and to accumulate it in their tisssue. Advances have been made in understanding these processes to the point where their exploitation in the field of prospecting for gold appears practically feasible. Neutron activation analysis is used for the determination of the small quantities of gold in plants
Koděra, Peter; Kozák, Jaroslav; Brčeková, Jana; Chovan, Martin; Lexa, Jaroslav; Jánošík, Michal; Biroň, Adrián; Uhlík, Peter; Bakos, František
2018-03-01
The Biely Vrch deposit in the Western Carpathians is assigned to the shallow, sulfide-poor porphyry gold deposit type and has an exceptionally low Cu/Au ratio. According to 3-D geochemical models, there is a limited spatial correlation between Au and Cu due to the primary introduction of gold by a salt melt and Cu by low-density vapor. Despite a rough spatial correlation of gold grades with quartz stockwork intensity, gold is hosted mostly by altered rock, exclusively in native form. Three main gold mineral assemblages were recognized here. In the deepest parts of the system, the K- and Ca-Na silicate gold assemblage is associated with minerals of high-temperature alteration (plagioclase, K-feldspar, actinolite), with gold grades and fineness depending on depth and potassium content of the host rock: K-silicate alteration hosts the lowest fineness gold ( 914), whereas Ca-Na silicate alteration has the highest ( 983). The intermediate argillic gold assemblage is the most widespread, with gold hosted mainly by chlorite, illite, smectite, and interstratified illite-chlorite-smectite minerals. The gold fineness is mostly variable (875-990) and inherited from the former gold mineral assemblages. The latest advanced argillic gold assemblage has its gold mostly in kaolinite. The extremely high fineness ( 994) results from gold remobilization by late-stage aqueous magmatic-hydrothermal fluids. Uncommon bonanza-grade appears where the earlier gold mineral assemblages were further enriched by this remobilized gold. Primary precipitation of gold occurred during ascent and cooling of salt melts at 450 to 309 °C, mostly during retrograde quartz solubility.
Moessbauer study of the chemical state of gold in gold ores
International Nuclear Information System (INIS)
Wagner, F.E.; Marion, P.H.; Regnard, J.-R.
1986-01-01
Information on the chemical state of gold in gold ores has been obtained by 197 Au Moessbauer spectroscopy in cases where the state of this element cannot be determined by such standard methods as optical or electron microscopy. Ore concentrates consisting mainly of pyrite or arsenopyrite and roasted ore and matte samples were studied. The results yielded directly the respective amounts of metallic and chemically bound gold. Unless the gold is metallic, its chemical state in the ores turns out to be different from that in the minerals studied so far as reference materials. The chemical processes taking place during various treatments of the ores, such as roasting or leaching, can also be followed by Moessbauer spectroscopy. It is hoped that Moessbauer spectroscopy will eventually facilitate the development of more efficient methods of gold extraction
Mahl, Dirk; Diendorf, Jörg; Ristig, Simon; Greulich, Christina; Li, Zi-An; Farle, Michael; Köller, Manfred; Epple, Matthias
2012-10-01
Silver, gold, and silver-gold-alloy nanoparticles were prepared by citrate reduction modified by the addition of tannin during the synthesis, leading to a reduction in particle size by a factor of three. Nanoparticles can be prepared by this easy water-based synthesis and subsequently functionalized by the addition of either tris(3-sulfonatophenyl)phosphine or poly( N-vinylpyrrolidone). The resulting nanoparticles of silver (diameter 15-25 nm), gold (5-6 nm), and silver-gold (50:50; 10-12 nm) were easily dispersable in water and also in cell culture media (RPMI + 10 % fetal calf serum), as shown by nanoparticle tracking analysis and differential centrifugal sedimentation. High-resolution transmission electron microscopy showed a polycrystalline nature of all nanoparticles. EDX on single silver-gold nanoparticles indicated that the concentration of gold is higher inside a nanoparticle. The biologic action of the nanoparticles toward human mesenchymal stem cells (hMSC) was different: Silver nanoparticles showed a significant concentration-dependent influence on the viability of hMSC. Gold nanoparticles showed only a small effect on the viability of hMSC after 7 days. Surprisingly, silver-gold nanoparticles had no significant influence on the viability of hMSC despite the silver content. Silver nanoparticles and silver-gold nanoparticles in the concentration range of 5-20 μg mL-1 induced the activation of hMSC as indicated by the release of IL-8. In contrast, gold nanoparticles led to a reduction of the release of IL-6 and IL-8.
27 CFR 25.196 - Removals for research, development or testing.
2010-04-01
... Analysis, Research, Development Or Testing § 25.196 Removals for research, development or testing. (a) A brewer may remove beer, without payment of tax, for use in research, development, or testing (other than... or brewery operations. Beer may be removed for research, development or testing in packages or in...
Gold deposit styles and placer gold characterisation in northern and east-central Madagascar
Pitfield, Peter E. J; Styles, Michael T.; Taylor, Cliff D.; Key, Roger M.; Bauer,; Ralison, A
2009-01-01
Microchemical characterisation of bedrock and placer gold grains from six gold districts within the Archaean domains and intervening Neoproterozoic Anaboriana-Manampotsy belt of northern and east-central Madagascar show few opaque inclusions (e.g pyrrhotite, Bi tellurides) but wide range of Ag contents (40wt%). Some districts exhibit multiple source populations of grains. The ‘greenstone belt’ terranes have an orogenic gold signature locally with an intrusion-related to epithermal overprint. Proterozoic metasediments with felsic to ultramafic bodies yield dominantly intrusion-related gold. A high proportion of secondary gold (<0.5wt% Ag) is related to recycling of paleoplacers and erosion of post-Gondwana planation surfaces and indicates that some mesothermal gold systems were already partially to wholly removed by erosion by the PermoTriassic.
Analysis of gold and silver concentration on gold mining tailings by neutron activation analysis
International Nuclear Information System (INIS)
Sadikov, I.I.; Salimov, M.I.; Sadykova, Z.O.
2014-01-01
Full text: Instrumental neutron-activation analysis without radiochemical separation is one of most applicable and often used methods to analyze the concentration of gold, silver and other rare and noble metals in gold ores. This method is not suitable for analyzing low concentration of gold and silver in gold mining tailings due to rather high concentration of some elements. Samples are dissolved by boiling in a mixture of concentrated hydrochloric and nitric acids to extract gold and silver into the solution. Chemical yield of gold and silver after dissolution of the sample and further chromatographic separation is between 92 and 95 percent respectively
International Nuclear Information System (INIS)
Salvadori, M. C.; Teixeira, F. S.; Araújo, W. W. R.; Sgubin, L. G.; Cattani, M.; Spirin, R. E.; Brown, I. G.
2012-01-01
We describe work in which gold nanoparticles were formed in diamond-like carbon (DLC), thereby generating a Au-DLC nanocomposite. A high-quality, hydrogen-free DLC thin film was formed by filtered vacuum arc plasma deposition, into which gold nanoparticles were introduced using two different methods. The first method was gold ion implantation into the DLC film at a number of decreasing ion energies, distributing the gold over a controllable depth range within the DLC. The second method was co-deposition of gold and carbon, using two separate vacuum arc plasma guns with suitably interleaved repetitive pulsing. Transmission electron microscope images show that the size of the gold nanoparticles obtained by ion implantation is 3-5 nm. For the Au-DLC composite obtained by co-deposition, there were two different nanoparticle sizes, most about 2 nm with some 6-7 nm. Raman spectroscopy indicates that the implanted sample contains a smaller fraction of sp 3 bonding for the DLC, demonstrating that some sp 3 bonds are destroyed by the gold implantation.
Energy Technology Data Exchange (ETDEWEB)
Mahl, Dirk; Diendorf, Joerg; Ristig, Simon [University of Duisburg-Essen, Department of Inorganic Chemistry, Center for Nanointegration Duisburg-Essen (CeNIDE) (Germany); Greulich, Christina [Ruhr-University of Bochum, Bergmannsheil University Hospital/Surgical Research (Germany); Li Zian; Farle, Michael [University of Duisburg-Essen, Faculty of Physics, Center for Nanointegration Duisburg-Essen (CeNIDE) (Germany); Koeller, Manfred [Ruhr-University of Bochum, Bergmannsheil University Hospital/Surgical Research (Germany); Epple, Matthias, E-mail: matthias.epple@uni-due.de [University of Duisburg-Essen, Department of Inorganic Chemistry, Center for Nanointegration Duisburg-Essen (CeNIDE) (Germany)
2012-10-15
Silver, gold, and silver-gold-alloy nanoparticles were prepared by citrate reduction modified by the addition of tannin during the synthesis, leading to a reduction in particle size by a factor of three. Nanoparticles can be prepared by this easy water-based synthesis and subsequently functionalized by the addition of either tris(3-sulfonatophenyl)phosphine or poly(N-vinylpyrrolidone). The resulting nanoparticles of silver (diameter 15-25 nm), gold (5-6 nm), and silver-gold (50:50; 10-12 nm) were easily dispersable in water and also in cell culture media (RPMI + 10 % fetal calf serum), as shown by nanoparticle tracking analysis and differential centrifugal sedimentation. High-resolution transmission electron microscopy showed a polycrystalline nature of all nanoparticles. EDX on single silver-gold nanoparticles indicated that the concentration of gold is higher inside a nanoparticle. The biologic action of the nanoparticles toward human mesenchymal stem cells (hMSC) was different: Silver nanoparticles showed a significant concentration-dependent influence on the viability of hMSC. Gold nanoparticles showed only a small effect on the viability of hMSC after 7 days. Surprisingly, silver-gold nanoparticles had no significant influence on the viability of hMSC despite the silver content. Silver nanoparticles and silver-gold nanoparticles in the concentration range of 5-20 {mu}g mL{sup -1} induced the activation of hMSC as indicated by the release of IL-8. In contrast, gold nanoparticles led to a reduction of the release of IL-6 and IL-8.
International Nuclear Information System (INIS)
Mahl, Dirk; Diendorf, Jörg; Ristig, Simon; Greulich, Christina; Li Zian; Farle, Michael; Köller, Manfred; Epple, Matthias
2012-01-01
Silver, gold, and silver–gold-alloy nanoparticles were prepared by citrate reduction modified by the addition of tannin during the synthesis, leading to a reduction in particle size by a factor of three. Nanoparticles can be prepared by this easy water-based synthesis and subsequently functionalized by the addition of either tris(3-sulfonatophenyl)phosphine or poly(N-vinylpyrrolidone). The resulting nanoparticles of silver (diameter 15–25 nm), gold (5–6 nm), and silver–gold (50:50; 10–12 nm) were easily dispersable in water and also in cell culture media (RPMI + 10 % fetal calf serum), as shown by nanoparticle tracking analysis and differential centrifugal sedimentation. High-resolution transmission electron microscopy showed a polycrystalline nature of all nanoparticles. EDX on single silver–gold nanoparticles indicated that the concentration of gold is higher inside a nanoparticle. The biologic action of the nanoparticles toward human mesenchymal stem cells (hMSC) was different: Silver nanoparticles showed a significant concentration-dependent influence on the viability of hMSC. Gold nanoparticles showed only a small effect on the viability of hMSC after 7 days. Surprisingly, silver–gold nanoparticles had no significant influence on the viability of hMSC despite the silver content. Silver nanoparticles and silver–gold nanoparticles in the concentration range of 5–20 μg mL −1 induced the activation of hMSC as indicated by the release of IL-8. In contrast, gold nanoparticles led to a reduction of the release of IL-6 and IL-8.
International Nuclear Information System (INIS)
Young, J.E.
1993-01-01
Gold is found in minute quantities and gold mining generates enormous amounts of waste materials and long history of environmental destruction: mercury in tailing, eroded land, and acid mine drainage are legacies of the past. The problem has become worse in recent years in North America, Australia, the Amazon basin, Philippines. This paper describes the economics of gold and the changes in the world economy which has precipitated the new gold rushes. Current technology uses a cyanide solution for leaching small amounts of gold from tons of waste, and mercury remains a toxic waste of gold mining. Both short and long term results of gold mining, on the environment and on indiginous populations are described
Ahmed A. Mohamed
2015-01-01
Basic chemistry of gold tells us that it can bond to sulfur, phosphorous, nitrogen, and oxygen donor ligands. The Frontiers in Gold Chemistry Special Issue covers gold complexes bonded to the different donors and their fascinating applications. This issue covers both basic chemistry studies of gold complexes and their contemporary applications in medicine, materials chemistry, and optical sensors. There is a strong belief that aurophilicity plays a major role in the unending applications of g...
Direct formation of gold nanorods on surfaces using polymer-immobilised gold seeds
Directory of Open Access Journals (Sweden)
Majid K. Abyaneh
2016-06-01
Full Text Available Herein, we present the formation of gold nanorods (GNRs on novel gold–poly(methyl methacrylate (Au–PMMA nanocomposite substrates with unprecedented growth control through the polymer molecular weight (Mw and gold-salt-to-polymer weight ratio. For the first time, GNRs have been produced by seed-mediated direct growth on surfaces that were pre-coated with polymer-immobilised gold seeds. A Au–PMMA nanocomposite formed by UV photoreduction has been used as the gold seed. The influence of polymer Mw and gold concentration on the formation of GNRs has been investigated and discussed. The polymer nanocomposite formed with a lower Mw PMMA and 20 wt % gold salt provides a suitable medium for growing well-dispersed GNRs. In this sample, the average dimension of produced GNRs is 200 nm in length with aspect ratios up to 10 and a distribution of GNRs to nanoparticles of nearly 22%. Suitable characterization techniques such as AFM and SEM have been used to support concept of the proposed growth method.
Moessbauerspectroscopy on Gold Ruby Glass
International Nuclear Information System (INIS)
Haslbeck, S.
2005-01-01
In this thesis, the chemical states of gold and the physical mechanisms of the growing process of the particles under the influence of additional ingredients like tin, lead, antimony and selenium before, during and after the colouring process are investigated by using the Moessbauer spectroscopy on 197 Au, 119 Sn and 121 Sb, optical spectroscopy and X-ray-diffraction. Gold in an unnealed, colourless state of the glasses consists of monovalent forming linear bonds to two neighbouring oxygen atoms. The Lamb-Moessbauer factor of these gold oxide bondings is observed as 0.095 at 4.2 K. The gold in it's oxide state transforms to gold particles with a diameter of 3 nm to 60 nm. The size of the gold particles is quite definable within the optical spectra and certain sizes are also discernable within the Moessbauer spectra. One component of the Moessbauer spectra is assigned to the surface layer of the gold particles. By comparing this surface component with the amount of the bulk metallic core, one can calculate the size of the gold particles. In the Moessbauer spectra of the colourless glass one also can find parts of bulk metallic gold. Investigations with X-ray diffraction show that these are gold particles with a diameter of 100 nm to 300 nm and therefore have no additional colouring effect within the visible spectrum. The Moessbauer spectra on gold of the remelt glasses are similar to those which have been measured on the initial colourless glasses
46 CFR 196.37-33 - Instructions for changing steering gear.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Instructions for changing steering gear. 196.37-33... steering gear. (a) Instructions in at least 1/2 inch letters and figures shall be posted in the steering engineroom, relating in order, the different steps to be taken in changing to the emergency steering gear...
Immunological properties of gold nanoparticles.
Dykman, Lev A; Khlebtsov, Nikolai G
2017-03-01
In the past decade, gold nanoparticles have attracted strong interest from the nanobiotechnological community owing to the significant progress made in robust and easy-to-make synthesis technologies, in surface functionalization, and in promising biomedical applications. These include bioimaging, gene diagnostics, analytical sensing, photothermal treatment of tumors, and targeted delivery of various biomolecular and chemical cargos. For the last-named application, gold nanoparticles should be properly fabricated to deliver the cargo into the targeted cells through effective endocytosis. In this review, we discuss recent progress in understanding the selective penetration of gold nanoparticles into immune cells. The interaction of gold nanoparticles with immune cell receptors is discussed. As distinct from other published reviews, we present a summary of the immunological properties of gold nanoparticles. This review also summarizes what is known about the application of gold nanoparticles as an antigen carrier and adjuvant in immunization for the preparation of antibodies in vivo . For each of the above topics, the basic principles, recent advances, and current challenges are discussed. Thus, this review presents a detailed analysis of data on interaction of gold nanoparticles with immune cells. Emphasis is placed on the systematization of data over production of antibodies by using gold nanoparticles and adjuvant properties of gold nanoparticles. Specifically, we start our discussion with current data on interaction of various gold nanoparticles with immune cells. The next section describes existing technologies to improve production of antibodies in vivo by using gold nanoparticles conjugated with specific ligands. Finally, we describe what is known about adjuvant properties of bare gold or functionalized nanoparticles. In the Conclusion section, we present a short summary of reported data and some challenges and perspectives.
International Nuclear Information System (INIS)
Wolter, D.
1974-01-01
The silver isotopes Ag 105 and Agsup(110m) and the gold isotopes Au 195 and Au 199 were used for isotope effect measurements. The isotope effect of the gold self-diffusion was measured on four monocrystals samples at about 850 0 C, that of silver in gold monocrystals at five different temperatures between 731 0 C and 1050 0 C. Furthermore, the isotope effect for silver at 904 0 C was measured on seven silver-gold alloys of varying silver concentration. The correlation factor was determined from the measurements. (HPOE/LH) [de
The giant Jiaodong gold province: The key to a unified model for orogenic gold deposits?
Directory of Open Access Journals (Sweden)
David I. Groves
2016-05-01
Full Text Available Although the term orogenic gold deposit has been widely accepted for all gold-only lode-gold deposits, with the exception of Carlin-type deposits and rare intrusion-related gold systems, there has been continuing debate on their genesis. Early syngenetic models and hydrothermal models dominated by meteoric fluids are now clearly unacceptable. Magmatic-hydrothermal models fail to explain the genesis of orogenic gold deposits because of the lack of consistent spatially – associated granitic intrusions and inconsistent temporal relationships. The most plausible, and widely accepted, models involve metamorphic fluids, but the source of these fluids is hotly debated. Sources within deeper segments of the supracrustal successions hosting the deposits, the underlying continental crust, and subducted oceanic lithosphere and its overlying sediment wedge all have their proponents. The orogenic gold deposits of the giant Jiaodong gold province of China, in the delaminated North China Craton, contain ca. 120 Ma gold deposits in Precambrian crust that was metamorphosed over 2000 million years prior to gold mineralization. The only realistic source of fluid and gold is a subducted oceanic slab with its overlying sulfide-rich sedimentary package, or the associated mantle wedge. This could be viewed as an exception to a general metamorphic model where orogenic gold has been derived during greenschist- to amphibolite-facies metamorphism of supracrustal rocks: basaltic rocks in the Precambrian and sedimentary rocks in the Phanerozoic. Alternatively, if a holistic view is taken, Jiaodong can be considered the key orogenic gold province for a unified model in which gold is derived from late-orogenic metamorphic devolatilization of stalled subduction slabs and oceanic sediments throughout Earth history. The latter model satisfies all geological, geochronological, isotopic and geochemical constraints but the precise mechanisms of auriferous fluid release, like many
Facts and Fantasies about Gold
Klement, Joachim
2015-01-01
Due to the increasing popularity of gold as an investment the demand for effective risk management techniques for gold investments has increased as well. In this paper we analyze several drivers of the price of gold that have been proposed in the past. Our analysis indicates that short-term volatility of the price of gold remains rather unpredictable with many of the explanations like the fund flows in physical gold ETF either unreliable or unstable over time. Our analysis suggests that there...
Occurrences of dendritic gold at the McLaughlin Mine hot-spring gold deposit
Sherlock, R. L.; Lehrman, N. J.
1995-06-01
Two styles of gold dendrites are variably developed at the McLaughlin Mine. The most abundant occurrence is hosted by amber-coloured hydrocarbon-rich opal. Silica likely precipitated from a boiling hydrothermal fluid and complexed with immiscible hydrocarbons forming an amorphous hydrocarbon-silica phase. This phase likely scavenged particulate gold by electrostatic attraction to the hydrocarbon-silica phase. The dendritic nature of the gold is secondary and is the result of dewatering of the amorphous hydrocarbon-silica phase and crystallization of gold into syneresis fractures. The second style of dendritic gold is hosted within vein swarms that focused large volumes of fluid flow. The dendrites occur along with hydrocarbon-rich silica at the upper contact of the vein margins which isolated the dendrites allowing sufficient time for them to grow. In a manner similar to the amber-coloured opal, the dendrites may have formed by scavenging particulate gold by electrostatic attraction to the hydrocarbon-silica phase.
International Nuclear Information System (INIS)
Karczmarczyk, Aleksandra; Celebanska, Anna; Nogala, Wojciech; Sashuk, Volodymyr; Chernyaeva, Olga; Opallo, Marcin
2014-01-01
Graphical abstract: - Highlights: • Gold nanoparticulate film electrodes were prepared by layer-by-layer method from oppositely charged nanoparticles. • Positively charged nanoparticles play dominant role in glucose oxidation in alkaline solution. • Gold and gold-carbon nanoparticulate film electrodes exhibit similar glucose oxidation current and onset potential. - Abstract: Electrocatalytic oxidation of glucose was studied at nanoparticulate gold and gold-carbon film electrodes. These electrodes were prepared by a layer-by-layer method without application of any linker molecules. Gold nanoparticles were stabilized by undecane thiols functionalized by trimethyl ammonium or carboxylate groups, whereas the carbon nanoparticles were covered by phenylsulfonate functionalities. The gold nanoparticulate electrodes were characterized by UV-vis and XPS spectroscopy, atomic force microscopy and voltammetry, before and after heat-treatment. Heat-treatment facilitates the aggregation of the nanoparticles and affects the structure of the film. The comparison of the results obtained with film electrodes prepared from gold nanoparticles with the same charge and with gold-carbon nanoparticulate electrodes, proved that positively charged nanoparticles are responsible for the high electrocatalytic activity, whereas negatively charged ones act rather as a linker of the film
Directory of Open Access Journals (Sweden)
Yue Liu
Full Text Available MicroRNAs (miRNAs can function as tumor suppressors or oncogene promoters during tumor development. In this study, low levels of expression of miR-196b were detected in patients with chronic myeloid leukemia. Bisulfite genomic sequencing PCR and methylation-specific PCR were used to examine the methylation status of the CpG islands in the miR-196b promoter in K562 cells, patients with leukemia and healthy individuals. The CpG islands showed more methylation in patients with chronic myeloid leukemia compared with healthy individuals (P<0.05, which indicated that low expression of miR-196b may be associated with an increase in the methylation of CpG islands. The dual-luciferase reporter assay system demonstrated that BCR-ABL1 and HOXA9 are the target genes of miR-196b, which was consistent with predictions from bioinformatics software analyses. Further examination of cell function indicated that miR-196b acts to reduce BCR-ABL1 and HOXA9 protein levels, decrease cell proliferation rate and retard the cell cycle. A low level of expression of miR-196b can cause up-regulation of BCR-ABL1 and HOXA9 expression, which leads to the development of chronic myeloid leukemia. MiR-196b may represent an effective target for chronic myeloid leukemia therapy.
A non-diazo approach to α-oxo gold carbenes via gold-catalyzed alkyne oxidation.
Zhang, Liming
2014-03-18
For the past dozen years, homogeneous gold catalysis has evolved from a little known topic in organic synthesis to a fully blown research field of significant importance to synthetic practitioners, due to its novel reactivities and reaction modes. Cationic gold(I) complexes are powerful soft Lewis acids that can activate alkynes and allenes toward efficient attack by nucleophiles, leading to the generation of alkenyl gold intermediates. Some of the most versatile aspects of gold catalysis involve the generation of gold carbene intermediates, which occurs through the approach of an electrophile to the distal end of the alkenyl gold moiety, and their diverse transformations thereafter. On the other hand, α-oxo metal carbene/carbenoids are highly versatile intermediates in organic synthesis and can undergo various synthetically challenging yet highly valuable transformations such as C-H insertion, ylide formation, and cyclopropanation reactions. Metal-catalyzed dediazotizations of diazo carbonyl compounds are the principle and most reliable strategy to access them. Unfortunately, the substrates contain a highly energetic diazo moiety and are potentially explosive. Moreover, chemists need to use energetic reagents to prepare them, putting further constrains on operational safety. In this Account, we show that the unique access to the gold carbene species in homogeneous gold catalysis offers an opportunity to generate α-oxo gold carbenes if both nucleophile and electrophile are oxygen. Hence, this approach would enable readily available and safer alkynes to replace hazardous α-diazo carbonyl compounds as precursors in the realm of gold carbene chemistry. For the past several years, we have demonstrated that alkynes can indeed effectively serve as precursors to versatile α-oxo gold carbenes. In our initial study, we showed that a tethered sulfoxide can be a suitable oxidant, which in some cases leads to the formation of α-oxo gold carbene intermediates. The
A Non-Diazo Approach to α-Oxo Gold Carbenes via Gold-Catalyzed Alkyne Oxidation
2015-01-01
For the past dozen years, homogeneous gold catalysis has evolved from a little known topic in organic synthesis to a fully blown research field of significant importance to synthetic practitioners, due to its novel reactivities and reaction modes. Cationic gold(I) complexes are powerful soft Lewis acids that can activate alkynes and allenes toward efficient attack by nucleophiles, leading to the generation of alkenyl gold intermediates. Some of the most versatile aspects of gold catalysis involve the generation of gold carbene intermediates, which occurs through the approach of an electrophile to the distal end of the alkenyl gold moiety, and their diverse transformations thereafter. On the other hand, α-oxo metal carbene/carbenoids are highly versatile intermediates in organic synthesis and can undergo various synthetically challenging yet highly valuable transformations such as C–H insertion, ylide formation, and cyclopropanation reactions. Metal-catalyzed dediazotizations of diazo carbonyl compounds are the principle and most reliable strategy to access them. Unfortunately, the substrates contain a highly energetic diazo moiety and are potentially explosive. Moreover, chemists need to use energetic reagents to prepare them, putting further constrains on operational safety. In this Account, we show that the unique access to the gold carbene species in homogeneous gold catalysis offers an opportunity to generate α-oxo gold carbenes if both nucleophile and electrophile are oxygen. Hence, this approach would enable readily available and safer alkynes to replace hazardous α-diazo carbonyl compounds as precursors in the realm of gold carbene chemistry. For the past several years, we have demonstrated that alkynes can indeed effectively serve as precursors to versatile α-oxo gold carbenes. In our initial study, we showed that a tethered sulfoxide can be a suitable oxidant, which in some cases leads to the formation of α-oxo gold carbene intermediates. The
Surface-stabilized gold nanocatalysts
Dai, Sheng [Knoxville, TN; Yan, Wenfu [Oak Ridge, TN
2009-12-08
A surface-stabilized gold nanocatalyst includes a solid support having stabilizing surfaces for supporting gold nanoparticles, and a plurality of gold nanoparticles having an average particle size of less than 8 nm disposed on the stabilizing surfaces. The surface-stabilized gold nanocatalyst provides enhanced stability, such as at high temperature under oxygen containing environments. In one embodiment, the solid support is a multi-layer support comprising at least a first layer having a second layer providing the stabilizing surfaces disposed thereon, the first and second layer being chemically distinct.
A halogen-free synthesis of gold nanoparticles using gold(III) oxide
International Nuclear Information System (INIS)
Sashuk, Volodymyr; Rogaczewski, Konrad
2016-01-01
Gold nanoparticles are one of the most used nanomaterials. They are usually synthesized by the reduction of gold(III) chloride. However, the presence of halide ions in the reaction mixture is not always welcome. In some cases, these ions have detrimental influence on the morphology and structure of resulting nanoparticles. Here, we present a simple and halogen-free procedure to prepare gold nanoparticles by reduction of gold(III) oxide in neat oleylamine. The method provides the particles with an average size below 10 nm and dispersity of tens of percent. The process of nanoparticle formation was monitored using UV–Vis spectroscopy. The structure and chemical composition of the nanoparticles was determined by SEM, XPS and EDX. We also proposed the mechanism of reduction of gold(III) oxide based on MS, IR and NMR data. Importantly, the synthetic protocol is general and applicable for the preparation of other coinage metal nanoparticles from the corresponding metal oxides. For instance, we demonstrated that the absence of halogen enables efficient alloying of metals when preparing gold–silver bimetallic nanoparticles.
Structure and bonding in gold compounds
International Nuclear Information System (INIS)
Parish, R.V.
1988-01-01
Recent developments in chemical applications of 197 Au Moessbauer spectroscopy are reviewed. For gold(I) and gold(III), systematic variations in isomer shift and quadrupole splitting are seen as the ligands are changed; the effects of change in coordination number of the gold atoms are also systematic. Data for gold(II) systems involving gold-gold bonds lie between those for corresponding gold(I) and gold(III) materials, showing a small increase in isomer shift and a larger increase in quadrupole splitting as the oxidation state decreases; these trends are explained in terms of the structures. Data for mixed-metal cluster compounds are much more sensitive to structural effects than in homonuclear clusters. Both sets of data show systematic changes with increase in the number of metal atoms to which the gold atom is bound. The connectivity also influences the recoil-free fraction. (orig.)
Chen, Yan; Huang, Shai; Wu, Bo; Fang, Jiankai; Zhu, Minsheng; Sun, Li; Zhang, Lifeng; Zhang, Yongsheng; Sun, Maomin; Guo, Lingling; Wang, Shouli
2017-07-25
Transforming growth factor-β1 is considered a key contributor to the progression of breast cancer. MicroRNAs are important factors in the development and progression of many malignancies. In the present study, upon studies of breast cancer cell lines and tissues, we showed that microRNA -196a-3p is decreased by transforming growth factor-β1 in breast cancer cells and associated with breast cancer progression. We identified neuropilin-2 as a target gene of microRNA -196a-3p and showed that it is regulated by transforming growth factor-β1. Moreover, transforming growth factor-β1-mediated inhibition of microRNA -196a-3p and activation of neuropilin-2were required for transforming growth factor-β1-induced migration and invasion of breast cancer cells. In addition, neuropilin-2 expression was suppressed in breast tumors, particularly in triple-negative breast cancers. Collectively, our findings strongly indicate that microRNA -196a-3p is a predictive biomarker of breast cancer metastasis and patient survival and a potential therapeutic target in metastatic breast cancer.
Knowledge-driven GIS modeling technique for gold exploration, Bulghah gold mine area, Saudi Arabia
Directory of Open Access Journals (Sweden)
Ahmed A. Madani
2011-12-01
Full Text Available This research aims to generate a favorability map for gold exploration at the Bulghah gold mine area using integration of geo-datasets within a GIS environment. Spatial data analyses and integration of different geo-datasets are carried out based on knowledge-driven and weighting technique. The integration process involves the weighting and scoring of different layers affecting the gold mineralization at the study area using the index overlay method within PCI Geomatica environment. Generation of the binary predictor maps for lithology, lineaments, faults and favorable contacts precede the construction of the favorability map. About 100 m buffer zones are generated for favorable contacts, lineaments and major faults layers. Internal weighting is assigned to each layer based on favorability for gold mineralization. The scores for lithology, major faults, lineaments and favorable contacts layers in the constructed favorability map are 50%, 25%, 10% and 15%, respectively. Final favorability map for the Bulghah gold mine area shows the recording of two new sites for gold mineralization located at the northern and southern extensions of tonalite–diorite intrusions. The northern new site is now exploited for gold from the Bulghah North mine. The southern new site is narrow and small; its rocks resemble those of the Bulghah gold mine.
Raaijmakers, J M; Weller, D M
2001-06-01
The genotypic diversity that occurs in natural populations of antagonistic microorganisms provides an enormous resource for improving biological control of plant diseases. In this study, we determined the diversity of indigenous 2,4-diacetylphloroglucinol (DAPG)-producing Pseudomonas spp. occurring on roots of wheat grown in a soil naturally suppressive to take-all disease of wheat. Among 101 isolates, 16 different groups were identified by random amplified polymorphic DNA (RAPD) analysis. One RAPD group made up 50% of the total population of DAPG-producing Pseudomonas spp. Both short- and long-term studies indicated that this dominant genotype, exemplified by P. fluorescens Q8r1-96, is highly adapted to the wheat rhizosphere. Q8r1-96 requires a much lower dose (only 10 to 100 CFU seed(-1) or soil(-1)) to establish high rhizosphere population densities (10(7) CFU g of root(-1)) than Q2-87 and 1M1-96, two genotypically different, DAPG-producing P. fluorescens strains. Q8r1-96 maintained a rhizosphere population density of approximately 10(5) CFU g of root(-1) after eight successive growth cycles of wheat in three different, raw virgin soils, whereas populations of Q2-87 and 1M1-96 dropped relatively quickly after five cycles and were not detectable after seven cycles. In short-term studies, strains Q8r1-96, Q2-87, and 1M1-96 did not differ in their ability to suppress take-all. After eight successive growth cycles, however, Q8r1-96 still provided control of take-all to the same level as obtained in the take-all suppressive soil, whereas Q2-87 and 1M1-96 gave no control anymore. Biochemical analyses indicated that the superior rhizosphere competence of Q8r1-96 is not related to in situ DAPG production levels. We postulate that certain rhizobacterial genotypes have evolved a preference for colonization of specific crops. By exploiting diversity of antagonistic rhizobacteria that share a common trait, biological control can be improved significantly.
196Hg and 202Hg isotopic ratios in chondrites: revisited
International Nuclear Information System (INIS)
Jovanovic, S.; Reed, G.W. Jr.
1976-01-01
Additional evidence for an isotopically anomalous Hg fraction in unequilibrated meteorites has been obtained using neutron activation to produce 196 Hg and 202 Hg followed by stepwise heating to extract the Hg. In the latest experiments Allende matrix samples released the anomalous Hg but various high-temperature inclusions did not. Nucleogenetic processes are suggested as the probable cause of the anomaly. (Auth.)
Determination of Gold from Gold Matrix of North Western Nigeria ...
African Journals Online (AJOL)
The research paper presents analytical results of Au, Mn and V concentrations of some Nigerian gold ores using two techniques: epithermal neutron activation analysis (ENAA) and proton induced X-ray emission (PIXE). Fourteen samples were collected from gold fields of North Western Nigeria, prepared separately to a ...
Analysis of gold(I/III)-complexes by HPLC-ICP-MS demonstrates gold(III) stability in surface waters.
Ta, Christine; Reith, Frank; Brugger, Joël; Pring, Allan; Lenehan, Claire E
2014-05-20
Understanding the form in which gold is transported in surface- and groundwaters underpins our understanding of gold dispersion and (bio)geochemical cycling. Yet, to date, there are no direct techniques capable of identifying the oxidation state and complexation of gold in natural waters. We present a reversed phase ion-pairing HPLC-ICP-MS method for the separation and determination of aqueous gold(III)-chloro-hydroxyl, gold(III)-bromo-hydroxyl, gold(I)-thiosulfate, and gold(I)-cyanide complexes. Detection limits for the gold species range from 0.05 to 0.30 μg L(-1). The [Au(CN)2](-) gold cyanide complex was detected in five of six waters from tailings and adjacent monitoring bores of working gold mines. Contrary to thermodynamic predictions, evidence was obtained for the existence of Au(III)-complexes in circumneutral, hypersaline waters of a natural lake overlying a gold deposit in Western Australia. This first direct evidence for the existence and stability of Au(III)-complexes in natural surface waters suggests that Au(III)-complexes may be important for the transport and biogeochemical cycling of gold in surface environments. Overall, these results show that near-μg L(-1) enrichments of Au in environmental waters result from metastable ligands (e.g., CN(-)) as well as kinetically controlled redox processes leading to the stability of highly soluble Au(III)-complexes.
Directory of Open Access Journals (Sweden)
Jiankang Jin
2014-01-01
Full Text Available Five gold stocks in Chinese Shanghai and Shenzhen A-share and Comex gold futures are chosen to form the sample, for the purpose of analysing the impact of the fluctuation of the international gold prices on the gold stocks in Chinese Shanghai and Shenzhen A-share. Using the methods of unit root test, Granger causality test, VAR model, and impulse response function, this paper has analysed the relationship between the price change of the international gold futures and the price fluctuation of gold stocks in Chinese Shanghai and Shenzhen comprehensively. The results suggest the fluctuation of the international gold futures has a strong influence on the domestic futures.
Formation of gold nanorods and gold nanorod films for surface-enhanced Raman scattering spectroscopy
International Nuclear Information System (INIS)
Trotsyuk, L.L.; Kulakovich, O.S.; Shabunya-Klyachkovskaya, E.V.; Gaponenko, S.V.; Vashchenko, S.V.
2016-01-01
The formation of gold nanorods as well as thin films prepared via electrostatic deposition of gold nanorods has been investigated. The obtained gold nanorods films have been used as substrates for the surface-enhanced Raman scattering analysis of sulfur-free organic molecules mitoxantrone and malachite green as well as inorganic malachite microcrystals for the first time. The additional modification of films with L-cysteine allows one to significantly extend the use of gold nanorods for the surface-enhanced Raman scattering analysis. (authors)
Metallic gold beads in hyaluronic acid
DEFF Research Database (Denmark)
Pedersen, Dan Sonne; Tran, Thao Phuong; Smidt, Kamille
2013-01-01
. In conclusion, our findings support that bio-liberation of gold from metallic gold surfaces have anti-inflammatory properties similar to classic gold compounds, warranting further studies into the pharmacological potential of this novel gold-treatment and the possible synergistic effects of hyaluronic acid....... by exploiting macrophage-induced liberation of gold ions (dissolucytosis) from gold surfaces. Injecting gold beads in hyaluronic acid (HA) as a vehicle into the cavities of the brain can delay clinical signs of disease progression in the MS model, experimental autoimmune encephalitis (EAE). This study...... investigates the anti-inflammatory properties of metallic gold/HA on the gene expression of tumor necrosis factor (Tnf-α), Interleukin (Il)-1β, Il-6, Il-10, Colony-stimulating factor (Csf)-v2, Metallothionein (Mt)-1/2, Bcl-2 associated X protein (Bax) and B cell lymphoma (Bcl)-2 in cultured J774 macrophages...
A study on gold detection in Wenyu gold mine with XRF techniques
International Nuclear Information System (INIS)
Liu Liuchun
1988-01-01
A portable X ray fluorescence analyzer was used for detecting fluorcescent X rays from the elements associated with gold ores. Fe, As and Ni were chosen to be the indicator elements to analyse rock samples in Wenyu gold mine. Optimum indicators were determined, and it had proved to be successful to detect gold indirectly by measuring the yields of characteristic X rays of the elements. The method provided also valuable information on geology mapping and deposits forming environment
Energy Technology Data Exchange (ETDEWEB)
Wall, N.C.; Hughes-Narborough, C.; Willey, G. [Davy (Stockton) Ltd., Stockton-on-Tees (United Kingdom)
1994-11-01
Coal Gold Agglomeration (CGA) was developed by BP Minerals and involves the selective recovery of oleophilic gold particles from an aqueous slurry into coal-oil agglomerates. These agglomerates are allowed to build up to a high gold loading and are then separated from the slurry. The loaded agglomerates are burned and the gold is finally recovered from the ash residue by dissolution and precipitation or by direct smelting. 6 figs.
Annealing relaxation of ultrasmall gold nanostructures
Chaban, Vitaly
2015-01-01
Except serving as an excellent gift on proper occasions, gold finds applications in life sciences, particularly in diagnostics and therapeutics. These applications were made possible by gold nanoparticles, which differ drastically from macroscopic gold. Versatile surface chemistry of gold nanoparticles allows coating with small molecules, polymers, biological recognition molecules. Theoretical investigation of nanoscale gold is not trivial, because of numerous metastable states in these systems. Unlike elsewhere, this work obtains equilibrium structures using annealing simulations within the recently introduced PM7-MD method. Geometries of the ultrasmall gold nanostructures with chalcogen coverage are described at finite temperature, for the first time.
Vishiti, A.; Suh, C. E.; Lehmann, B.; Egbe, J. A.; Shemang, E. M.
2015-11-01
The Batouri area hosts lode-gold mineralization under several-m-thick lateritic cover. Pitting to bed rock on a geochemical Au anomaly defined from previous reconnaissance soil sampling identified five horizons ranging from saprock at the base to laterite at the top. Analysis of bulk samples from each horizon by fire assay shows that most of the horizons are barren although 119 ppb and 48 ppb Au values were obtained from one laterite horizon and one saprolite horizon, respectively, from two separate pits. All the horizons were panned and particulate gold was also recovered only from these two horizons. The gold grains from both horizons are morphologically and compositionally indistinguishable with rare quartz, pyrite and galena inclusions. The grains have irregular, sub-rounded, bean to elongated shapes and they show a remarkable core-rim zonation. Electron microprobe analysis of the grains recorded high gold content in the rims (86.3-100 wt%) and along fissures within the grains (95.1-100 wt%). The cores are relatively Ag rich (11.8-14 wt% Ag) while the rims (0.63-13.7 wt% Ag, most of the values fall within the lower limit of this range) and fissures (0.03-5.02 wt% Ag) are poor in Ag. The low Ag concentration in the rims and along fissures is attributed to preferential leaching of Ag; a process recognized in gold grains and platiniferous alloys from alluvia. The core composition of the grains is similar to that of primary gold composition in the bedrock. These results show that gold in the soil is relic particulate gold derived from the primary source with no evidence of secondary gold precipitation in the weathering cycle. In all the pits no horizon was systematically enriched in gold suggesting there has been no chemical remobilization of gold in this environment. Rather the dispersion of gold here is in the particulate form. Therefore combining particulate gold features with assay data is relevant to exploration in such tropical environments.
International Nuclear Information System (INIS)
Ahmed, K.; Dampare, S.B.; Addo, M.A.; Osae, S.; Adotey, D.K.; Adomako, D.
2005-01-01
A novel method has been developed for processing and extraction of gold from gold bearing rocks for use by small-scale gold miners in Ghana. The methodology involved crushing of gold bearing hard rocks to fine particles to form a composite sample and screening at a range of sizes. Gold distribution in the composite sample was determined as a function of particle size by using Instrumental Neutron Activation Analysis. The concentrations of gold for the corresponding particle sizes were 16.4 ± 0.17mg/kg for sizes <63μm; 161± 0.75 mg/kg for 63 - 125 μm, 0.53 + 0.03 mg/kg for 125 - 250 μm, 4.66± 0.07 mg/kg for 250 - 355 μm, 1.55 ± 0.06 for 355 - 425 μm, 0.80 ± 0.008 mg/kg for 425 -1000 μm, and 1.27 + 0.05 mg/kg for 1000-2000 μm. The average gold content in a 7.127 kg composite sample based on particle size found to be 3.08 mg/kg. (au)
International Nuclear Information System (INIS)
James, G.S.; Davidson, R.J.
1977-01-01
A process for extracting gold and uranium from an ore containing them both comprising the steps of pulping the finely comminuted ore with a suitable cyanide solution at an alkaline pH, acidifying the pulp for uranium dissolution, adding carbon activated for gold recovery to the pulp at a suitable stage, separating the loaded activated carbon from the pulp, and recovering gold from the activated carbon and uranium from solution
Free gold recovery by coal-oil agglomeration
Energy Technology Data Exchange (ETDEWEB)
Kotze, W.; Petersen, F.W. [Cape Technikon Cape Town (South Africa). Dept. of Chemical Engineering
2000-02-01
The gold mining industry has mainly relied upon the use of highly polluting chemicals, such as mercury and cyanide to recover gold from its ores. The Coal Gold Agglomeration (CGA) process was developed some years ago and has the advantage in that gold is recovered by a procedure which has little or no negative impact on the environment. A gold ore containing liberated gold particles is contacted with coal-oil agglomerates, whereby the gold is recovered into the coal/oil phase. Laboratory scale batch tests were performed on an artificial mixture gold slurry and gold recoveries of up to 85% were found under optimized conditions. By recycling the coal/oil phase, it was found that the gold loading onto the agglomerates was increased. Tests performed on an industrial ore yielded slightly lower gold recoveries, and X-ray Diffraction (XRD) analysis on the coal/oil phase showed that minerals other than gold were recovered into this phase. A comparative study was conducted whereby the CGA process was compared to mercury amalgamation. Gold recoveries obtained through amalgamation were 15% lower than by the agglomeration process, which indicates that this process can be considered favourably as an alternative to amalgamation. 16 refs., 2 figs., 6 tabs.
Directory of Open Access Journals (Sweden)
Bright Tim
2011-02-01
Full Text Available Abstract Background Proton pump inhibitor (PPI medication and surgical fundoplication are used for the control of gastro-oesophageal reflux in patients with Barrett's oesophagus, but differ in their effectiveness for both acid and bile reflux. This might impact on the inflammatory processes that are associated with progression of Barrett's oesophagus to cancer, and this may be evident in the gene expression profile and microRNA expression pattern in Barrett's oesophagus mucosa. We hypothesised that two miRNAs with inflammatory and oncogenic roles, miR-101 and miR-196a, are differentially expressed in Barrett's oesophagus epithelium in patients with reflux treated medically vs. surgically. Findings Mucosal tissue was obtained at endoscopy from patients with Barrett's oesophagus whose reflux was controlled by proton pump inhibitor (PPI therapy (n = 20 or by fundoplication (n = 19. RNA was extracted and the expression of miR-101 and miR-196a was measured using real-time reverse transcription - polymerase chain reaction. There were no significant differences in miR-101 and miR-196a expression in Barrett's oesophagus epithelium in patients treated by PPI vs. fundoplication (p = 0.768 and 0.211 respectively. Secondary analysis showed a correlation between miR-196a expression and Barrett's oesophagus segment length (p = 0.014. Conclusion The method of reflux treatment did not influence the expression of miR-101 and miR-196a in Barrett's oesophagus. This data does not provide support to the hypothesis that surgical treatment of reflux better prevents cancer development in Barrett's oesophagus. The association between miR-196a expression and Barrett's oesophagus length is consistent with a tumour promoting role for miR-196a in Barrett's oesophagus.
2011-01-01
Background Proton pump inhibitor (PPI) medication and surgical fundoplication are used for the control of gastro-oesophageal reflux in patients with Barrett's oesophagus, but differ in their effectiveness for both acid and bile reflux. This might impact on the inflammatory processes that are associated with progression of Barrett's oesophagus to cancer, and this may be evident in the gene expression profile and microRNA expression pattern in Barrett's oesophagus mucosa. We hypothesised that two miRNAs with inflammatory and oncogenic roles, miR-101 and miR-196a, are differentially expressed in Barrett's oesophagus epithelium in patients with reflux treated medically vs. surgically. Findings Mucosal tissue was obtained at endoscopy from patients with Barrett's oesophagus whose reflux was controlled by proton pump inhibitor (PPI) therapy (n = 20) or by fundoplication (n = 19). RNA was extracted and the expression of miR-101 and miR-196a was measured using real-time reverse transcription - polymerase chain reaction. There were no significant differences in miR-101 and miR-196a expression in Barrett's oesophagus epithelium in patients treated by PPI vs. fundoplication (p = 0.768 and 0.211 respectively). Secondary analysis showed a correlation between miR-196a expression and Barrett's oesophagus segment length (p = 0.014). Conclusion The method of reflux treatment did not influence the expression of miR-101 and miR-196a in Barrett's oesophagus. This data does not provide support to the hypothesis that surgical treatment of reflux better prevents cancer development in Barrett's oesophagus. The association between miR-196a expression and Barrett's oesophagus length is consistent with a tumour promoting role for miR-196a in Barrett's oesophagus. PMID:21352563
Spectroscopic diagnostic of gold plasma
Energy Technology Data Exchange (ETDEWEB)
Busquet, M.
1986-06-01
Results of a simulation of a gold-aluminium alloy target irradiated by laser are presented. FCI code has been used with a processing out of LTE of atomic physics of gold and of multigroup photonics. Emission and reabsorption of gold and aluminium lines are included.
Activation analysis in gold industry
International Nuclear Information System (INIS)
Kist, A. A.
2003-01-01
Nuclear techniques and methods were, are, and will be very important for many fields of science, agriculture, industry, etc. Among other examples one can remember role of the nuclear medicine (radiotherapy and radiodiagnostic methods) or semiconductors (communication, computing, information, etc.) which industrial production has been on initial stage based on activation analysis. One of very illustrative examples is application of nuclear methods in gold industry. This is given by favorable nuclear properties of gold. Uzbekistan is one of the main producers of gold. Open-cast mining and hydro metallurgic extraction (using leaching by cyanide and sorption by ion-exchange resin) is the mostly used technology. The typical gold ores are sulfide and contain elevated concentration of As and Sb. That needs special technology of gold extraction. Importance of gold for Uzbekistan economy is a reason why for many years there are carried out studies concerning to gold production. These studies include also nuclear methods and their results are successfully used in gold industry. The present paper gives a brief overview for period of 25 years. For many reasons most of these studies were not published before completely. Despite some results are obtained decades ago we decided to present the overview as an example how nuclear methods can cover requirements of the whole process. We are trying to sort these studies according to methods and applications
Directory of Open Access Journals (Sweden)
Arifudin Idrus
2014-06-01
Full Text Available DOI: 10.17014/ijog.v6i1.114In 2008, placer gold was discovered in Langkowala area (Bombana Regency, Southeast Sulawesi, Indonesia, and more than 60,000 traditional gold miners in the early 2009 have been operating by digging vertical pits and panning active stream sediments. The grade of placer gold ranges from 50 to 140 g/t. Local geological framework indicates that the placer gold is not related to volcanic rock-related hydrothermal gold deposit, e.g. epithermal, skarn or porphyry. This paper describes a preliminary study on possible primary deposit type as a source of the Langkowala (Bombana secondary placer gold. A field study indicates that the Langkowala (Bombana placer/paleoplacer gold is possibly related to gold-bearing quartz veins/veinlets hosted by metamorphic rocks particularly mica schist and metasediments in the area. These quartz veins/veinlets are currently recognized in metamorphic rocks at Wumbubangka Mountains, a northern flank of Rumbia Mountain Range. Sheared, segmented quartz veins/veinlets are of 2 cm to 2 m in width and contain gold in a grade varying between 2 and 61 g/t. At least, there are two generations of the quartz veins. The first generation of quartz vein is parallel to foliation of mica schist and metasediments with general orientation of N 300oE/60o; the second quartz vein generation crosscut the first quartz vein and the foliation of the wallrock. The first quartz veins are mostly sheared/deformed, brecciated, and occasionally sigmoidal, whereas the second quartz veins are relatively massive. The similar quartz veins/veinlets types are also probably present in Mendoke Mountain Range, in the northern side of Langkowala area. This primary gold deposit is called as ‘orogenic gold type’. The orogenic gold deposit could be a new target of gold exploration in Indonesia in the future.
International Nuclear Information System (INIS)
Parish, R.V.; Cottrill, S.M.
1987-01-01
A major use of gold compounds in the pharmaceutical industry is for anti-arthritic agents. The disease itself is not understood and little is known about the way in which the drugs act, but detailed pictures of the distribution of gold in the body are available, and some of the relevant biochemistry is beginning to emerge. The purpose of this article is to give a survey of the types of compounds presently employed in medicine, of the distribution of gold in the body which results from their use, and of some relevant chemistry. Emphasis is placed on results obtained in the last few years
Spectroscopic diagnostic of gold plasma
International Nuclear Information System (INIS)
Busquet, M.
1986-01-01
Results of a simulation of a gold-aluminium alloy target irradiated by laser are presented. FCI code has been used with a processing out of LTE of atomic physics of gold and of multigroup photonics. Emission and reabsorption of gold and aluminium lines are included [fr
Spherical aggregates composed of gold nanoparticles
International Nuclear Information System (INIS)
Chen, C-C; Kuo, P-L; Cheng, Y-C
2009-01-01
Alkylated triethylenetetramine (C12E3) was synthesized and used as both a reductant in the preparation of gold nanoparticles by the reduction of HAuCl 4 and a stabilizer in the subsequent self-assembly of the gold nanoparticles. In acidic aqueous solution, spherical aggregates (with a diameter of about 202 ± 22 nm) of gold nanoparticles (with the mean diameter of ∼18.7 nm) were formed. The anion-induced ammonium adsorption of the alkylated amines on the gold nanoparticles was considered to provide the electrostatic repulsion and steric hindrance between the gold nanoparticles, which constituted the barrier that prevented the individual particles from coagulating. However, as the amino groups became deprotonated with increasing pH, the ammonium adsorption was weakened, and the amino groups were desorbed from the gold surface, resulting in discrete gold particles. The results indicate that the morphology of the reduced gold nanoparticles is controllable through pH-'tunable' aggregation under the mediation of the amino groups of alkylated amine to create spherical microstructures.
['Gold standard', not 'golden standard'
Claassen, J.A.H.R.
2005-01-01
In medical literature, both 'gold standard' and 'golden standard' are employed to describe a reference test used for comparison with a novel method. The term 'gold standard' in its current sense in medical research was coined by Rudd in 1979, in reference to the monetary gold standard. In the same
2010-07-01
... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Gold. 101-45.002 Section... PERSONAL PROPERTY § 101-45.002 Gold. (a) Gold will be sold in accordance with this section and part 102-38 of the Federal Management Regulation. (b) Sales of gold shall be processed to— (1) Use the sealed bid...
Poly-thiosemicarbazide Membrane for Gold Adsorption and In-situ Growth of Gold Nanoparticles
Parra, Luis F.
2012-12-01
In this work the synergy between a polymer containing chelate sites and gold ions was explored by the fabrication of a polymeric membrane with embedded gold nanoparticles inside its matrix and by developing a process to recover gold from acidic solutions. After realizing that the thiosemicarbazide groups present in the monomeric unit of poly-thiosemicarbazide (PTSC) formed strong complexes with Au ions, membrane technology was used to exploit this property to its maximum. The incorporation of metal nanoparticles into polymeric matrices with current technologies involves either expensive and complicated procedures or leads to poor results in terms of agglomeration, loading, dispersion, stability or efficient use of raw materials. The fabrication procedure described in this thesis solves these problems by fabricating a PTSC membrane containing 33.5 wt% in the form of 2.9 nm gold nanoparticles (AuNPs) by a three step simple and scalable procedure. It showed outstanding results in all of the areas mentioned above and demonstrated catalytic activity for the reduction of 4-Nitrophenol (4−NP) to 4-Aminophenol (4−AP). The current exponential demand of gold for electronics has encouraged the development of efficient processes to recycle it. Several adsorbents used to recover gold from acidic solutions can be found in the literature with outstanding maximum uptakes,yet, poor kinetics leading to an overall inefficient process. The method developed in this dissertation consisted in permeating the gold-containing solution through a PTSC membrane that will capture all the Au ions by forming a metal complex with them. Forcing the ions through the pores of the membrane eliminates the diffusion limitations and the adsorption will only depended on the fast complexation kinetics, resulting in a very efficient process. A flux as high as 1868 L/h m2 was enough to capture >90% of the precious metal present in a solution of 100 ppm Au. The maximum uptake achieved without sacrificing
Gold mineralogy and extraction
International Nuclear Information System (INIS)
Cashion, J.D.; Brown, L.J.
1998-01-01
Several examples are examined in which Moessbauer spectroscopic analysis of gold mineral samples, treated concentrates and extracted species has provided information not obtainable by competing techniques. Descriptions are given of current work on bacterial oxidation of pyritic ores and on the adsorbed species from gold extracted from cyanide and chloride solutions onto activated carbon and polyurethane foams. The potential benefits for the gold mining industry from Moessbauer studies and some limitations on the use of the technique are also discussed
Gold mineralogy and extraction
Energy Technology Data Exchange (ETDEWEB)
Cashion, J.D.; Brown, L.J. [Monash University, Physics Department (Australia)
1998-12-15
Several examples are examined in which Moessbauer spectroscopic analysis of gold mineral samples, treated concentrates and extracted species has provided information not obtainable by competing techniques. Descriptions are given of current work on bacterial oxidation of pyritic ores and on the adsorbed species from gold extracted from cyanide and chloride solutions onto activated carbon and polyurethane foams. The potential benefits for the gold mining industry from Moessbauer studies and some limitations on the use of the technique are also discussed.
Idrus, Arifudin; Nur, I; Warmada, I. W; Fadlin, Fadlin
2011-01-01
DOI: 10.17014/ijog.v6i1.114In 2008, placer gold was discovered in Langkowala area (Bombana Regency), Southeast Sulawesi, Indonesia, and more than 60,000 traditional gold miners in the early 2009 have been operating by digging vertical pits and panning active stream sediments. The grade of placer gold ranges from 50 to 140 g/t. Local geological framework indicates that the placer gold is not related to volcanic rock-related hydrothermal gold deposit, e.g. epithermal, skarn or porphyry. This pa...
Wang, Jin-Yu; Wang, Xin-Ting; Wang, Lin-Lin; Jia, Cun-Xian
2015-01-01
Suicide is an important public problem, the mechanism of which has not been clarified. Many studies have focused on the molecular, biological and genetic mechanisms of suicide. Brain-derived neurotrophic factor (BDNF) G196A is one of the most leading loci in recent studies, but the results are inconsistent. We conducted a 1:1 age- and sex-matched case-control study in rural areas of Shandong Province, China. A total of 365 pairs of cases and controls were finally recruited into our study. The adjusted odds ratios (AORs) of BDNF 196G/G and their 95% confidence intervals (CIs) were calculated by multivariate conditional logistic regression models. No association between BDNF polymorphisms and attempted suicide was found in the overall population. However, the BDNF 196G/G genotype was significantly related to attempted suicide in the elderly population (AOR = 7.85, 95% CI: 1.12-54.90, p = 0.038), while the associations were not significant in young and middle-aged groups. Our study suggests that the BDNF 196G/G genotype increases the risk of attempted suicide in elderly people. © 2015 S. Karger AG, Basel.
Meta-Analysis of the Association between Mir-196a-2 Polymorphism and Cancer Susceptibility
International Nuclear Information System (INIS)
Zhang, Huan; Su, Yu-liang; Yu, Herbert; Qian, Bi-yun
2012-01-01
MicroRNA plays a vital role in gene expression, and microRNA dysregulation is involved in carcinogenesis. The miR-196a-2 polymorphism rs11614913 is reportedly associated with cancer susceptibility. This meta-analysis was performed to assess the overall association of miR-196a-2 with cancer risk. A total of 27 independent case-control studies involving 10,435 cases and 12,075 controls were analyzed for the rs11614913 polymorphism. A significant association was found between rs11614913 polymorphism and cancer risk in four genetic models (CT vs. TT, OR=1.15, 95%CI=1.05–1.27; CC vs. TT, OR=1.23, 95%CI=1.08–1.39; Dominant model, OR=1.17, 95%CI=1.06–1.30; Additive model, OR=1.08, 95%CI=1.01–1.14). In the subgroup analysis of different tumor types, the C allele was associated with increased risk of lung, breast, and colorectal cancer, but not with liver, gastric, or esophageal cancer. In the subgroup analysis by ethnicity, a significantly increased risk of cancer was found among Asians in all genetic models, but no associations were found in the Caucasian subgroup. The meta-analysis demonstrated that the miR-196a-2 polymorphism is associated with cancer susceptibility, especially lung cancer, colorectal cancer, and breast cancer among Asian populations
Nanotoxicity of gold and gold-cobalt nanoalloy.
Girgis, E; Khalil, W K B; Emam, A N; Mohamed, M B; Rao, K V
2012-05-21
Nanotoxicology test of gold nanoparticles (Au NPs) and gold-cobalt (Au-Co) nanoalloy is an important step in their safety evaluation for biomedical applications. The Au and Au-Co NPs were prepared by reducing the metal ions using sodium borohydride (NaBH(4)) in the presence of polyvinyl pyrrolidone (PVP) as a capping material. The average size and shape of the nanoparticles (NPs) were characterized using high resolution transmission electron microscopy (HRTEM). Cobalt presence in the nanoalloy was confirmed by energy dispersive X-ray spectroscopy (EDX) analysis, and the magnetic properties of these particles were determined using a vibrating sample magnetometer (VSM). The Gold and gold-cobalt NPs of average size 15 ± 1.5 nm were administered orally to mice with a dose of 80, 160, and 320 mg/kg per body weight (bw) using gavages. Samples were collected after 7 and 14 days of the treatment. The results indicated that the Au-Co NPs were able to induce significant alteration in the tumor-initiating genes associated with an increase of micronuclei (MNs) formation and generation of DNA adduct (8-hydroxy-2-deoxyguanosine, 8-OHdG) as well as a reduction in the glutathione peroxidase activity. This action of Au-Co NPs was observed using 160 and 320 mg/kg bw at both time intervals. However, Au NPs had much lower effects than Au-Co NPs on alteration in the tumor-initiating genes, frequency of MNs, and generation of 8-OHdG as well as glutathione peroxidase activity except with the highest dose of Au NPs. This study suggests that the potential to cause in vivo genetic and antioxidant enzyme alterations due to the treatment by Au-Co nanoalloy may be attributed to the increase in oxidative stress in mice.
Lifetime measurements of excited states in 196Pt
International Nuclear Information System (INIS)
Bolotin, H.H.; Katayama, Ichiro; Sakai, Hideyuki; Fujita, Yoshitaka; Fujiwara, Mamoru
1979-01-01
The lifetimes of six excited states in 196 Pt up to an excitation energy of 1525 keV were measured by the recoil-distance method (RDM). These levels were populated by Coulomb excitation using both 90 MeV 20 Ne and 220 MeV 58 Ni ion beams. The measured lifetimes of the 2 1 + , 4 1 + , 6 1 + , 2 2 + , 4 2 + and 0 2 + states and the B(E2) values inferred for the depopulating transitions from these levels are presented. With the exception of the 2 1 + state, the meanlives of all other levels are the first such direct experimental determinations to be reported. (author)
In harmony with gold and uranium
International Nuclear Information System (INIS)
Anon.
1983-01-01
A profile is given on Mr Clive Knobbs as managing director of Harmony gold mine. From March 1 1983 he succeeded as deputy chairman of the group's gold and uranium division, and became the Rand Mines representative on the Gold Producers Committee and the Executive Committee of the Chamber of Mines. The article also takes a look at gold and uranium mining in general
The extractive metallurgy of gold
Kongolo, K.; Mwema, M. D.
1998-12-01
Mössbauer spectroscopy has been successfully used in investigation of the gold compounds present in ores and the gold species which occur during the process metallurgy of this metal. This paper is a survey of the basic recovery methods and techniques used in extractive metallurgy of gold. Process fundamentals on mineral processing, ore leaching, zinc dust cementation, adsorption on activated carbon, electrowinning and refining are examined. The recovery of gold as a by-product of the copper industry is also described. Alternative processing methods are indicated in order to shed light on new interesting research topics where Mössbauer spectroscopy could be applied.
The extractive metallurgy of gold
International Nuclear Information System (INIS)
Kongolo, K.; Mwema, M.D.
1998-01-01
Moessbauer spectroscopy has been successfully used in investigation of the gold compounds present in ores and the gold species which occur during the process metallurgy of this metal. This paper is a survey of the basic recovery methods and techniques used in extractive metallurgy of gold. Process fundamentals on mineral processing, ore leaching, zinc dust cementation, adsorption on activated carbon, electrowinning and refining are examined. The recovery of gold as a by-product of the copper industry is also described. Alternative processing methods are indicated in order to shed light on new interesting research topics where Moessbauer spectroscopy could be applied
The extractive metallurgy of gold
Energy Technology Data Exchange (ETDEWEB)
Kongolo, K.; Mwema, M.D. [University of Lubumbashi, Zaire, Gecamines Metallurgical Research Centre, Likasi, Zaire, c/o Gecamines Brussels (Belgium)
1998-12-15
Moessbauer spectroscopy has been successfully used in investigation of the gold compounds present in ores and the gold species which occur during the process metallurgy of this metal. This paper is a survey of the basic recovery methods and techniques used in extractive metallurgy of gold. Process fundamentals on mineral processing, ore leaching, zinc dust cementation, adsorption on activated carbon, electrowinning and refining are examined. The recovery of gold as a by-product of the copper industry is also described. Alternative processing methods are indicated in order to shed light on new interesting research topics where Moessbauer spectroscopy could be applied.
Recovery of carrier-free gold-195
International Nuclear Information System (INIS)
Iofa, B.Z.; Ivanova, N.A.
1995-01-01
It is known that gold(III) is readily extracted from nitric acid solutions with ethers. The authors have studied extraction of trace amounts of gold(III) from nitric acid solutions with diethyl and diisopropyl ethers in the presence of significant excess of Pt(IV). Distribution coefficients of gold(III) were measured radiometrically using carrier-free gold-195 or spectrophotometrically in the presence of platinum(IV). Very high coefficients of gold separation from platinum may be achieved. Preliminary experiments have shown that zinc-65 was not extracted with ethers from nitric acid solutions. As an extraction system, the authors have chosen the system 10 M HNO 3 -diisopropyl ether. After model experiments, the authors have performed recovery of carrier-free gold-195 from a real platinum target irradiated with protons in a cyclotron
Theoretical designs of 19.6 nm Ne-like Ge XRL source
International Nuclear Information System (INIS)
Zhang Guoping; Zhang Tanxin; Zheng Wudi
2004-01-01
19.6 nm Ne-like Ge X-ray laser (XRL) can be used as a source to diagnose Rayleigh-Taylor instability in laser induced plasma. In this paper, systemic optimum designs and theoretical analysis to Ne-like Ge XRL driven by pre-main short pulses were conducted by a series of codes, which had been tested by experiments. Simulation results show that, adopting driven conditions of 2%-3% pre-pulse, 6-8 ns pre-main pulse interval and 40 TW/cm 2 power intensity, a gain area of 19.6 nm laser line beyond 60 μm and gain duration of 90 ps can be obtained. Furthermore, with 16 mm plane target, the gain gets to 11.8/cm, and if 6 mrad/cm curved target is adopted, it reaches to 13.3/cm, and small signal gain-length product of single target is about 21.3, which means that saturated gain can be realized by a single target. With double targets opposite coupling, gain-length product can reach 38.4, deep saturation can be gotten, and XRL source required by demonstration of application is out of question
Gold--a controversial sensitizer
DEFF Research Database (Denmark)
Bruze, M; Andersen, Klaus Ejner
1999-01-01
allergy to gold sodium thiosulfate were published at the beginning of the 1990s, the allergic nature of the reported positive patch test reactions to gold was questioned. The major argument for such questioning was the lack of demonstrable clinical relevance in most positive reactors. A major reason......Until recently, gold allergy was considered to be extremely rare. Gold has been used and worshipped for thousands of years without any obvious complaints of skin problems, either in those participating in mining and other ways of prospecting, or in those wearing jewellery. When studies on contact...... for the questioning may have been confusion in differentiating between contact allergy and allergic contact dermatitis. To arrive at a diagnosis of allergic contact dermatitis, 3 steps have, in principle, to be fulfilled: (i) establishment of contact allergy; (ii) demonstration of present exposure; (iii) assessment...
32 CFR 196.425 - Counseling and use of appraisal and counseling materials.
2010-07-01
... 32 National Defense 2 2010-07-01 2010-07-01 false Counseling and use of appraisal and counseling... Programs or Activities Prohibited § 196.425 Counseling and use of appraisal and counseling materials. (a) Counseling. A recipient shall not discriminate against any person on the basis of sex in the counseling or...
Efraín Sánchez Cabra
2003-01-01
On 22 december 1939, the Banco de la República, the Central Bank of Colombia, purchased a 23.5 centimetres high pre-Columbian gold arte fact weighing 777·7 grams that was to become the Gold M useum's foundation stone. Described as a Quimbaya poporo, it is a masterpiece of pre-Hispanic goldwork, an object of beauty whose brightly burnished body and neck, crowned with four sphere-like or naments, rest on an exquisite cast metal tiligree base and which seems to ftoat in a space of its own. The b...
Gold nano-particles fixed on glass
International Nuclear Information System (INIS)
Worsch, Christian; Wisniewski, Wolfgang; Kracker, Michael; Rüssel, Christian
2012-01-01
Highlights: ► We produced wear resistant gold–ruby coatings on amorphous substrates. ► Thin sputtered gold layers were covered by or embedded in silica coatings. ► Annealing above T g of the substrate glass led to the formation of gold nano particles. ► A 1 1 1-texture of the gold particles is observed via XRD and EBSD. ► EBSD-patterns can be acquired from crystals covered by a thin layer of glass. - Abstract: A simple process for producing wear resistant gold nano-particle coatings on transparent substrates is proposed. Soda-lime-silica glasses were sputtered with gold and subsequently coated with SiO 2 using a combustion chemical vapor deposition technique. Some samples were first coated with silica, sputtered with gold and then coated with a second layer of silica. The samples were annealed for 20 min at either 550 or 600 °C. This resulted in the formation of round, well separated gold nano-particles with sizes from 15 to 200 nm. The color of the coated glass was equivalent to that of gold–ruby glasses. Silica/gold/silica coatings annealed at 600 °C for 20 min were strongly adherent and scratch resistant. X-ray diffraction and electron backscatter diffraction (EBSD) were used to describe the crystal orientations of the embedded particles. The gold particles are preferably oriented with their (1 1 1) planes perpendicular to the surface.
Nature vs. nurture: gold perpetuates "stemness".
Paul, Willi; Sharma, Chandra P; Deb, Kaushik Dilip
2011-01-01
Adult tissues contain quiescent reservoirs of multipotent somatic stem cells and pluripotent embryonic-like stem cells (ELSCs). Credited with regenerative properties gold is used across both -contemporary and -ancient medicines. Here, we show that gold exerted these effects by enhancing the pool of pluripotent ELSC while improving their stemness. We used hESCs as an in-vitro model to understand if gold could enhance self-renewal and pluripotency. Swarna-bhasma (SB), an ancient Indian gold microparticulate (41.1 nm), preparation, reduced spontaneous-differentiation, improved self-renewal, pluripotency and proliferation of hESCs. Colloidal gold-nanoparticles (GNP) (15.59 nm) were tested to confirm that the observations were attributable to nanoparticulate-gold. SB and GNP exposure: maintained -stemness, -karyotypic stability, enhanced pluripotency till day-12, increased average colony-sizes, and reduced the number of autonomously-derived differentiated FGFR1 positive fibroblast-niche-cells/colony. Particulate-gold induced upregulation of FGFR1 and IGF2 expression, and decrease in IGF1 secretion indicates IGF1/2 mediated support for enhanced pluripotency and self-renewal in hESCs.
Fracture toughness testing of V-4Cr-4Ti at 25{degrees}C and -196{degrees}C
Energy Technology Data Exchange (ETDEWEB)
Li, H.X.; Kurtz, R.J. [Pacific Northwest National Lab., Richland, WA (United States)
1996-10-01
Measurements of the fracture toughness of the production-scale heat (832665) of V-4Cr-4Ti have been performed at 25{degrees}C and {minus}196{degrees}C using compact tension (CT) specimens. Test specimens were vacuum annealed at either 1000{degrees}C for 1 hour (HT1) or 1050{degrees}C for two hours (HT2). Specimens given the HT1 treatment were annealed after final machining, whereas the HT2 specimens received the 1050{degrees}C anneal at Teledyne Wah Chang prior to final machining. Following machining HT2 specimens were then vacuum annealed at 180{degrees}C for two hours to remove hydrogen. Specimens treated using HT1 had a partially recrystallized microstructure and those treated using HT2 had a fully recrystallized microstructure. The fracture toughness at 25{degrees}C was determined by J-integral tests and at {minus}196{degrees}C by ASTM E 399 type tests. Toughness values obtained at {minus}196{degrees}C were converted to J-integral values for comparison to the 25{degrees}C data. The 25{degrees}C fracture toughness was very high with none of the specimens giving valid results per ASTM criteria. Specimens fractured by microvoid coalescence. The fracture toughness at {minus}196{degrees}C was much lower than that at 25{degrees}C and the fracture surface showed predominantly cleavage features. The present results show a transition from ductile to brittle behavior with decreasing test temperature which is not observed from one-third scale Charpy impact tests. The fracture toughness at {minus}196{degrees}C was still quite high, however, at about 75 kJ/m{sup 2}. Delaminations in planes normal to the thickness direction were seen at both test temperatures. Fracture surfaces inside the delaminations exhibited nearly 100% cleavage facets. The cause of the brittle delaminations was not determined, but will be a subject for further investigation.
Roman Policies towards Antiochus III and the Greeks from Winter 197/196 B.C. to Autumn 196 B.C.
Directory of Open Access Journals (Sweden)
Deutschmann, Eike Hellmut
2012-01-01
Full Text Available In the Second Macedonian War (200-196 B.C., the res publica reduced the strength of the enemy King Philip V apparently to establish a new political order in Southern Balkans: Assumedly a pro-Roman balance of forces should prevail there, untainted by influence of another major power. A particular senatorial policy towards the Greeks probably did not exist before the fighting in Hellas came to an end in summer 197 B.C. In the same year, the Seleucid king Antiochus III brought large parts of the west coast of Asia Minor under control and set about crossing the Hellespont. Rome subsequently stylized itself as the guardian of freedom for the Greeks living in Hellas and Asia Minor. The statesmen of the res publica could have perceived Antiochus’ expansion as a threat to the mentioned new order. Therefore, the Roman Policy of Freedom was possibly applied primarily to take action against the Seleucid king. Die res publica verminderte im Zweiten Makedonischen Krieg (200-196 a.c. die Macht des gegnerischen Königs Philipp V - anscheinend um eine neue politische Ordnung im südlichen Balkanraum zu etablieren: Vermutlich sollte dort ein romfreundliches Kräftegleichgewicht vorherrschen, auf das keine andere Großmacht Einfluß hat. Eine speziell an die Griechen gerichtete Politik seitens des römischen Senats gab es wahrscheinlich nicht vor Ende der Kampfhandlungen in Hellas im Sommer 197 a.c. In dem Jahr erweiterte der seleukidische König Antiochos III. seinen Einflussbereich auf große Teile der kleinasiatischen Westküste und schickte sich an, den Hellespont zu überqueren. Rom stilisierte sich in der Folgezeit zum Freiheitsgarant der in Hellas und Kleinasien lebenden Griechen. Antiochos Expansion könnte von den Staatsmännern der res publica als Bedrohung der genannten neuen Ordnung angesehen worden sein. Demzufolge wurde die römische Freiheitspolitik möglicherweise in erster Linie angewendet, um gegen den seleukidischen König vorzugehen.
Carbonate hosted gold deposit in Tasmania, Australia
International Nuclear Information System (INIS)
Abadi, M.H.
1999-01-01
Full text: This study uses elemental and isotopic composition of carbonates associated with gold from Henty and Beaconsfield in Tasmania, Australia, to illustrate source of gold-bearing fluids, salinity, temperature and dissolution and reprecipitation of carbonate. The Beaconsfield and Henty gold mines are located in northern and western Tasmania respectively. Gold mineralisation in Beaconsfield occurs within the quartz-carbonate Tasmania Reef (Lower to Middle Palaeozoic sequence, Hills, 1998). The Henty gold mine is located at the base of the Cambrian Tyndall Group (volcano-sedimentary succession, White and McPhie, 1996) close to Henty Fault. Gold in carbonate samples from Henty ranges from 7.7 to 9360 ppm and in Beaconsfield ranges from 0.01 to 434 ppm. The amount of carbonate in samples from Henty and Beaconsfield gold mines varies from approximately 24 to 99.8%. Bivariate plot of Ca relative to total amounts of Mg, Fe and Mn illustrates that the major carbonate minerals at Beaconsfield and Henty gold mines are magnesian ankerite and calcite. The difference in carbonate mineralogy, at Henty and Beaconsfield gold mines, is attributed to the composition of fluids responsible for carbonate alteration. Gold and magnesium in Beaconsfield ankerite are derived from the leaching of Cambrian ultramafic rocks during the Devonian by the passage of meteoric fluids through tectonically affected Ordovician carbonates (Rao and Adabi, 1999). The total concentration of Fe and Mn are low (0.5 to 2%) in Henty and high (1 to 17.5%) in Beaconsfield ankerite, possibly due to oxidising conditions at Henty and reducing conditions at Beaconsfield gold mines during gold mineralisation. Variation of Sr values between Beaconsfield ankerite and Henty calcite is related to dissolution of limestone that increase Sr concentrations in gold mineralising fluids. Na values in both Beaconsfield (20 to 1100 ppm) and Henty carbonates (25 to 1650 ppm) suggest low salinity fluids responsible for gold
Confining hot spots in 3C 196 - implications for QSO-companion galaxies
International Nuclear Information System (INIS)
Brown, R.L.; Broderick, J.J.; Mitchell, K.J.; Virginia Polytechnic Institute and State Univ., Blacksburg; NASA, Goddard Space Flight Center, Greenbelt, MD)
1986-01-01
VLBI observations of the extremely compact hot spot in the northern radio lobe of the QSO 3C 196 reveal the angular size of its smallest substructure to be 0.065 arcsec x 0.045 arcsec or about 300 pc at the redshift distance. The morphology of the hot spot and its orientation relative to the more diffuse radio emission suggest that it is formed by an oblique interaction between the nuclear QSO jet and circum-QSO cloud. The inferred density in this cloud, together with its apparent size, imply that the cloud contains a galactic mass, greater than a billion solar masses of gas. The effect of the jet will be to hasten gravitational collapse of the cloud. If many QSOs such as 3C 196 are formed or found in gas-rich environments, the QSO radio phase may commonly stimulate the metamorphosis of circum-QSO gas to QSO-companion galaxies or it may play a significant part in catalyzing star formation in existing companions. 30 references
Cross section of the 197Au(n,2n196Au reaction
Directory of Open Access Journals (Sweden)
Kalamara A.
2017-01-01
Full Text Available The 197Au(n,2n196Au reaction cross section has been measured at two energies, namely at 17.1 MeV and 20.9 MeV, by means of the activation technique, relative to the 27Al(n,α24Na reference reaction cross section. Quasi-monoenergetic neutron beams were produced at the 5.5 MV Tandem T11/25 accelerator laboratory of NCSR “Demokritos”, by means of the 3H(d,n4He reaction, implementing a new Ti-tritiated target of ∼ 400 GBq activity. The induced γ-ray activity at the targets and reference foils has been measured with HPGe detectors. The cross section for the population of the second isomeric (12− state m2 of 196Au was independently determined. Auxiliary Monte Carlo simulations were performed using the MCNP code. The present results are in agreement with previous experimental data and with theoretical calculations of the measured reaction cross sections, which were carried out with the use of the EMPIRE code.
Energy Technology Data Exchange (ETDEWEB)
Lee, K. M.; Sun, G. M. [KAERI, Daejeon (Korea, Republic of)
2016-05-15
The purpose of this study is to develop fake gold bar detecting method by using Prompt-gamma activation analysis (PGAA) facility at the Korea Atomic Energy Research Institute (KAERI). PGAA is an established nuclear analytical technique for non-destructive determination of elemental and isotopic compositions. For a preliminary study on detecting fake gold bar, Monte Carlo simulation of neutron transmission in gold bar was conducted and the possibility for detecting fake gold bar was confirmed. Under the gold bullion standard, it guaranteed the government would redeem any amount of currency for its value in gold. After the gold bullion standard ended, gold bars have been the target for investment as ever. But it is well known that fake gold bar exist in the gold market. This cannot be identified easily without performing a testing as it has the same appearance as the pure gold bar. In order to avoid the trading of fake gold bar in the market, they should be monitored thoroughly. Although the transmissivity of cold neutrons are low comparing that of thermal neutrons, the slower neutrons are more apt to be absorbed in a target, and can increase the prompt gamma emission rate. Also the flux of both thermal and cold neutron beam is high enough to activate thick target. If the neutron beam is irradiated on the front and the reverse side of gold bar, all insides of it can be detected.
International Nuclear Information System (INIS)
Lee, K. M.; Sun, G. M.
2016-01-01
The purpose of this study is to develop fake gold bar detecting method by using Prompt-gamma activation analysis (PGAA) facility at the Korea Atomic Energy Research Institute (KAERI). PGAA is an established nuclear analytical technique for non-destructive determination of elemental and isotopic compositions. For a preliminary study on detecting fake gold bar, Monte Carlo simulation of neutron transmission in gold bar was conducted and the possibility for detecting fake gold bar was confirmed. Under the gold bullion standard, it guaranteed the government would redeem any amount of currency for its value in gold. After the gold bullion standard ended, gold bars have been the target for investment as ever. But it is well known that fake gold bar exist in the gold market. This cannot be identified easily without performing a testing as it has the same appearance as the pure gold bar. In order to avoid the trading of fake gold bar in the market, they should be monitored thoroughly. Although the transmissivity of cold neutrons are low comparing that of thermal neutrons, the slower neutrons are more apt to be absorbed in a target, and can increase the prompt gamma emission rate. Also the flux of both thermal and cold neutron beam is high enough to activate thick target. If the neutron beam is irradiated on the front and the reverse side of gold bar, all insides of it can be detected
DEFF Research Database (Denmark)
Larsen, Agnete; Kolind, Kristian; Pedersen, Dan Sonne
2008-01-01
neural stem cell response. We conclude that bio-liberated gold ions possess pronounced anti-inflammatory and neuron-protective capacities in the brain and suggest that metallic gold has clinical potentials. Intra-cerebral application of metallic gold as a pharmaceutical source of gold ions represents......Traumatic brain injury results in loss of neurons caused as much by the resulting neuroinflammation as by the injury. Gold salts are known to be immunosuppressive, but their use are limited by nephrotoxicity. However, as we have proven that implants of pure metallic gold release gold ions which do...... not spread in the body, but are taken up by cells near the implant, we hypothesize that metallic gold could reduce local neuroinflammation in a safe way. Bio-liberation, or dissolucytosis, of gold ions from metallic gold surfaces requires the presence of disolycytes i.e. macrophages and the process...
Intensification Behavior of Mercury Ions on Gold Cyanide Leaching
Directory of Open Access Journals (Sweden)
Qiang Zhong
2018-01-01
Full Text Available Cyanidation is the main method used to extract gold from gold raw materials; however, a serious problem with this method is the low leaching rate. In order to improve gold leaching, the intensification behavior of mercury ions on gold cyanide leaching, for two types of materials, sulphide gold concentrate and oxide gold ore, was investigated. The results showed that mercury ions, with only a 10−5 M dosage, could significantly intensify leaching and gold recovery. The dissolution behavior of gold plate was also intensified by 10−5 M mercury ions. Microstructure analysis showed that mercury ions intensified the cyanidation corrosion of the gold surface, resulting in a loose structure, where a large number of deep ravines and raised particles were evident across the whole gold surface. The loose structure added contact surface between the gold and cyanide, and accelerated gold dissolution. Moreover, mercury ions obstructed the formation of insoluble products, such as AuCN, Au(OHCN, and Au(OHx, that lead to a passivation membrane on the gold surface, reducing contact between the gold and cyanide. These effects, brought about by mercury ions, change the structure and product of the gold surface during gold cyanidation and promote gold leaching.
International Nuclear Information System (INIS)
Salamandra Martinez, Carlos
2004-01-01
The main purpose of this work is to offer a general panoramic of the processes or experiences pilot that are carried out in the Project Green Gold, as strategy of environmental sustainability and organizational invigoration in Choco, especially in the 12 communities of the municipalities of Tado and Condoto. It is also sought to offer a minimum of information on the techniques of handmade production and to show the possibilities to carry out in a rational way the use and use of the natural resources. The Project Green Gold is carried out by the Corporation Green Gold (COV) and co-financed with resources of international and national character, the intervention of the financial resources it achievement mainly for the use of clean processes in the extraction stages and metals benefit. The project is centered primarily in the absence of use of products or toxic substances as the mercury, fair trade, organizational invigoration, execution of 11 approaches and certification of the metals Gold and Platinum. The COV, it has come executing the proposal from the year 2001 with the premise of contributing to the balance between the rational exploitation of the natural resources and the conservation of the environment in the Choco. In the project they are used technical handmade characteristic of the region framed inside the mining activity and production activities are diversified in the productive family units. Those producing with the support of entities of juridical character, specify the necessary game rules for the extraction and products commercialization
Gold nanoparticles produced in a microalga
International Nuclear Information System (INIS)
Luangpipat, Tiyaporn; Beattie, Isabel R.; Chisti, Yusuf; Haverkamp, Richard G.
2011-01-01
An efficient biological route to production of gold nanoparticles which allows the nanoparticles to be easily recovered remains elusive. Live cells of the green microalga Chlorella vulgaris were incubated with a solution of gold chloride and harvested by centrifugation. Nanoparticles inside intact cells were identified by transmission electron microscopy and confirmed to be metallic gold by synchrotron based X-ray powder diffraction and X-ray absorption spectroscopy. These intracellular gold nanoparticles were 40–60 nm in diameter. At a concentration of 1.4% Au in the alga, a better than 97% recovery of the gold from solution was achieved. A maximum of 4.2% Au in the alga was obtained. Exposure of C. vulgaris to solutions containing dissolved salts of palladium, ruthenium, and rhodium also resulted in the production of the corresponding nanoparticles within the cells. These were surmised to be also metallic, but were produced at a much lower intracellular concentration than achieved with gold. Iridium was apparently toxic to the alga. No nanoparticles were observed using platinum solutions. C. vulgaris provides a possible route to large scale production of gold nanoparticles.
Mavrodi, Olga V; Mavrodi, Dmitri V; Weller, David M; Thomashow, Linda S
2006-11-01
Pseudomonas fluorescens Q8r1-96 produces 2,4-diacetylphloroglucinol (2,4-DAPG), a polyketide antibiotic that suppresses a wide variety of soilborne fungal pathogens, including Gaeumannomyces graminis var. tritici, which causes take-all disease of wheat. Strain Q8r1-96 is representative of the D-genotype of 2,4-DAPG producers, which are exceptional because of their ability to aggressively colonize and maintain large populations on the roots of host plants, including wheat, pea, and sugar beet. In this study, three genes, an sss recombinase gene, ptsP, and orfT, which are important in the interaction of Pseudomonas spp. with various hosts, were investigated to determine their contributions to the unusual colonization properties of strain Q8r1-96. The sss recombinase and ptsP genes influence global processes, including phenotypic plasticity and organic nitrogen utilization, respectively. The orfT gene contributes to the pathogenicity of Pseudomonas aeruginosa in plants and animals and is conserved among saprophytic rhizosphere pseudomonads, but its function is unknown. Clones containing these genes were identified in a Q8r1-96 genomic library, sequenced, and used to construct gene replacement mutants of Q8r1-96. Mutants were characterized to determine their 2,4-DAPG production, motility, fluorescence, colony morphology, exoprotease and hydrogen cyanide (HCN) production, carbon and nitrogen utilization, and ability to colonize the rhizosphere of wheat grown in natural soil. The ptsP mutant was impaired in wheat root colonization, whereas mutants with mutations in the sss recombinase gene and orfT were not. However, all three mutants were less competitive than wild-type P. fluorescens Q8r1-96 in the wheat rhizosphere when they were introduced into the soil by paired inoculation with the parental strain.
Gold Nanoparticle Mediated Phototherapy for Cancer
International Nuclear Information System (INIS)
Yao, C.; Zhang, L.; Wang, J.; He, Y.; Xin, J.; Wang, S.; Xu, H.; Zhang, Z.
2016-01-01
Gold nanoparticles exhibit very unique physiochemical and optical properties, which now are extensively studied in range of medical diagnostic and therapeutic applications. In particular, gold nanoparticles show promise in the advancement of cancer treatments. This review will provide insights into the four different cancer treatments such as photothermal therapy, gold nanoparticle-aided photodynamic therapy, gold nanoparticle-aided radiation therapy, and their use as drug carrier. We also discuss the mechanism of every method and the adverse effects and its limitations
Kalies, Stefan; Gentemann, Lara; Schomaker, Markus; Heinemann, Dag; Ripken, Tammo; Meyer, Heiko
2014-01-01
Gold nanoparticle mediated (GNOME) laser transfection/perforation fulfills the demands of a reliable transfection technique. It provides efficient delivery and has a negligible impact on cell viability. Furthermore, it reaches high-throughput applicability. However, currently only large gold particles (> 80 nm) allow successful GNOME laser perforation, probably due to insufficient sedimentation of smaller gold nanoparticles. The objective of this study is to determine whether this aspect can be addressed by a modification of silica particles with gold nanoparticles. Throughout the analysis, we show that after the attachment of gold nanoparticles to silica particles, comparable or better efficiencies to GNOME laser perforation are reached. In combination with 1 µm silica particles, we report laser perforation with gold nanoparticles with sizes down to 4 nm. Therefore, our investigations have great importance for the future research in and the fields of laser transfection combined with plasmonics. PMID:25136494
2010-01-01
... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false When will Commerce entities allow a debtor to pay a Commerce debt in installments instead of one lump sum? 19.6 Section 19.6 Commerce and Foreign Trade Office of the Secretary of Commerce COMMERCE DEBT COLLECTION Procedures To Collect Commerce...
Linear Optical Properties of Gold Colloid
Directory of Open Access Journals (Sweden)
Jingmin XIA
2015-11-01
Full Text Available Gold colloid was prepared by reducing HAuCl4·4H2O with Na3C6H5O7·2H2O. The morphology, size of gold nanoparticles and the optical property of colloid were characterized by transmission electron microscope and UV-Vis spectrophotometer, respectively. It shows that the gold nanoparticles are in the shape of spheres with diameters less than 8 nm, and the surface plasmon resonance absorption peak is located at about 438 nm. As the volume fraction of gold particles increases, the intensity of absorption peak strengthens. The optical property of gold colloid was analyzed by Maxwell-Garnett (MG effective medium theory in the company of Drude dispersion model. The results show that the matrix dielectric constant is a main factor, which influences the optical property of gold colloid.DOI: http://dx.doi.org/10.5755/j01.ms.21.4.9558
Coal-oil assisted flotation for the gold recovery
Energy Technology Data Exchange (ETDEWEB)
Sen, S.; Seyrankaya, A.; Cilingir, Y. [Dokuz Eylul University, Izmir (Turkey). Mining Engineering Department
2005-09-01
Using coal-oil agglomeration method for free or native gold recovery has been a research subject for many researchers over the years. In this study, a new approach 'coal-oil assisted gold flotation' was used to recover gold particles. The coal-oil-gold agglomeration process considers the preferential wetting of coal and gold particles. The method takes advantage of the greater hydrophobicity and oleophilicity of coal and gold compared to that the most gangue materials. Unlike the previous studies about coal-oil-gold agglomeration, this method uses a very small amount of coal and agglomerating agents. Some experiments were conducted on synthetic gold ore samples to reveal the reaction of the coal-oil assisted gold flotation process against the size and the number of gold particles in the feed. It was observed that there is no significant difference in process gold recoveries for feeds assaying different Au. Although there was a slight decrease for coarse gold particles, the process seems to be effective for the recovery of gold grains as coarse as 300 {mu} m. The decrease in the finest size ({lt} 53 {mu} m) is considered to be the decrease in the collision efficiency between the agglomerates and the finest gold particles. The effect of changing coal quantity for constant ore and oil amounts was also investigated. The experiments showed that the process gives very similar results for both artificial and natural ore samples; the best results have been obtained by using 30/1 coal-oil ratio.
International Nuclear Information System (INIS)
Hoehn, R.; Herzig, C.
1986-01-01
The thermodynamic activity of the gold component was directly measured in Au-Pd alloys in the concentration range between X Au =0.048 and 0.850 and in the temperature range 1070 and 1300 K. The ratio of the vapour pressures of pure gold and of the gold component of the alloys was determined - after effusion from a Knudsen twin cell and condensation on a collecting plate - by analysing the decay rate of the radioisotopes 195 Au and 198 Au in an intrinsic germanium well-type detector. The partial mixing enthalpy and the partial mixing entropy of Au were directly obtained from these results. By Gibbs-Duhem integration the integral mixing functions were deduced. Similar measurements were performed in several ternary Au-Ag-Pd alloys of fixed mole fraction X Ag /X Pd =1/9. A comparison of the directly measured partial free excess enthalpy of Au in these ternary alloys with data obtained by the approximate models of Kohler, Toop and Bonnier using data of the corresponding three binary systems yields satisfactory agreement. (orig.) [de
Cancer caused by radioactive gold rings
International Nuclear Information System (INIS)
Callary, E.M.
1989-01-01
Two recent cases of skin cancer caused by radioactive gold rings are described. The gold was contaminated with radon daughters from hollow goldseeds used to hold radon, back in the 1930s or possibly later. Other radioactive gold rings are probably being worn. The Canadian AECB offers free testing
Directory of Open Access Journals (Sweden)
Giacoppo F.
2015-01-01
Full Text Available An excess of strength on the low-energy tail of the giant dipole resonance recently has been observed in the γ-decay from the quasicontinuum of 195,196Pt. The nature of this phenomenon is not yet fully investigated. If this feature is present also in the γ-ray strength of the neutron-rich isotopes, it can affect the neutron-capture reactions involved in the formation of heavy-elements in stellar nucleosynthesis. The experimental level density and γ-ray strength function of 195,196Pt are presented together with preliminary calculations of the corresponding neutron-capture cross sections.
Synthesis of camptothecin-loaded gold nanomaterials
International Nuclear Information System (INIS)
Xing Zhimin; Liu Zhiguo; Zu Yuangang; Fu Yujie; Zhao Chunjian; Zhao Xiuhua; Meng Ronghua; Tan Shengnan
2010-01-01
Camptothecin-loaded gold nanomaterials have been synthesized by the sodium borohydride reduction method under a strong basic condition. The obtained gold nanomaterials have been characterized by transmission electron microscopy (TEM), atomic force microscopy (AFM) and UV-vis absorption spectroscopy. The camptothecin-loaded gold colloidal solution was very stable and can be stored for more than two months at room temperature without obvious changes. The color of the colloidal solution can change from wine red to purple and blue during the acidifying process. It was revealed that the release of camptothecin and the aggregation of gold nanoparticles can be controlled by tuning the solution pH. The present study implied that the gold nanomaterials can be used as the potential carrier for CPT delivery.
Synthesis of camptothecin-loaded gold nanomaterials
Energy Technology Data Exchange (ETDEWEB)
Xing Zhimin [Key Laboratory of Forest Plant Ecology of Ministry of Education, Northeast Forestry University, Harbin 150040 (China); Engineering Research Center of Forest Bio-preparation, Ministry of Education, Northeast Forestry University, Harbin 150040 (China); Liu Zhiguo, E-mail: zguoliu@yahoo.com.cn [Key Laboratory of Forest Plant Ecology of Ministry of Education, Northeast Forestry University, Harbin 150040 (China); Engineering Research Center of Forest Bio-preparation, Ministry of Education, Northeast Forestry University, Harbin 150040 (China); Zu Yuangang, E-mail: nefunano@yahoo.com.cn [Key Laboratory of Forest Plant Ecology of Ministry of Education, Northeast Forestry University, Harbin 150040 (China); Engineering Research Center of Forest Bio-preparation, Ministry of Education, Northeast Forestry University, Harbin 150040 (China); Fu Yujie; Zhao Chunjian; Zhao Xiuhua; Meng Ronghua; Tan Shengnan [Key Laboratory of Forest Plant Ecology of Ministry of Education, Northeast Forestry University, Harbin 150040 (China); Engineering Research Center of Forest Bio-preparation, Ministry of Education, Northeast Forestry University, Harbin 150040 (China)
2010-04-01
Camptothecin-loaded gold nanomaterials have been synthesized by the sodium borohydride reduction method under a strong basic condition. The obtained gold nanomaterials have been characterized by transmission electron microscopy (TEM), atomic force microscopy (AFM) and UV-vis absorption spectroscopy. The camptothecin-loaded gold colloidal solution was very stable and can be stored for more than two months at room temperature without obvious changes. The color of the colloidal solution can change from wine red to purple and blue during the acidifying process. It was revealed that the release of camptothecin and the aggregation of gold nanoparticles can be controlled by tuning the solution pH. The present study implied that the gold nanomaterials can be used as the potential carrier for CPT delivery.
Albumin-gold-glutathione is a probable auranofin metabolite
International Nuclear Information System (INIS)
Shaw, C.F. III; Coffer, M.; Isab, A.A.
1989-01-01
The newly licensed gold drug, auranofin ((2,3,4,6-tetra-O-acetyl-β-1-D-gluco-pyranosato-S-)triethylphoshine-gold(I)) crosses cell membranes and enters cells which are inaccessible to parenteral gold drugs. In vivo, the triethylphosphine ligand and gold of auranofin, but not the thio-sugar moiety, accumulate in and subsequently efflux from red blood cells (RBCs). Extracellular albumin increases in the extent of gold efflux and acts as a gold binding site. The rate of efflux is first-order in RBC gold concentration. Studies using RBCs in which labelled [ 14 C]-glutathione is generated in situ incorporation of [ 14 C]- glycine demonstrate that glutathione also effluxes from the RBCs and forms a gold-glutathione-albumin complex. This may be the immunopharmacologically active complex
Kalies, Stefan; Heinemann, Dag; Schomaker, Markus; Gentemann, Lara; Meyer, Heiko; Ripken, Tammo
2014-01-01
Abstract. In comparison to standard transfection methods, gold nanoparticle-mediated laser transfection has proven to be a versatile alternative. This is based on its minor influence on cell viability and its high efficiency, especially for the delivery of small molecules like small interfering RNA. However, in order to transfer it to routine usage, a safety aspect is of major concern: The avoidance of nanoparticle uptake by the cells is desired. The immobilization of the gold nanoparticles on cell culture surfaces can address this issue. In this study, we achieved this by silanization of the appropriate surfaces and the binding of gold nanoparticles to them. Comparable perforation efficiencies to the previous approaches of gold nanoparticle-mediated laser transfection with free gold nanoparticles are demonstrated. The uptake of the immobilized particles by the cells is unlikely. Consequently, these investigations offer the possibility of bringing gold nanoparticle-mediated laser transfection closer to routine usage. PMID:25069006
High temperature creep of single crystals of gold, silver and solid solution gold silver 50-50
International Nuclear Information System (INIS)
Dorizzi, Paul
1973-01-01
We have studied in compression creep along a direction, single crystals of gold, silver and a 50-50 gold-silver solid solution. The experiments were made at temperatures above 0.7 Tf. We have shown that under these conditions and for these three metals a new slip system is operating: the deformation is due to the slip of dislocations having a 1/2 burgers vector on the {110} planes. For gold the activation energy for creep is equal to the self-diffusion energy. We found the same result for silver when the contribution of divacancies to the self-diffusion energy is taken into account. For the alloy the activation energy for creep is very close to the self-diffusion energy of gold in a 50-50 gold-silver alloy, gold being the slower diffusing species in the alloy. The curves giving the creep rate versus the stress can be fitted with the following laws: ε 0 = σ 5 for gold; ε 0 = σ 2,2 for silver and ε 0 = σ 2,5 for the alloy. The dislocation substructure was studied using the crystalline contrast given by the electron microprobe. This new method gives images which are very sensitive to the sub-grains misorientation. The substructure is made of parallelepipedic cells divided by tilt boundaries that are perpendicular to the {110} slip planes. (author) [fr
Gold - Old Drug with New Potentials.
Faa, Gavino; Gerosa, Clara; Fanni, Daniela; Lachowicz, Joanna I; Nurchi, Valeria M
2018-01-01
Research into gold-based drugs for a range of human diseases has seen a revival in recent years. This article reviews the most important applications of gold products in different fields of human pathology. Au(I) and Au(III) compounds have been re-introduced in clinical practice for targeting the cellular components involved in the onset and progression of viral and parasitic diseases, rheumatoid arthritis and cancer. After some brief historical notes, this article takes into account the applications of gold compounds against Mycobacterium tuberculosis, and also in tuberculosis and in rheumatoid arthritis treatment. The use of gold containing drugs in the cure of cancer are then considered, with special emphasis to the use of nanoparticles and to the photo-thermal cancer therapy. The use of colloidal gold in diagnostics, introduced in the last decade is widely discussed. As a last point a survey on the adverse effects and on the toxicity of the various gold derivatives in use in medicine is presented. In this review, we described the surprisingly broad spectrum of possible uses of gold in diagnostics and in therapeutic approaches to multiple human diseases, ranging from degenerative to infectious diseases, and to cancer. In particular, gold nanoparticles appear as attractive elements in modern clinical medicine, combining high therapeutic properties, high selectivity in targeting cancer cells and low toxicity. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.
Maruyama, Tessho; Nishihara, Kazuhide; Umikawa, Masato; Arasaki, Akira; Nakasone, Toshiyuki; Nimura, Fumikazu; Matayoshi, Akira; Takei, Kimiko; Nakachi, Saori; Kariya, Ken-Ichi; Yoshimi, Naoki
2018-01-01
MicroRNAs (miRs) are expected to serve as prognostic tools for cancer. However, many miRs have been reported as prognostic markers of recurrence or metastasis in oral squamous cell carcinoma patients. We aimed to determine the prognostic markers in early-stage tongue squamous cell carcinoma (TSCC). Based on previous studies, we hypothesized that miR-10a, 10b, 196a-5p, 196a-3p, and 196b were prognostic markers and we retrospectively performed miR expression analyses using formalin-fixed paraffin-embedded sections of surgical specimens. Total RNA was isolated from cancer tissues and adjacent normal tissue as control, and samples were collected by laser-capture microdissection. After cDNA synthesis, reverse transcription-quantitative polymerase chain reaction was performed. Statistical analyses for patient clinicopathological characteristics, recurrence/metastasis, and survival rates were performed to discern their relationships with miR expression levels, and the 2−ΔΔCq method was used. miR-196a-5p levels were significantly upregulated in early-stage TSCC, particularly in the lymph node metastasis (LNM) group. The LNM-free survival rate in the low miR-196a-5p ΔΔCq value regulation group was found to be lower than that in the high ΔΔCq value regulation group (P=0.0079). Receiver operating characteristic analysis of ΔΔCq values revealed that miR-196a-5p had a P-value=0.0025, area under the curve=0.740, and a cut-off value=−0.875 for distinguishing LNM. To our knowledge, this is the first study to examine LNM-related miRs in early-stage TSCC as well as miRs and ‘delayed LNM’ in head and neck cancer. miR-196a-5p upregulation may predict delayed LNM. Our data serve as a foundation for future studies to evaluate miR levels and facilitate the prediction of delayed LNM during early-stage TSCC, which prevent metastasis when combined with close follow-up and aggressive adjuvant therapy or elective neck dissection. Moreover, our data will serve as a foundation
Red gold analysis by using gamma absorption tchnique
International Nuclear Information System (INIS)
Kurtoglu, A.; Tugrul, A.B.
2001-01-01
Gold is a valuable metal and also preferable materials for antique artefacts and some advanced technology products. It can be offered for the analysis of the gold as namely; neutron activation analysis, X-ray florescence technique, Auger spectroscopy, atomic absorption and wet chemistry. Some limitations exist in practice for these techniques, especially in the points of financial and applicability concepts. An advanced a practical technique is gamma absorption technique for the gold alloys. This technique is based on discontinuities in the absorption coefficient for gamma rays at corresponding to the electronic binding energies of the absorber. If irradiation is occurred at gamma absorption energy for gold, absorption rates of the red gold changes via the gold amounts in the alloy. Red gold is a basic and generally preferable alloy that has copper and silver additional of the gold in it. The gold amount defines as carat of the gold. Experimental studies were observed for four different carats of red gold; these are 8, 14, 18 and 22 carats. K-edge energy level of the gold is on 80 keV energy. So, Ba-133 radioisotope is preferred as the gamma source because of it has gamma energy peak in that energy. Experiments observed in the same geometry for all samples. NaI(Tl) detector and multichannel analyser were used for measurements. As a result of the experiments, the calibration curves could be drawn for red gold. For examine this curve, unknown samples are measured in experimental set and it can be determined the carat of it with the acceptability. So the red gold analysis can be observed non-destructively, easily and quickly by using the gamma absorption technique
MANSUROV R.KH.
2016-01-01
The relevance of the discussed issue is caused by the need to detect a new gold ore deposits within the Yenisei ridge to replenish the mineral resources of gold ore in Russia. The main aim of the study is to explore the features of geological structure and gold ore mineralized zones of ore occurrence Yuzhnoe in order to forecast gold ore bodies, and to substantiate the continuation of geological exploration. The prospecting is realized by the express method of prospecting of gold ore deposits...
Diazonium-derived aryl films on gold nanoparticles: evidence for a carbon-gold covalent bond.
Laurentius, Lars; Stoyanov, Stanislav R; Gusarov, Sergey; Kovalenko, Andriy; Du, Rongbing; Lopinski, Gregory P; McDermott, Mark T
2011-05-24
Tailoring the surface chemistry of metallic nanoparticles is generally a key step for their use in a wide range of applications. There are few examples of organic films covalently bound to metal nanoparticles. We demonstrate here that aryl films are formed on gold nanoparticles from the spontaneous reduction of diazonium salts. The structure and the bonding of the film is probed with surface-enhanced Raman scattering (SERS). Extinction spectroscopy and SERS show that a nitrobenzene film forms on gold nanoparticles from the corresponding diazonium salt. Comparison of the SERS spectrum with spectra computed from density functional theory models reveals a band characteristic of a Au-C stretch. The observation of this stretch is direct evidence of a covalent bond. A similar band is observed in high-resolution electron energy loss spectra of nitrobenzene layers on planar gold. The bonding of these types of films through a covalent interaction on gold is consistent with their enhanced stability observed in other studies. These findings provide motivation for the use of diazonium-derived films on gold and other metals in applications where high stability and/or strong adsorbate-substrate coupling are required.
Directory of Open Access Journals (Sweden)
Qian Li
2017-05-01
Full Text Available A total gold extraction of 70.2% could only be reached via direct cyanidation from a refractory As-, S- and C-bearing gold concentrate calcine, and the gold extraction varied noticeably with different size fractions. The reasons for unsatisfactory gold extraction from the calcine were studied through analyses of chemical composition, chemical phase and SEM-EDS of different sizes of particles. It was found that a significant segregation of compositions occurred during the grinding of gold ore before flotation. As a result, for the calcine obtained after oxidative roasting, the encapsulation of gold by iron oxides was easily engendered in finer particles, whilst in coarser particles the gold encapsulation by silicates was inclined to occur likely due to melted silicates blocking the porosity of particles. The improvement of gold leaching from different size fractions was further investigated through pretreatments with alkali washing, acid pickling or sulfuric acid curing-water leaching. Finally, a novel process was recommended and the total gold extraction from the calcine could be increased substantially to 93.6% by the purposeful pretreatment with alkali washing for the relatively coarse size fraction (+37 μm and sulfuric acid curing–water leaching for the fine size fraction (−37 μm.
Qiu, Xiao-bin; Wen, Jian-kang; Huang, Song-tao; Yang, Hong-ying; Liu, Mei-lin; Wu, Biao
2017-10-01
To extract gold from a low-grade (13.43 g/t) and high-sulfur (39.94wt% sulfide sulfur) Carlin-type gold concentrate from the Nibao deposit, Guizhou, a bio-pretreatment followed by carbon-in-pulp (CIP) cyanide leaching process was used. Various methods were used to detect the low-grade gold in the concentrate; however, only time-of-flight secondary-ion mass spectrometry (TOF-SIMS) was successful. With bio-pretreatment, the gold recovery rate increased by approximately 70.16% compared with that obtained by direct cyanide leaching of the concentrate. Various attempts were made to increase the final gold recovery rate. However, approximately 20wt% of the gold was non-extractable. To determine the nature of this non-extractable gold, mineralogy liberation analysis (MLA), formation of secondary product during the bio-pretreatment, and the preg-robbing capacity of the carbonaceous matter in the ore were investigated. The results indicated that at least four factors affected the gold recovery rate: gold occurrence, tight junctions of gold-bearing pyrite with gangue minerals, jarosite coating of the ore, and the carbonaceous matter content.
NUCLEATION STUDIES OF GOLD ON CARBON ELECTRODES
Directory of Open Access Journals (Sweden)
S. SOBRI
2008-04-01
Full Text Available Interest has grown in developing non-toxic electrolytes for gold electrodeposition to replace the conventional cyanide-based bath for long term sustainability of gold electroplating. A solution containing thiosulphate and sulphite has been developed specially for microelectronics applications. However, at the end of the electrodeposition process, the spent electrolyte can contain a significant amount of gold in solution. This study has been initiated to investigate the feasibility of gold recovery from a spent thiosulphate-sulphite electrolyte. We have used flat-plate glassy carbon and graphite electrodes to study the mechanism of nucleation and crystal growth of gold deposition from the spent electrolyte. It was found that at the early stages of reduction process, the deposition of gold on glassy carbon exhibits an instantaneous nucleation of non-overlapping particles. At longer times, the particles begin to overlap and the deposition follows a classic progressive nucleation phenomenon. On the other hand, deposition of gold on graphite does not follow the classical nucleation phenomena.
International Nuclear Information System (INIS)
Bleser, Ed
1992-01-01
On April 24, Brookhaven's Alternating Gradient Synchrotron (AGS) started to deliver gold ions at 11.4 GeV per nucleon (2,000 GeV per ion) to experimenters who were delighted not only to receive the world's highest energy gold beam but also to receive it on schedule
Marczenko, Z; Jankowski, K
1985-04-01
The gold(I)-iodide-Methylene Blue (MB) system is suitable for flotation separation and spectrophotometric determination of gold. Under the optimum conditions [(MB(+))(AuI(2)(-))].3[(MB(+))(I(3)(-))] is formed, and floated with cyclohexane. The product is dissolved in methanol and its absorbance measured. The molar absorptivity is 3.4 x 10(5)1.mole(-1).cm(-1) at 655 nm. The proposed method is more than three times as sensitive as the Rhodamine B method. Pt, Pd, Ag and Hg interfere seriously, and Ir, Rh, Bi and Cd to a smaller extent. Preliminary separation of gold by precipitation with tellurium as a collector is recommended. The method has been applied to determination of gold traces (about 1 x 10(-4)%) in a copper sample.
Precipitation of lamellar gold nanocrystals in molten polymers
International Nuclear Information System (INIS)
Palomba, M.; Carotenuto, G.
2016-01-01
Non-aggregated lamellar gold crystals with regular shape (triangles, squares, pentagons, etc.) have been produced by thermal decomposition of gold chloride (AuCl) molecules in molten amorphous polymers (polystyrene and poly(methyl methacrylate)). Such covalent inorganic gold salt is high soluble into non-polar polymers and it thermally decomposes at temperatures compatible with the polymer thermal stability, producing gold atoms and chlorine radicals. At the end of the gold precipitation process, the polymer matrix resulted chemically modified because of the partial cross-linking process due to the gold atom formation reaction.
Synthesis of radioactive gold nanoparticle in surfactant medium
International Nuclear Information System (INIS)
Swadesh Mandal
2014-01-01
The present study describes the synthesis of radioactive gold nanoparticle in surfactant medium. Proton irradiated stable 197 Au and radioactive 198 Au were simultaneously used for production of radioactive gold nanoparticle. Face centered cubic gold nanoparticles with size of 4-50 nm were found in proton irradiated gold foil. However, the size of nanoparticle varies with pH using both stable and radioactive gold. (author)
Establishment of gold-quartz standard GQS-1
Millard, Hugh T.; Marinenko, John; McLane, John E.
1969-01-01
A homogeneous gold-quartz standard, GQS-1, was prepared from a heterogeneous gold-bearing quartz by chemical treatment. The concentration of gold in GQS-1 was determined by both instrumental neutron activation analysis and radioisotope dilution analysis to be 2.61?0.10 parts per million. Analysis of 10 samples of the standard by both instrumental neutron activation analysis and radioisotope dilution analysis failed to reveal heterogeneity within the standard. The precision of the analytical methods, expressed as standard error, was approximately 0.1 part per million. The analytical data were also used to estimate the average size of gold particles. The chemical treatment apparently reduced the average diameter of the gold particles by at least an order of magnitude and increased the concentration of gold grains by a factor of at least 4,000.
Diatom. A potential bio-accumulator of gold
International Nuclear Information System (INIS)
Chakraborty, N.; Pal, R.; Ramaswami, A.; Nayak, D.; Lahiri, S.
2006-01-01
The bioaccumulation of gold in trace concentration by Nitzschia obtusa and Navicula minima, two members of bacillariophyceae, has been studied. It has been observed that Nitzschia obtusa showed better accumulation of gold in acidic pH in comparison to neutral and basic pH. Maximum accumulation was observed with 1 mg x kg -1 or less gold concentration. However, the accumulation by the living cells was reduced when the matrix concentration was higher. Navicula minima, on the other hand, found to be a better accumulator of gold in wide ranges of pH and substrate concentration of the media. It was also inferred that the gold accumulation by diatom was mainly due to adsorption by biosilica (siliceous frustules of dead diatom cells). Accumulated gold was recovered with conc. HNO 3 . (author)
International Nuclear Information System (INIS)
Lengke, M. F.; Ravel, B.; Fleet, M. E.; Wanger, G.; Gordon, R. A.; Southam, G.
2007-01-01
The mechanisms of gold precipitation by the interaction of cyanobacteria (Plectonema boryanum UTEX 485) and gold(III) chloride aqueous solutions (7.6 mmol/L final gold) have been studied at 25, 60, and 80 C, using both laboratory and real-time synchrotron radiation absorption spectroscopy experiments. Addition of aqueous gold(III) chloride to the cyanobacterial culture initially promoted the precipitation of amorphous gold(I) sulfide at the cell walls and finally caused the formation of octahedral (111) platelets (<1 to 6 (micro)m) of gold metal near cell surfaces and in solutions. X-ray absorption spectroscopy results confirmed that the reduction mechanism of gold(III) chloride to elemental gold by cyanobacteria involves the formation of an intermediate Au(I) species, gold(I) sulfide, with sulfur originating from cyanobacterial proteins, presumably cysteine or methionine. Although the bioreduction of gold(III) chloride to gold(I) sulfide was relatively rapid at all temperatures, the reaction rate increased with the increase in temperature. At the completion of the experiments, elemental gold was the major species present at all temperatures
Energy Technology Data Exchange (ETDEWEB)
Harish, S. [Electrodics and Electrocatalysis Division, CSIR-Central Electrochemical Research Institute, Karaikudi 630006, Tamilnadu (India); Joseph, James, E-mail: jameskavlam@yahoo.com [Electrodics and Electrocatalysis Division, CSIR-Central Electrochemical Research Institute, Karaikudi 630006, Tamilnadu (India); Phani, K.L.N. [Electrodics and Electrocatalysis Division, CSIR-Central Electrochemical Research Institute, Karaikudi 630006, Tamilnadu (India)
2011-06-30
Highlights: > In group IB, Cu and Ag form Prussian blue analogues but similar formation of gold hexacyanoferrate was not found in the literature and non-existence of gold hexacyanoferrate remains a mystery. > Potential cycling of gold chloride and potassium ferro/ferri cyanide was resulted in the formation of Au-PB nano-composite. > Redox reaction between gold chloride and potassium ferrocyanide ion is spontaneous but no reaction occurs when gold chloride and potassium ferricyanide is mixed. > We are proposing the formation of a compound with general formula 'KFe{sub x}[Au(CN){sub 2}]{sub y}' and discussing the formation of gold hexacyanoferrate is not feasible by simple chemical or electrochemical reaction in contrast to other PB analogues. - Abstract: Prussian blue analogues are a class of compounds formed by the reaction between metal salt and potassium hexacyanoferrate (II/III). In our earlier report, the formation of Au-Prussian blue nano-composite was noticed on potential cycling the glassy carbon electrode in a medium containing gold (III) chloride and potassium hexacyanoferrate (III). Hence in this work, the formation of gold hexacyanoferrate was attempted by a simple chemical reaction. The reaction of gold (III) chloride with potassium hexacyanoferrate (II/III) was examined by UV-Vis spectroscopy and found that there is no redox reaction between gold (III) chloride and potassium hexacyanoferrate (III). However, the redox reaction occurs between gold (III) chloride and potassium hexacyanoferrate (II) leading to the formation of charge transfer band and the conversion of hexacyanoferrate (II) to hexacyanoferrate (III) was evidenced by the emergence of new absorption peaks in UV-Vis spectra. The oxidation state of gold in Au-Fe complex was found to be +1 from X-ray photoelectron spectroscopy. The stability of the Au-Fe complex was also studied by cyclic voltammetry. Cyclic voltammetric results indicated the presence of high spin iron in Au
International Nuclear Information System (INIS)
Harish, S.; Joseph, James; Phani, K.L.N.
2011-01-01
Highlights: → In group IB, Cu and Ag form Prussian blue analogues but similar formation of gold hexacyanoferrate was not found in the literature and non-existence of gold hexacyanoferrate remains a mystery. → Potential cycling of gold chloride and potassium ferro/ferri cyanide was resulted in the formation of Au-PB nano-composite. → Redox reaction between gold chloride and potassium ferrocyanide ion is spontaneous but no reaction occurs when gold chloride and potassium ferricyanide is mixed. → We are proposing the formation of a compound with general formula 'KFe x [Au(CN) 2 ] y ' and discussing the formation of gold hexacyanoferrate is not feasible by simple chemical or electrochemical reaction in contrast to other PB analogues. - Abstract: Prussian blue analogues are a class of compounds formed by the reaction between metal salt and potassium hexacyanoferrate (II/III). In our earlier report, the formation of Au-Prussian blue nano-composite was noticed on potential cycling the glassy carbon electrode in a medium containing gold (III) chloride and potassium hexacyanoferrate (III). Hence in this work, the formation of gold hexacyanoferrate was attempted by a simple chemical reaction. The reaction of gold (III) chloride with potassium hexacyanoferrate (II/III) was examined by UV-Vis spectroscopy and found that there is no redox reaction between gold (III) chloride and potassium hexacyanoferrate (III). However, the redox reaction occurs between gold (III) chloride and potassium hexacyanoferrate (II) leading to the formation of charge transfer band and the conversion of hexacyanoferrate (II) to hexacyanoferrate (III) was evidenced by the emergence of new absorption peaks in UV-Vis spectra. The oxidation state of gold in Au-Fe complex was found to be +1 from X-ray photoelectron spectroscopy. The stability of the Au-Fe complex was also studied by cyclic voltammetry. Cyclic voltammetric results indicated the presence of high spin iron in Au-Fe complex. Hence 'as
Downregulation of ZMYND11 induced by miR-196a-5p promotes the progression and growth of GBM.
Yang, Ji-Peng; Yang, Jian-Kai; Li, Chen; Cui, Zhi-Qiang; Liu, Hong-Jiang; Sun, Xiao-Feng; Geng, Shao-Mei; Lu, Sheng-Kui; Song, Jian; Guo, Cheng-Yong; Jiao, Bao-Hua
2017-12-16
ZMYND11 (zinc finger MYND-type containing 11) has been widely regarded to be involved in a variety of cancers as a potential suppressor. However, the biological role and mechanism of ZMYND11 in glioblastoma multiform (GBM) remain unknown. In this study, we found that ZMYND11 expression was remarkably decreased in GBM tissues from 20 cases and cell line (U87) compared to normal brain tissue from 10 cases (P GBM tissue and U87 cells by changing the expression level of miR-196a-5p with lentivirus and plasmid vector. Furthermore, we demonstrated that decreased ZMYND11 could reverse suppressive effect of downregulated miR-196a-5p on U87 by rescue experiment. Taken together, ZMYND11 was demonstrated to be a potential and extremely promising suppressor of GBM, while miRNA-196a-5p was quite an important target of treatment of GBM. Copyright © 2017 Elsevier Inc. All rights reserved.
Physicochemical Properties of Gold Nanostructures Deposited on Glass
Directory of Open Access Journals (Sweden)
Zdenka Novotna
2014-01-01
Full Text Available Properties of gold films sputtered onto borosilicate glass substrate were studied. UV-Vis absorption spectra were used to investigate optical parameters. XRD analysis provided information about the gold crystalline nanostructure, the texture, and lattice parameter and biaxial tension was also determined by the XRD method. The surface morphology was examined by atomic force microscopy (AFM; chemical structure of sputtered gold nanostructures was examined by X-ray photoelectron spectroscopy (ARXPS. The gold crystallites are preferentially [111] oriented on the sputtered samples. Gold deposition leads to dramatic changes in the surface morphology in comparison to pristine glass substrate. Oxygen is not incorporated into the gold layer during gold deposition. Experimental data on lattice parameter were also confirmed by theoretical investigations of nanoclusters using tight-binding potentials.
Electroplating of gold using a sulfite-based electrolyte
Smalbrugge, E.; Jacobs, B.; Falcone, S.; Geluk, E.J.; Karouta, F.; Leijtens, X.J.M.; Besten, den J.H.
2000-01-01
Electroplating of gold is often used in optoelectronic and microelectronic devices for air-bridges, heat-sinks or gold-bumps for flip-chip techniques. The gold-cyanide electrolytes, which are commonly used in gold-electroplating, are toxic and attack resist patterns causing cracks during the plating
197Au(d,3He)196Pt reaction and the supersymmetry scheme
International Nuclear Information System (INIS)
Vergnes, M.; Berrier-Ronsin, G.; Rotbard, G.; Vernotte, J.; Langevin- Joliot, H.; Gerlic, E.; Wiele, J. van de; Guillot, J.
1981-01-01
The 197 Au(d, 3 He) 196 Pt reaction has been studied at Esub(d) = 108 MeV. An important breakdown of the selection rules of the supersymmetry scheme is observed for the 2 2 + level. The generally strong excitation of the 2 2 + level by transfer reactions in the Pt region leads to question the validity of the supersymmetry scheme at least for this level
Urban artisanal gold shops and mercury emissions
International Nuclear Information System (INIS)
Cordy, P.; Veiga, M.; Carrasco, V.H.G.
2008-01-01
Artisanal miners in developing countries use mercury amalgamation processes to extract gold. The amalgams are then refined before being sold on to urban gold shops. The amalgams can often contain between 2 to 40 per cent mercury. Unburned amalgams are also often sold directly to gold shops. There are serious health risks for shop employees and nearby populations when the gold is melted and further purified. Studies have shown that mercury concentrations in the ambient air of gold shops often exceeds World Health Organization (WHO) limits by an order of magnitude or more. This study examined the practices and technologies used to refine gold in Latin America and Indonesia. The study compared and contrasted various refining methods and their resulting mercury emissions. Methods of reducing mercury emissions were also investigated, including a filtration system designed to capture 80 per cent of mercury emissions. Barriers to implementing mercury emissions reduction plans were also investigated. It was concluded that the design of urban gold shops must include condensers, fume hoods, and efficient mercury capture systems. 15 refs
Gold analysis by the gamma absorption technique
International Nuclear Information System (INIS)
Kurtoglu, Arzu; Tugrul, A.B.
2003-01-01
Gold (Au) analyses are generally performed using destructive techniques. In this study, the Gamma Absorption Technique has been employed for gold analysis. A series of different gold alloys of known gold content were analysed and a calibration curve was obtained. This curve was then used for the analysis of unknown samples. Gold analyses can be made non-destructively, easily and quickly by the gamma absorption technique. The mass attenuation coefficients of the alloys were measured around the K-shell absorption edge of Au. Theoretical mass attenuation coefficient values were obtained using the WinXCom program and comparison of the experimental results with the theoretical values showed generally good and acceptable agreement
Surface vertical deposition for gold nanoparticle film
International Nuclear Information System (INIS)
Diao, J J; Qiu, F S; Chen, G D; Reeves, M E
2003-01-01
In this rapid communication, we present the surface vertical deposition (SVD) method to synthesize the gold nanoparticle films. Under conditions where the surface of the gold nanoparticle suspension descends slowly by evaporation, the gold nanoparticles in the solid-liquid-gas junction of the suspension aggregate together on the substrate by the force of solid and liquid interface. When the surface properties of the substrate and colloidal nanoparticle suspension define for the SVD, the density of gold nanoparticles in the thin film made by SVD only depends on the descending velocity of the suspension surface and on the concentration of the gold nanoparticle suspension. (rapid communication)
[Biosynthesis of gold nanoparticles by Azospirillum brasilense].
Kupriashina, M A; Vetchinkina, E P; Burov, A M; Ponomareva, E G; Nikitina, V E
2014-01-01
Plant-associated nitrogen-fixing soil bacteria Azospirillum brasilense were shown to reduce the gold of chloroauric acid to elemental gold, resulting in formation of gold nanoparicles. Extracellular phenoloxidizing enzymes (laccases and Mn peroxidases) were shown to participate in reduction of Au+3 (HAuCl4) to Au(0). Transmission electron microscopy revealed accumulation of colloidal gold nanoparticles of diverse shape in the culture liquid of A. brasilense strains Sp245 and Sp7. The size of the electron-dense nanospheres was 5 to 50 nm, and the size of nanoprisms varied from 5 to 300 nm. The tentative mechanism responsible for formation of gold nanoparticles is discussed.
Biomass processing over gold catalysts
Simakova, Olga A; Murzin, Dmitry Yu
2014-01-01
The book describes the valorization of biomass-derived compounds over gold catalysts. Since biomass is a rich renewable feedstock for diverse platform molecules, including those currently derived from petroleum, the interest in various transformation routes has become intense. Catalytic conversion of biomass is one of the main approaches to improving the economic viability of biorefineries. In addition, Gold catalysts were found to have outstanding activity and selectivity in many key reactions. This book collects information about transformations of the most promising and important compounds derived from cellulose, hemicelluloses, and woody biomass extractives. Since gold catalysts possess high stability under oxidative conditions, selective oxidation reactions were discussed more thoroughly than other critical reactions such as partial hydrogenation, acetalization, and isomerization. The influence of reaction conditions, the role of the catalyst, and the advantages and disadvantages of using gold are pre...
Optical trapping of gold aerosols
DEFF Research Database (Denmark)
Schmitt, Regina K.; Pedersen, Liselotte Jauffred; Taheri, S. M.
2015-01-01
Aerosol trapping has proven challenging and was only recently demonstrated.1 This was accomplished by utilizing an air chamber designed to have a minimum of turbulence and a laser beam with a minimum of aberration. Individual gold nano-particles with diameters between 80 nm and 200 nm were trapped...... in air using a 1064 nm laser. The positions visited by the trapped gold nano-particle were quantified using a quadrant photo diode placed in the back focal plane. The time traces were analyzed and the trapping stiffness characterizing gold aerosol trapping determined and compared to aerosol trapping...... of nanometer sized silica and polystyrene particles. Based on our analysis, we concluded that gold nano-particles trap more strongly in air than similarly sized polystyrene and silica particles. We found that, in a certain power range, the trapping strength of polystyrene particles is linearly decreasing...
Directed Assembly of Gold Nanoparticles
DEFF Research Database (Denmark)
Westerlund, Axel Rune Fredrik; Bjørnholm, Thomas
2009-01-01
As a complement to common "top-down" lithography techniques, "bottom-up" assembly techniques are emerging as promising tools to build nanoscale structures in a predictable way. Gold nanoparticles that are stable and relatively easy to synthesize are important building blocks in many such structures...... due to their useful optical and electronic properties. Programmed assembly of gold nanoparticles in one, two, and three dimensions is therefore of large interest. This review focuses on the progress from the last three years in the field of directed gold nanoparticle and nanorod assembly using...
Energy Technology Data Exchange (ETDEWEB)
Choi, Munsik; Kim, Nak-hyeon; Eom, Seyoung [Department of Biomedical Engineering, Kyung Hee University, Yongin 446-701 (Korea, Republic of); Kim, Tae Woo [School of East–West Medical Science, Kyung Hee University, Yongin 446-701 (Korea, Republic of); Byun, Kyung Min, E-mail: kmbyun@khu.ac.kr [Department of Biomedical Engineering, Kyung Hee University, Yongin 446-701 (Korea, Republic of); Park, Hyeong-Ho, E-mail: hyeongho.park@kanc.re.kr [Nano Process Division, Korea Advanced Nano Fab Center, Suwon 443-270 (Korea, Republic of)
2015-07-31
We report on a versatile method to fabricate gold nanocrown arrays on a thin gold film based on ultraviolet nanoimprint lithography and tilted evaporation technique. We realize highly ordered 2-dimensional nanocrown arrays and characterize their sizes and morphologies using scanning electron microscopy. To demonstrate an enhanced surface plasmon resonance (SPR) detection by the fabricated gold nanocrown samples, biosensing experiments are performed by measuring SPR angle shift for biotin–streptavidin interaction and bulk refractive index change of dielectric medium. We hope that the suggested plasmonic platform with a high sensitivity could be extended to a variety of biomolecular binding reactions. - Highlights: • Gold nanocrown arrays are produced by nanoimprint lithography and tilted evaporation. • Use of gold nanocrown arrays can improve the sensor sensitivity significantly. • Improved sensitivity is due to enhanced field–matter interaction at gold nanocrowns.
Ellen,Hardy; Bento,Silvana Ferreira; Osis,Maria José Duarte
2002-01-01
Introdução : a Resolução 196/96, do Conselho Nacional de Saúde (Ministério da Saúde), apresenta as diretrizes regulamentadoras mais abrangentes acerca de pesquisas envolvendo seres humanos no Brasil, incluindo o conteúdo do termo de consentimento. Objetivo: apresentar o conhecimento e opinião de pesquisadores brasileiros sobre o conteúdo da Resolução 196/96 do Conselho Nacional de Saúde em relação ao consentimento informado. Sujeitos e Métodos: 46 responsáveis pela área de ginecologia em univ...
Roy, Sam; Upton, Phaedra; Craw, Dave
2018-01-01
Formation of placer accumulations in fluvial environments requires 103-106 or even greater times concentration of heavy minerals. For this to occur, regular sediment supply from erosion of adjacent topography is required, the river should remain within a single course for an extended period of time and the material must be reworked such that a high proportion of the sediment is removed while a high proportion of the heavy minerals remains. We use numerical modeling, constrained by observations of circum-Pacific placer gold deposits, to explore processes occurring in evolving river systems in dynamic tectonic environments. A fluvial erosion/transport model is used to determine the mobility of placer gold under variable uplift rate, storm intensity, and rock mass strength conditions. Gold concentration is calculated from hydraulic and bedload grain size conditions. Model results suggest that optimal gold concentration occurs in river channels that frequently approach a threshold between detachment-limited and transport-limited hydraulic conditions. Such a condition enables the accumulation of gold particles within the framework of a residual gravel lag. An increase in transport capacity, which can be triggered by faster uplift rates, more resistant bedrock, or higher intensity storm events, will strip all bedload from the channel. Conversely, a reduction in transport capacity, triggered by a reduction in uplift rate, bedrock resistance, or storm intensity, will lead to a greater accumulation of a majority of sediments and a net decrease in gold concentration. For our model parameter range, the optimal conditions for placer gold concentration are met by 103 times difference in strength between bedrock and fault, uplift rates between 1 and 5 mm a-1, and moderate storm intensities. Fault damage networks are shown to be a critical factor for high Au concentrations and should be a target for exploration.
Porous Gold Films Fabricated by Wet-Chemistry Processes
Directory of Open Access Journals (Sweden)
Aymeric Pastre
2016-01-01
Full Text Available Porous gold films presented in this paper are formed by combining gold electroless deposition and polystyrene beads templating methods. This original approach allows the formation of conductive films (2 × 106 (Ω·cm−1 with tailored and interconnected porosity. The porous gold film was deposited up to 1.2 μm on the silicon substrate without delamination. An original zirconia gel matrix containing gold nanoparticles deposited on the substrate acts both as an adhesion layer through the creation of covalent bonds and as a seed layer for the metallic gold film growth. Dip-coating parameters and gold electroless deposition kinetics have been optimized in order to create a three-dimensional network of 20 nm wide pores separated by 20 nm thick continuous gold layers. The resulting porous gold films were characterized by GIXRD, SEM, krypton adsorption-desorption, and 4-point probes method. The process is adaptable to different pore sizes and based on wet-chemistry. Consequently, the porous gold films presented in this paper can be used in a wide range of applications such as sensing, catalysis, optics, or electronics.
International Nuclear Information System (INIS)
Constantinescu, B.; Vasilescu, A.; Radtke, M.; Reinholz, U.
2009-01-01
The goal of the study is to verify if Transylvanian gold was used to manufacture Romanian archaeological objects using information related to trace elements: Sb, Te, Pb - recognized fingerprints for Carpathian Mountains mines and Sn characteristic for the panned river-bed (alluvional) gold. To solve these issues, samples (grains, nuggets,fine gold s and ) from various Transylvanian mines and rivers and some very small (few milligrams) fragments of archaeological objects are measured. During the experiment, point spectra for 22 natural gold samples from Tran sylvania and 18 m icronic s amples from archaeological objects were acquired at 34 keV excitation SR energy, using a spatially resolved SR-XRF set-up mounted for analyses at the hard X-ray beam line - BAMline at BESSY, Berlin. A summary for the characterization of Transylvanian native gold is the following: high (8 - 30%) Ag amounts and low (0.2 - 1%) Cu amounts; placer deposits (Valea Oltului, Stanija, Valea Pianului) contain as fingerprint Sn (150-300 ppm) - most probably from river bed cassiterite; primary deposits present as fingerprints Te (200-2000 ppm), Sb (150-300 ppm) - however, the samples are very inhomogeneous; primary deposit Sacaramb contains Te 0,25%, Sb (500 ppm), but also Sn ( 200 ppm); primary deposit Fizesti presents a big amount of Pb 1%, Sb (350 ppm), traces of Te and also Sn. As concerning the k oson d acian coins, the type w ith monogram i s made from refined (more than 97%) gold with no Sb, Te or Sn traces (remelted gold) and the type w ithout monogram i s clearly made from alluvial gold, partially combined with primary Transylvanian gold (Sn and Sb traces detected). A spectacular application of the micro-SR-XRF studies on native gold was the one of authentication of some recovered heritage artifacts: five Dacian gold bracelets exhibited at the National Museum of Romania's History, Bucharest. The Dacian multi-spiraled bracelets were made of gold; they belong to the classical period of the
International Nuclear Information System (INIS)
Chou Chau, Yuan-Fong; Lim, Chee Ming; Kumara, N. T. R. N.; Yoong, Voo Nyuk; Lee, Chuanyo; Huang, Hung Ji; Lin, Chun-Ting; Chiang, Hai-Pang
2016-01-01
Tunable surface plasmon resonance (SPR) and dipole cavity plasmon modes of the scattering cross section (SCS) spectra on the single solid-gold/gold-shell nanorod have been numerically investigated by using the finite element method. Various effects, such as the influence of SCS spectra under x- and y-polarizations on the surface of the single solid-gold/gold-shell nanorod, are discussed in detail. With the single gold-shell nanorod, one can independently tune the relative SCS spectrum width by controlling the rod length and rod diameter, and the surface scattering by varying the shell thickness and polarization direction, as well as the dipole peak energy. These behaviors are consistent with the properties of localized SPRs and offer a way to optically control and produce selected emission wavelengths from the single solid-gold/gold-shell nanorod. The electric field and magnetic distributions provide us a qualitative idea of the geometrical properties of the single solid-gold/gold-shell nanorod on plasmon resonance.
Jeong, Hun; Nguyen, Dang Mao; Lee, Min Sang; Kim, Hong Gun; Ko, Sang Cheol; Kwac, Lee Ku
2018-09-01
Herein, we successfully developed a novel three dimensional (3D) opened networks based on nitrogen doped graphene‑carbon nanotubes attaching with gold nanoparticles (N-GR-CNTs/AuNPs) to apply for non-enzymatic glucose determination. It was demonstrated that the N-GR-CNTs/AuNPs modified electrode exhibited good behavior for glucose detection with a long linear range of 2 μM to 19.6 mM, high sensitivity of 0.9824 μA·mM -1 ·cm -2 , low detection limit of 500 nM, and negligible interference effect. The high performance of the N-GR-CNTs/AuNPs based sensor was assumed due to the outstanding catalytic activity of AuNPs well dispersing on N-GR-CNTs networks, which exhibited as a perfect supporting scaffold due to the enhanced electrical conductivity and large surface area. The obtained results indicated that the N-GR-CNTs/AuNPs hybrid is highly promising for sensitive and selective detection of glucose in sensor application. Copyright © 2018 Elsevier B.V. All rights reserved.
Physiological investigation of gold nanorods toward watermelon.
Wan, Yujie; Li, Junli; Ren, Hongxuan; Huang, Jin; Yuan, Hong
2014-08-01
The objective of the present study was to evaluate the phytotoxicity and oxidant stress of the gold nanorods toward watermelon, and hence give a quantitative risk assessment of both seeds and plants phase. The seed germination, the activity of antioxidant enzymes, and the contents of soluble protein and malondialdehyde (MDA) have been measured while the plant roots were observed by transmission electron microscopy (TEM). It was found that the gold nanorods significantly promoted the root elongation. Furthermore, the results on the enzymes activities of plant indicated that oxidative stress happened in the plant treated with gold nanorods. However, the gold nanorods resulted in the phytotoxicity toward plant especially at high concentration. The TEM images of the plant roots with and without the treatment of gold nanorods showed the significant different size of starch granules. In conclusion, significant physiological changes of plant occurred after treatment with the gold nanorods.
Directory of Open Access Journals (Sweden)
Mao Cai-Xia
2011-10-01
Full Text Available Abstract Background Toll-like receptor 2 (TLR2 represents a reasonable functional and positional candidate gene for Alzheimer's disease (AD as it is located under the linkage region of AD on chromosome 4q, and functionally is involved in the microglia-mediated inflammatory response and amyloid-β clearance. The -196 to -174 del polymorphism affects the TLR2 gene and alters its promoter activity. Methods We recruited 800 unrelated Northern Han Chinese individuals comprising 400 late-onset AD (LOAD patients and 400 healthy controls matched for gender and age. The -196 to -174 del polymorphism in the TLR2 gene was genotyped using the polymerase chain reaction (PCR method. Results There were significant differences in genotype (P = 0.026 and allele (P = 0.009 frequencies of the -196 to -174 del polymorphism between LOAD patients and controls. The del allele was associated with an increased risk of LOAD (OR = 1.31, 95% CI = 1.07-1.60, Power = 84.9%. When these data were stratified by apolipoprotein E (ApoE ε4 status, the observed association was confined to ApoE ε4 non-carriers. Logistic regression analysis suggested an association of LOAD with the polymorphism in a recessive model (OR = 1.64, 95% CI = 1.13-2.39, Bonferroni corrected P = 0.03. Conclusions Our data suggest that the -196 to -174 del/del genotype of TLR2 may increase risk of LOAD in a Northern Han Chinese population.
Gold leaf counter electrodes for dye-sensitized solar cells
Shimada, Kazuhiro; Toyoda, Takeshi
2018-03-01
In this study, a gold leaf 100 nm thin film is used as the counter electrode in dye-sensitized solar cells. The traditional method of hammering gold foil to obtain a thin gold leaf, which requires only small amounts of gold, was employed. The gold leaf was then attached to the substrate using an adhesive to produce the gold electrode. The proposed approach for fabricating counter electrodes is demonstrated to be facile and cost-effective, as opposed to existing techniques. Compared with electrodes prepared with gold foil and sputtered gold, the gold leaf counter electrode demonstrates higher catalytic activity with a cobalt-complex electrolyte and higher cell efficiency. The origin of the improved performance was investigated by surface morphology examination (scanning electron microscopy), various electrochemical analyses (cyclic voltammetry, linear sweep voltammetry, and electrochemical impedance spectroscopy), and crystalline analysis (X-ray diffractometry).
Electrochemical Oxidation of Glycerol Using Gold Electrode
International Nuclear Information System (INIS)
Mohamed Rozali Othman; Amirah Ahmad
2015-01-01
Cyclic voltammetry, potential linear V and chronocuolometry methods were carried out to gain electrochemical behavior of glycerol at a gold electrode. Potassium hydroxide and sulfuric acid were chosen to be the electrolyte for the electro-oxidation of this organic compound. Besides gold plate electrode, gold composite electrode (Au-PVC) was also used as the working electrode. The Au-PVC composite electrode was characterized by Scanning Electron Microscopy (SEM) to determine its morphological aspects before and after used in electrochemical oxidation of glycerol. In alkaline solution, the adsorption of hydroxide species onto the surface of both gold plate and composite Au-PVC electrodes occurs at potential around 500 mV vs SCE. However, at gold plate electrode, there was a small, broad peak before the drastic escalation of current densities which indicates the charge transfer of the chemisorbed OH - anion. In acidic media, the gold oxide was formed after potential 1.0 V. From the cyclic voltammogram glycerol undergo oxidation twice in potassium hydroxide at gold plate and Au-PVC composite electrodes, while in sulfuric acid, oxidation reaction happened once for glycerol on the gold plate electrode. Overall, electrochemical oxidation of glycerol was more effective in alkaline media. Tafel graph which plotted from potential linear V method shows that Au-PVC composite electrode is better than gold plate electrode for the electro-oxidation of glycerol in alkaline solution. Electrochemical oxidation of glycerol products as analyzed by Gas Chromatography-Mass Spectrometry (GC-MS) produced several carboxylic acids and phenolic compounds. (author)
Hydrofluorination of Alkynes Catalysed by Gold Bifluorides.
Nahra, Fady; Patrick, Scott R; Bello, Davide; Brill, Marcel; Obled, Alan; Cordes, David B; Slawin, Alexandra M Z; O'Hagan, David; Nolan, Steven P
2015-01-01
We report the synthesis of nine new N -heterocyclic carbene gold bifluoride complexes starting from the corresponding N -heterocyclic carbene gold hydroxides. A new methodology to access N,N' -bis(2,6-diisopropylphenyl)imidazol-2-ylidene gold(I) fluoride starting from N,N' -bis(2,6-diisopropylphenyl)imidazol-2-ylidene gold(I) hydroxide and readily available potassium bifluoride is also reported. These gold bifluorides were shown to be efficient catalysts in the hydrofluorination of symmetrical and unsymmetrical alkynes, thus affording fluorinated stilbene analogues and fluorovinyl thioethers in good to excellent yields with high stereo- and regioselectivity. The method is exploited further to access a fluorinated combretastatin analogue selectively in two steps starting from commercially available reagents.
Gold, currencies and market efficiency
Kristoufek, Ladislav; Vosvrda, Miloslav
2016-05-01
Gold and currency markets form a unique pair with specific interactions and dynamics. We focus on the efficiency ranking of gold markets with respect to the currency of purchase. By utilizing the Efficiency Index (EI) based on fractal dimension, approximate entropy and long-term memory on a wide portfolio of 142 gold price series for different currencies, we construct the efficiency ranking based on the extended EI methodology we provide. Rather unexpected results are uncovered as the gold prices in major currencies lay among the least efficient ones whereas very minor currencies are among the most efficient ones. We argue that such counterintuitive results can be partly attributed to a unique period of examination (2011-2014) characteristic by quantitative easing and rather unorthodox monetary policies together with the investigated illegal collusion of major foreign exchange market participants, as well as some other factors discussed in some detail.
42 CFR 413.196 - Notification of changes in rate-setting methodologies and payment rates.
2010-10-01
... 42 Public Health 2 2010-10-01 2010-10-01 false Notification of changes in rate-setting... NURSING FACILITIES Payment for End-Stage Renal Disease (ESRD) Services and Organ Procurement Costs § 413.196 Notification of changes in rate-setting methodologies and payment rates. Link to an amendment...
Gold prices: Analyzing its cyclical behavior
Directory of Open Access Journals (Sweden)
Martha Gutiérrez
2013-07-01
Full Text Available Gold is a commodity that is seen as a safe haven when a financial crisis strikes, but when stock markets are prosperous, these are more attractive investment alternatives, and so the gold cycle goes on and on. The DJIA/GF (Dow Jones Industrial Average and Gold Fix ratio is chosen to establish the evolution of gold prices in relation to the NYSE. This paper has two goals: to prove that the DJIA/GF ratio is strongly cyclical by using Fourier analysis and to set a predictive neural networks model to forecast the behavior of this ratio during 2011-2020. To this end, business cycle events like the Great Depression along with the 1970s crisis, and the 1950s boom along with the world economic recovery of the 1990s are contrasted in light of the mentioned ratio. Gold prices are found to evolve cyclically with a dominant period of 37 years and are mainly affected by energy prices, financial markets and macroeconomic indicators.
Gold-Decorated Supraspheres of Block Copolymer Micelles
Kim, M. P.; Kang, D. J.; Kannon, A. G.; Jung, D.-W.; Yi, G. R.; Kim, B. J.
2012-02-01
Gold-decorated supraspheres displaying various surface morphologies were prepared by infiltration of gold precursor into polystyrene-b-poly(2-vinylpyridine) (PS-b-P2VP) supraspheres under acidic condition. The supraspheres were fabricated by emulsifying PS-b-P2VP polymer solution into surfactant solution. Selective swelling of P2VP in the suprasphere by gold precursor under acidic condition resulted in the formation of gold-decorated supraspheres with various surface structures. As evidenced by TEM and SEM images, dot pattern was formed in the case of smaller supraspheres than 800 nm; whereas fingerprint-like pattern was observed in larger supraspheres than 800 nm. Gold nanoparticles were located inside P2VP domains near the surface of prepared supraspheres as confirmed by TEM. The optical property of the supraspheres was characterized using UV-vis absorption spectroscopy and the maximum absorption peak at around 580 nm was observed, which means that gold nanoparticles densely packed into P2VP domain on the suprasphere. Our approach to prepare gold-decorated supraspheres can be extended to other metallic particles such as iron oxide or platinum nanoparticles, and those precursors can be also selectively incorporated into the P2VP domain.
López-Muñoz, Gerardo A; Estévez, M-Carmen; Vázquez-García, Marc; Berenguel-Alonso, Miguel; Alonso-Chamarro, Julián; Homs-Corbera, Antoni; Lechuga, Laura M
2018-05-01
Ultrasmooth gold/silver/gold trilayer nanostructured plasmonic sensors were obtained using commercial Blu-ray optical discs as nanoslits-based flexible polymer substrates. A thin gold film was used as an adhesion and nucleation layer to improve the chemical stability and reduce the surface roughness of the overlying silver film, without increasing ohmic plasmon losses. The structures were physically and optically characterized and compared with nanostructures of single gold layer. Ultrasmooth and chemically stable trilayer nanostructures with a surface roughness <0.5 nm were obtained following a simple and reproducible fabrication process. They showed a figure of merit (FOM) value up to 69.2 RIU -1 which is significantly higher (more than 95%) than the gold monolayer counterpart. Their potential for biosensing was demonstrated by employing the trilayer sensor for the direct and refractometric (label-free) detection of C-reactive protein (CRP) biomarker in undiluted urine achieving a Limit of Detection (LOD) in the pM order. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Glyco-gold nanoparticles: synthesis and applications
Compostella, Federica; Pitirollo, Olimpia; Silvestri, Alessandro; Polito, Laura
2017-01-01
Glyco-gold nanoparticles combine in a single entity the peculiar properties of gold nanoparticles with the biological activity of carbohydrates. The result is an exciting nanosystem, able to mimic the natural multivalent presentation of saccharide moieties and to exploit the peculiar optical properties of the metallic core. In this review, we present recent advances on glyco-gold nanoparticle applications in different biological fields, highlighting the key parameters which inspire the glyco ...
Cross-correlations and influence in world gold markets
Lin, Min; Wang, Gang-Jin; Xie, Chi; Stanley, H. Eugene
2018-01-01
Using the detrended cross-correlation analysis (DCCA) coefficient and the detrended partial cross-correlation analysis (DPCCA) coefficient, we investigate cross-correlations and net cross-correlations among five major world gold markets (London, New York, Shanghai, Tokyo, and Mumbai) at different time scales. We propose multiscale influence measures for examining the influence of individual markets on other markets and on the entire system. We find (i) that the cross-correlations, net cross-correlations, and net influences among the five gold markets vary across time scales, (ii) that the cross-market correlation between London and New York at each time scale is intense and inherent, meaning that the influence of other gold markets on the London-New York market is negligible, (iii) that the remaining cross-market correlations (i.e., those other than London-New York) are greatly affected by other gold markets, and (iv) that the London gold market significantly affects the other four gold markets and dominates the world-wide gold market. Our multiscale findings give market participants and market regulators new information on cross-market linkages in the world-wide gold market.
DEFF Research Database (Denmark)
Neumann, Tim; Rasmussen, Mette; Ghith, Nermin
2013-01-01
To evaluate the real-life effect of an evidence-based Gold Standard Programme (GSP) for smoking cessation interventions in disadvantaged patients and to identify modifiable factors that consistently produce the highest abstinence rates.......To evaluate the real-life effect of an evidence-based Gold Standard Programme (GSP) for smoking cessation interventions in disadvantaged patients and to identify modifiable factors that consistently produce the highest abstinence rates....
Gold nanoprobes for theranostics
Panchapakesan, Balaji; Book-Newell, Brittany; Sethu, Palaniappan; Rao, Madhusudhana; Irudayaraj, Joseph
2011-01-01
Gold nanoprobes have become attractive diagnostic and therapeutic agents in medicine and life sciences research owing to their reproducible synthesis with atomic level precision, unique physical and chemical properties, versatility of their morphologies, flexibility in functionalization, ease of targeting, efficiency in drug delivery and opportunities for multimodal therapy. This review highlights some of the recent advances and the potential for gold nanoprobes in theranostics. PMID:22122586
The effect of cysteine on electrodeposition of gold nanoparticle
International Nuclear Information System (INIS)
Dolati, A.; Imanieh, I.; Salehi, F.; Farahani, M.
2011-01-01
Highlights: → Cysteine was found as an appropriate additive for electrodeposition of gold nanoparticles. → The deposition mechanism of gold nanoparticle was determined as instantaneous nucleation. → Oxygen reduction on the gold nanoparticle surface was eight times greater than that on the conventional gold deposits. - Abstract: The most applications of gold nanoparticles are in the photo-electronical accessories and bio-chemical sensors. Chloride solution with cysteine additive was used as electrolyte in gold nanoparticles electrodeposition. The nucleation and growing mechanism were studied by electrochemical techniques such as cyclic voltammetry and chronoamperometry, in order to obtain a suitable nano structure. The deposition mechanism was determined as instantaneous nucleation and the dimension of particles was controlled in nanometric particle size range. Atomic Force Microscope was used to evaluate the effect of cysteine on the morphology and topography of gold nanoparticles. Finally the catalytic property of gold nanoparticle electrodeposited was studied in KOH solution, where oxygen reduction on the gold nanoparticle surface was eight times greater than that on the conventional gold deposits.
Structure and reactivity of a mononuclear gold(II) complex
Preiß, Sebastian; Förster, Christoph; Otto, Sven; Bauer, Matthias; Müller, Patrick; Hinderberger, Dariush; Hashemi Haeri, Haleh; Carella, Luca; Heinze, Katja
2017-12-01
Mononuclear gold(II) complexes are very rare labile species. Transient gold(II) species have been suggested in homogeneous catalysis and in medical applications, but their geometric and electronic structures have remained essentially unexplored: even fundamental data, such as the ionic radius of gold(II), are unknown. Now, an unprecedentedly stable neutral gold(II) complex of a porphyrin derivative has been isolated, and its structural and spectroscopic features determined. The gold atom adopts a 2+2 coordination mode in between those of gold(III) (four-coordinate square planar) and gold(I) (two-coordinate linear), owing to a second-order Jahn-Teller distortion enabled by the relativistically lowered 6s orbital of gold. The reactivity of this gold(II) complex towards dioxygen, nitrosobenzene and acids is discussed. This study provides insight on the ionic radius of gold(II), and allows it to be placed within the homologous series of nd9 Cu/Ag/Au divalent ions and the 5d8/9/10 Pt/Au/Hg 'relativistic' triad in the periodic table.
Chaves, Joana Darc Souza; Damasceno, Jaqueline Lopes; Paula, Marcela Cristina Ferreira; de Oliveira, Pollyanna Francielli; Azevedo, Gustavo Chevitarese; Matos, Renato Camargo; Lourenço, Maria Cristina S; Tavares, Denise Crispim; Silva, Heveline; Fontes, Ana Paula Soares; de Almeida, Mauro Vieira
2015-10-01
Novel gold(I) and gold(III) complexes containing derivatives of D-galactose, D-ribose and D-glucono-1,5-lactone as ligands were synthesized and characterized by IR, (1)H, and (13)C NMR, high resolution mass spectra and cyclic voltammetry. The compounds were evaluated in vitro for their cytotoxicity against three types of tumor cells: cervical carcinoma (HeLa) breast adenocarcinoma (MCF-7) and glioblastoma (MO59J) and one non-tumor cell line: human lung fibroblasts (GM07492A). Their antitubercular activity was evaluated as well expressed as the minimum inhibitory concentration (MIC90) in μg/mL. In general, the gold(I) complexes were more active than gold(III) complexes, for example, the gold(I) complex (1) was about 8.8 times and 7.6 times more cytotoxic than gold(III) complex (8) in MO59J and MCF-7 cells, respectively. Ribose and alkyl phosphine derivative complexes were more active than galactose and aryl phosphine complexes. The presence of a thiazolidine ring did not improve the cytotoxicity. The study of the cytotoxic activity revealed effective antitumor activities for the gold(I) complexes, being more active than cisplatin in all the tested tumor cell lines. Gold(I) compounds (1), (2), (3), (4) and (6) exhibited relevant antitubercular activity even when compared with first line drugs such as rifampicin.
Increased cellular uptake of peptide-modified PEGylated gold nanoparticles.
He, Bo; Yang, Dan; Qin, Mengmeng; Zhang, Yuan; He, Bing; Dai, Wenbing; Wang, Xueqing; Zhang, Qiang; Zhang, Hua; Yin, Changcheng
2017-12-09
Gold nanoparticles are promising drug delivery vehicles for nucleic acids, small molecules, and proteins, allowing various modifications on the particle surface. However, the instability and low bioavailability of gold nanoparticles compromise their clinical application. Here, we functionalized gold nanoparticles with CPP fragments (CALNNPFVYLI, CALRRRRRRRR) through sulfhydryl PEG to increase their stability and bioavailability. The resulting gold nanoparticles were characterized with transmission electron microscopy (TEM), dynamic light scattering (DLS), UV-visible spectrometry and X-ray photoelectron spectroscopy (XPS), and the stability in biological solutions was evaluated. Comparing to PEGylated gold nanoparticles, CPP (CALNNPFVYLI, CALRRRRRRRR)-modified gold nanoparticles showed 46 folds increase in cellular uptake in A549 and B16 cell lines, as evidenced by the inductively coupled plasma atomic emission spectroscopy (ICP-AES). The interactions between gold nanoparticles and liposomes indicated CPP-modified gold nanoparticles bind to cell membrane more effectively than PEGylated gold nanoparticles. Surface plasmon resonance (SPR) was used to measure interactions between nanoparticles and the membrane. TEM and uptake inhibitor experiments indicated that the cellular entry of gold nanoparticles was mediated by clathrin and macropinocytosis. Other energy independent endocytosis pathways were also identified. Our work revealed a new strategy to modify gold nanoparticles with CPP and illustrated the cellular uptake pathway of CPP-modified gold nanoparticles. Copyright © 2017 Elsevier Inc. All rights reserved.
Antifungal activity of gold nanoparticles prepared by solvothermal method
Energy Technology Data Exchange (ETDEWEB)
Ahmad, Tokeer, E-mail: tahmad3@jmi.ac.in [Nanochemistry Laboratory, Department of Chemistry, Jamia Millia Islamia, New Delhi 110025 (India); Wani, Irshad A.; Lone, Irfan H.; Ganguly, Aparna [Nanochemistry Laboratory, Department of Chemistry, Jamia Millia Islamia, New Delhi 110025 (India); Manzoor, Nikhat; Ahmad, Aijaz [Department of Biosciences, Jamia Millia Islamia, New Delhi 110025 (India); Ahmed, Jahangeer [Department of Chemistry, Michigan State University, East Lansing, MI 48824 (United States); Al-Shihri, Ayed S. [Department of Chemistry, Faculty of Science, King Khalid University, Abha 61413, P.O. Box 9004 (Saudi Arabia)
2013-01-15
Graphical abstract: Gold nanoparticles (7 and 15 nm) of very high surface area (329 and 269 m{sup 2}/g) have been successfully synthesized through solvothermal method by using tin chloride and sodium borohydride as reducing agents. As-prepared gold nanoparticles shows very excellent antifungal activity against Candida isolates and activity increases with decrease in the particle size. Display Omitted Highlights: ► Effect of reducing agents on the morphology of gold nanoparticles. ► Highly uniform and monodisperse gold nanoparticles (7 nm). ► Highest surface area of gold nanoparticles (329 m{sup 2/}g). ► Excellent antifungal activity of gold nanoparticles against Candida strains. -- Abstract: Gold nanoparticles have been successfully synthesized by solvothermal method using SnCl{sub 2} and NaBH{sub 4} as reducing agents. X-ray diffraction studies show highly crystalline and monophasic nature of the gold nanoparticles with face centred cubic structure. The transmission electron microscopic studies show the formation of nearly spherical gold nanoparticles of average size of 15 nm using SnCl{sub 2}, however, NaBH{sub 4} produced highly uniform, monodispersed and spherical gold nanoparticles of average grain size of 7 nm. A high surface area of 329 m{sup 2}/g for 7 nm and 269 m{sup 2}/g for 15 nm gold nanoparticles was observed. UV–vis studies assert the excitations over the visible region due to transverse and longitudinal surface plasmon modes. The gold nanoparticles exhibit excellent size dependant antifungal activity and greater biocidal action against Candida isolates for 7 nm sized gold nanoparticles restricting the transmembrane H{sup +} efflux of the Candida species than 15 nm sized gold nanoparticles.
Antifungal activity of gold nanoparticles prepared by solvothermal method
International Nuclear Information System (INIS)
Ahmad, Tokeer; Wani, Irshad A.; Lone, Irfan H.; Ganguly, Aparna; Manzoor, Nikhat; Ahmad, Aijaz; Ahmed, Jahangeer; Al-Shihri, Ayed S.
2013-01-01
Graphical abstract: Gold nanoparticles (7 and 15 nm) of very high surface area (329 and 269 m 2 /g) have been successfully synthesized through solvothermal method by using tin chloride and sodium borohydride as reducing agents. As-prepared gold nanoparticles shows very excellent antifungal activity against Candida isolates and activity increases with decrease in the particle size. Display Omitted Highlights: ► Effect of reducing agents on the morphology of gold nanoparticles. ► Highly uniform and monodisperse gold nanoparticles (7 nm). ► Highest surface area of gold nanoparticles (329 m 2/ g). ► Excellent antifungal activity of gold nanoparticles against Candida strains. -- Abstract: Gold nanoparticles have been successfully synthesized by solvothermal method using SnCl 2 and NaBH 4 as reducing agents. X-ray diffraction studies show highly crystalline and monophasic nature of the gold nanoparticles with face centred cubic structure. The transmission electron microscopic studies show the formation of nearly spherical gold nanoparticles of average size of 15 nm using SnCl 2 , however, NaBH 4 produced highly uniform, monodispersed and spherical gold nanoparticles of average grain size of 7 nm. A high surface area of 329 m 2 /g for 7 nm and 269 m 2 /g for 15 nm gold nanoparticles was observed. UV–vis studies assert the excitations over the visible region due to transverse and longitudinal surface plasmon modes. The gold nanoparticles exhibit excellent size dependant antifungal activity and greater biocidal action against Candida isolates for 7 nm sized gold nanoparticles restricting the transmembrane H + efflux of the Candida species than 15 nm sized gold nanoparticles.
The gold standard: gold nanoparticle libraries to understand the nano-bio interface.
Alkilany, Alaaldin M; Lohse, Samuel E; Murphy, Catherine J
2013-03-19
Since the late 1980s, researchers have prepared inorganic nanoparticles of many types--including elemental metals, metal oxides, metal sulfides, metal selenides, and metal tellurides--with excellent control over size and shape. Originally many researchers were primarily interested in exploring the quantum size effects predicted for such materials. Applications of inorganic nanomaterials initially centered on physics, optics, and engineering but have expanded to include biology. Many current nanomaterials can serve as biochemical sensors, contrast agents in cellular or tissue imaging, drug delivery vehicles, or even as therapeutics. In this Account we emphasize that the understanding of how nanomaterials will function in a biological system relies on the knowledge of the interface between biological systems and nanomaterials, the nano-bio interface. Gold nanoparticles can serve as excellent standards to understand more general features of the nano-bio interface because of its many advantages over other inorganic materials. The bulk material is chemically inert, and well-established synthetic methods allow researchers to control its size, shape, and surface chemistry. Gold's background concentration in biological systems is low, which makes it relatively easy to measure it at the part-per-billion level or lower in water. In addition, the large electron density of gold enables relatively simple electron microscopic experiments to localize it within thin sections of cells or tissue. Finally, gold's brilliant optical properties at the nanoscale are tunable with size, shape, and aggregation state and enable many of the promising chemical sensing, imaging, and therapeutic applications. Basic experiments with gold nanoparticles and cells include measuring the toxicity of the particles to cells in in vitro experiments. The species other than gold in the nanoparticle solution can be responsible for the apparent toxicity at a particular dose. Once the identity of the toxic
Subchronic inhalation toxicity of gold nanoparticles
Directory of Open Access Journals (Sweden)
Chung Yong
2011-05-01
Full Text Available Abstract Background Gold nanoparticles are widely used in consumer products, including cosmetics, food packaging, beverages, toothpaste, automobiles, and lubricants. With this increase in consumer products containing gold nanoparticles, the potential for worker exposure to gold nanoparticles will also increase. Only a few studies have produced data on the in vivo toxicology of gold nanoparticles, meaning that the absorption, distribution, metabolism, and excretion (ADME of gold nanoparticles remain unclear. Results The toxicity of gold nanoparticles was studied in Sprague Dawley rats by inhalation. Seven-week-old rats, weighing approximately 200 g (males and 145 g (females, were divided into 4 groups (10 rats in each group: fresh-air control, low-dose (2.36 × 104 particle/cm3, 0.04 μg/m3, middle-dose (2.36 × 105 particle/cm3, 0.38 μg/m3, and high-dose (1.85 × 106 particle/cm3, 20.02 μg/m3. The animals were exposed to gold nanoparticles (average diameter 4-5 nm for 6 hours/day, 5 days/week, for 90-days in a whole-body inhalation chamber. In addition to mortality and clinical observations, body weight, food consumption, and lung function were recorded weekly. At the end of the study, the rats were subjected to a full necropsy, blood samples were collected for hematology and clinical chemistry tests, and organ weights were measured. Cellular differential counts and cytotoxicity measurements, such as albumin, lactate dehydrogenase (LDH, and total protein were also monitored in a cellular bronchoalveolar lavage (BAL fluid. Among lung function test measurements, tidal volume and minute volume showed a tendency to decrease comparing control and dose groups during the 90-days of exposure. Although no statistically significant differences were found in cellular differential counts, histopathologic examination showed minimal alveoli, an inflammatory infiltrate with a mixed cell type, and increased macrophages in the high-dose rats. Tissue
Genesis of uranium-gold pyritic conglomerates
International Nuclear Information System (INIS)
Myers, W.B.
1981-01-01
The ancient pyritic ore conglomerates have a common origin best exemplified by the Witwatersrand deposits. All contain detrital pyrite and uraninite, which are unstable in modern oxygenated environments and were deposited in a reducing atmosphere. The Rand reefs are not similar to modern gold placers. Placers result from the near incapacity of streams and currents to transport coarse gold. Placers as rich as Rand reef occur only in narrow paystreaks within 15 kilometers of a coarse-gold source. The board dispersion of gold in the reefs is due to solution transport of metal complexed as aurous sulfide, leached anoxygenically from crustal rocks, probably from sea-floor basalt, and precipitated by a slow reaction driven by the radioactive decay of detrital uraninite. Radiolysis of water on shallow marine unconformities resulted in diffusion of hydrogen to the atmosphere and a slight excess of hydroxyl free radical in the reef environment. The mild oxidizing tendency slowly dissolved uranium, precipitated gold, and oxygenated thucholite. These actions define a maturing process. A uraninite placer accumulating on an unconformity becomes progressively converted to a gold reef with little residual uraninite. The most mature reefs tend to grade toward the thucholite-seam type, very thin but exceedingly rich in gold. A combination of chemical attack and physical reworking accounts for the general thinness of mature reefs. Pyrite, like uraninite, decreases in abundance with increasing maturity; buffering by pyrite moderated the oxidative depletion of uranium. Where pyrite was scanty or absent, uraninite was completely dissolved by the effects of radiolysis and no ore formed
Single layer porous gold films grown at different temperatures
International Nuclear Information System (INIS)
Zhang Renyun; Hummelgard, Magnus; Olin, Hakan
2010-01-01
Large area porous gold films can be used in several areas including electrochemical electrodes, as an essential component in sensors, or as a conducting material in electronics. Here, we report on evaporation induced crystal growth of large area porous gold films at 20, 40 and 60 deg. C. The gold films were grown on liquid surface at 20 deg. C, while the films were grown on the wall of beakers when temperature increased to 40 and 60 deg. C. The porous gold films consisted of a dense network of gold nanowires as characterized by TEM and SEM. TEM diffraction results indicated that higher temperature formed larger crystallites of gold wires. An in situ TEM imaging of the coalescence of gold nanoparticles mimicked the process of the growth of these porous films, and a plotting of the coalescence time and the neck radius showed a diffusion process. The densities of these gold films were also characterized by transmittance, and the results showed film grown at 20 deg. C had the highest density, while the film grown at 60 deg. C had the lowest consistent with SEM and TEM characterization. Electrical measurements of these gold films showed that the most conductive films were the ones grown at 40 deg. C. The conductivities of the gold films were related to the amount of contamination, density and the diameter of the gold nanowires in the films. In addition, a gold film/gold nanoparticle hybrid was made, which showed a 10% decrease in transmittance during hybridization, pointing to applications as chemical and biological sensors.
International Nuclear Information System (INIS)
Anon.
1983-01-01
Vaal Reefs Mine, the world's top gold producer with an output last quarter of 19,6 tons of gold, is to expand further with the building of an 120 000t/month run-of-mine mill at the new No 9 Shaft in the south area, linked with a carbon-in-pulp plant
CO oxidation on gold nanoparticles: Theoretical studies
DEFF Research Database (Denmark)
Remediakis, Ioannis; Lopez, Nuria; Nørskov, Jens Kehlet
2005-01-01
We present a summary of our theoretical results regarding CO oxidation on both oxide-supported and isolated gold nanoparticles. Using Density Functional Theory we have studied the adsorption of molecules and the oxidation reaction of CO on gold clusters. Low-coordinated sites on the gold...... nanoparticles can adsorb small inorganic molecules such as O2 and CO, and the presence of these sites is the key factor for the catalytic properties of supported gold nanoclusters. Other contributions, induced by the presence of the support, can provide parallel channels for the reaction and modulate the final...
Use of coal-oil agglomerates for particulate gold recovery
Energy Technology Data Exchange (ETDEWEB)
Calvez, J.P.S.; Kim, M.J.; Wong, P.L.M.; Tran, T. [University of New South Wales, Sydney, NSW (Australia). School of Chemical Engineering and Industrial Chemistry
1998-09-01
The underlying principles by which gold is recovered by coal-oil agglomerates was investigated. The effects of various parameters such as oil:coal ratios, agglomerate:ore ratios, pH and coal particle size on gold recovery were evaluated using synthetic gold bearing samples, bituminous coal, and diesel oil and kerosene. The effects of sulfides on gold recovery and the depth of gold particle penetration within the agglomerates were also investigated. Results showed that gold recovery was increased by increasing agglomerate:ore ratio, decreasing oil:coal ratio and decreasing coal particle size. There was no significant difference in gold recoveries at pH range of 4-12 and at up to 5% sulfides in the feed.
Preparation of gold nanoparticles by arc discharge in water
International Nuclear Information System (INIS)
Lung, Jen-Kuang; Huang, Jen-Chuen; Tien, Der-Chi; Liao, Chih-Yu; Tseng, Kuo-Hsiung; Tsung, Tsing-Tshin; Kao, Wen-Shiow; Tsai, Teh-Hua; Jwo, Ching-Song; Lin, Hong-Ming; Stobinski, Leszek
2007-01-01
Gold nanoparticles have been attracting attention due to their extensive application in chemistry, physics, material science, electronics, catalysis and bionanotechnology. Synthesis of gold nanoparticles often involves toxic and expensive physical-chemistry methods. Preparation of gold nanoparticles by arc discharge in water is proposed for the first time. Fabrication of gold nanostructures in deionized water has been successfully established. The evidence of gold particles' light absorbance reveals a unique surface plasmon resonance for Au nanoparticles suspended in deionized water. Gold nanostructures uniformly dispersed in water, their UV-Vis absorption and crystalline size are shown. Our experimental results demonstrate that fabrication of gold nanoparticles by arc discharge in water is an alternative, cheap, effective and environmentally friendly method
Geochemical indicators of gold ore fields
International Nuclear Information System (INIS)
Shcherbakov, Yu.G.
1995-01-01
The principles of selection of indicators for genetic reconstructions and prognostic valuations of gold mineralization of diverse morphological and geochemical types have been substantiated. The neutron-activation analysis with radiochemical separation and detection limit of 1-10 -8 %, instrumental neutron-activation analysis and atomic-absorption analysis are the main methods of determination of gold low contents in the rocks, as well as diverse elements, including transition, rare earth elements and tellurium, in gold. 50 refs.; 1 fig.; 3 tabs
Glyco-gold nanoparticles: synthesis and applications
Directory of Open Access Journals (Sweden)
Federica Compostella
2017-05-01
Full Text Available Glyco-gold nanoparticles combine in a single entity the peculiar properties of gold nanoparticles with the biological activity of carbohydrates. The result is an exciting nanosystem, able to mimic the natural multivalent presentation of saccharide moieties and to exploit the peculiar optical properties of the metallic core. In this review, we present recent advances on glyco-gold nanoparticle applications in different biological fields, highlighting the key parameters which inspire the glyco nanoparticle design.
Thiosulfate leaching of gold from waste mobile phones.
Ha, Vinh Hung; Lee, Jae-chun; Jeong, Jinki; Hai, Huynh Trung; Jha, Manis K
2010-06-15
The present communication deals with the leaching of gold from the printed circuit boards (PCBs) of waste mobile phones using an effective and less hazardous system, i.e., a copper-ammonia-thiosulfate solution, as an alternative to the conventional and toxic cyanide leaching of gold. The influence of thiosulfate, ammonia and copper sulfate concentrations on the leaching of gold from PCBs of waste mobile phones was investigated. Gold extraction was found to be enhanced with solutions containing 15-20 mM cupric, 0.1-0.14 M thiosulfate, and 0.2-0.3 M ammonia. Similar trends were obtained for the leaching of gold from two different types of scraps and PCBs of waste mobile phones. From the scrap samples, 98% of the gold was leached out using a solution containing 20 mM copper, 0.12 M thiosulfate and 0.2 M ammonia. Similarly, the leaching of gold from the PCBs samples was also found to be good, but it was lower than that of scrap samples in similar experimental conditions. In this case, only 90% of the gold was leached, even with a contact time of 10h. The obtained data will be useful for the development of processes for the recycling of gold from waste mobile phones. Copyright 2010 Elsevier B.V. All rights reserved.
Geochemical methodology for gold prospect ion in Uruguay
International Nuclear Information System (INIS)
Spangenber, J.
1987-01-01
This work is about the history of gold prospection in Uruguay. In this study there are considered the geochemical aspects, the gold performance, the applicability to mining prospection and the gold prospection aluvionar
Directory of Open Access Journals (Sweden)
Ellen Hardy
2004-12-01
Full Text Available OBJETIVO: Este artigo apresenta a avaliação da estrutura, funcionamento e atuação de 17 Comitês de Ética em Pesquisa, na opinião de seus presidentes, considerando as determinações da Resolução 196/96 do Conselho Nacional de Saúde, Ministério da Saúde, Brasil. MÉTODOS: Foram identificados os presidentes de 33 Comitês que avaliavam projetos de pesquisa em regulação da fecundidade. Eles foram indicados pelos responsáveis dos serviços de ginecologia de 46 faculdades de medicina no Brasil e pelos diretores de quatro centros de pesquisa em reprodução humana. Uma carta foi enviada aos presidentes, convidando-os a participar voluntariamente de uma pesquisa, preenchendo um questionário. RESULTADOS: Dezessete presidentes responderam o questionário. Os resultados mostraram uma série de violações à Resolução 196/96. Três Comitês não tinham representantes da comunidade; quatro demoravam mais de um mês para emitir o parecer final dos protocolos e 13 não acompanhavam o desenvolvimento dos projetos. A composição e arquivamento dos protocolos estavam de acordo com a Resolução, porém, o tempo de mandato era diferente do estabelecido em oito dos Comitês avaliados. Quase todos os presidentes (entre 14 e 17 consideraram a composição e atuação de seus CEPs adequados. A grande maioria dos presidentes (11 qualificou a Resolução como sendo apropriada, porém, difícil de ser cumprida. CONCLUSÃO: Os resultados sugerem que um amplo debate sobre a viabilidade operacional da Resolução seria oportuno. Este processo resultaria em sugestões valiosas para o aperfeiçoamento e aplicabilidade das normas. Isto contribuiria para a melhoria da qualidade cientifica e ética dos estudos desenvolvidos no Brasil.PURPOSE: This article intends to evaluate the structure, functioning and performance of 17 Institutional Review Boards (IRB, from the viewpoint of their presidents, in relation to the instructions of Resolution 196/96 of the
Directory of Open Access Journals (Sweden)
Vestbo J
2012-09-01
Full Text Available Jørgen VestboUniversity of Manchester, Manchester, UKI read with interest the paper entitled "Diagnosis of airway obstruction in the elderly: contribution of the SARA study" by Sorino et al in a recent issue of this journal.1 Being involved in the Global Initiative for Obstructive Lung Diseases (GOLD, it is nice to see the interest sparked by the GOLD strategy document. However, in the paper by Sorino et al, there are a few misunderstandings around GOLD and the fixed ratio (forced expiratory volume in 1 second/forced volume vital capacity < 0.70 that need clarification.View original paper by Sorino and colleagues.
Directory of Open Access Journals (Sweden)
Leonarda F. Liotta
2014-07-01
Full Text Available Gold is an element that has fascinated mankind for millennia. The catalytic properties of gold have been a source of debate, due to its complete chemical inertness when in a bulk form, while it can oxidize CO at temperatures as low as ~200 K when in a nanocrystalline state, as discovered by Haruta in the late 1980s [1]. Since then, extensive activity in both applied and fundamental research on gold has been initiated. The importance of the catalysis by gold represents one of the fasted growing fields in science and is proven by the promising applications in several fields, such as green chemistry and environmental catalysis, in the synthesis of single-walled carbon nanotubes, as modifiers of Ni catalysts for methane steam and dry reforming reactions and in biological and electrochemistry applications. The range of reactions catalyzed by gold, as well as the suitability of different supports and the influence of the preparation conditions have been widely explored and optimized in applied research [2]. Gold catalysts appeared to be very different from the other noble metal-based catalysts, due to their marked dependence on the preparation method, which is crucial for the genesis of the catalytic activity. Several methods, including deposition-precipitation, chemical vapor deposition and cation adsorption, have been applied for the preparation of gold catalysts over reducible oxides, like TiO2. Among these methods, deposition-precipitation has been the most frequently employed method for Au loading, and it involves the use of tetrachloroauric (III acid as a precursor. On the other hand, the number of articles dealing with Au-loaded acidic supports is smaller than that on basic supports, possibly because the deposition of [AuCl4]− or [AuOHxCl4−x]− species on acidic supports is difficult, due to their very low point of zero charge. Despite this challenge, several groups have reported the use of acidic zeolites as supports for gold. Zeolites
Phytomining for Artisanal Gold Mine Tailings Management
Directory of Open Access Journals (Sweden)
Baiq Dewi Krisnayanti
2016-08-01
Full Text Available Mine tailings are generally disposed of by artisanal and small scale gold miners in poorly constructed containment areas and this leads to environmental risk. Gold phytomining could be a possible option for tailings management at artisanal and small-scale gold mining (ASGM locations where plants accumulate residual gold in their above ground biomass. The value of metal recovered from plants could offset some of the costs of environmental management. Getting gold into plants has been repeatedly demonstrated by many research groups; however, a simple working technology to get gold out of plants is less well described. A field experiment to assess the relevance of the technology to artisanal miners was conducted in Central Lombok, Indonesia between April and June 2015. Tobacco was planted in cyanidation tailings (1 mg/kg gold and grown for 2.5 months before the entire plot area was irrigated with NaCN to induce metal uptake. Biomass was then harvested (100 kg, air dried, and ashed by miners in equipment currently used to ash activated carbon at the end of a cyanide leach circuit. Borax and silver as a collector metal were added to the tobacco ash and smelted at high temperature to extract metals from the ash. The mass of the final bullion (39 g was greater than the mass of silver used as a collector (31 g, indicating recovery of metals from the biomass through the smelt process. The gold yield of this trial was low (1.2 mg/kg dry weight biomass concentration, indicating that considerable work must still be done to optimise valuable metal recovery by plants at the field scale. However, the described method to process the biomass was technically feasible, and represents a valid technique that artisanal and small-scale gold miners are willing to adopt if the economic case is good.
2010-10-19
... Authority Foreign-Trade Zone 196 ATC Logistics & Electronics (Cell Phone Kitting) Fort Worth, TX Pursuant to... Foreign-Trade Zones Board (the Board) adopts the following Order: Whereas, ATC Logistics & Electronics... Logistics & Electronics, as described in the application and Federal Register notice, is approved, subject...
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Markings for lifesaving appliances, instructions to..., etc. § 196.37-37 Markings for lifesaving appliances, instructions to passengers, and stowage locations. Lifesaving appliances, instructions to passengers, and stowage locations must be marked in accordance with...
Multifunctional gold nanoparticles for photodynamic therapy of cancer
Khaing Oo, Maung Kyaw
As an important and growing branch of photomedicine, photodynamic therapy (PDT) is being increasingly employed in clinical applications particularly for the treatment of skin cancer. This dissertation focuses on the synthesis, characterization and deployment of gold nanoparticles for enhanced PDT of fibrosarcoma cancer cells. We have developed robust strategies and methods in fabrication of gold nanoparticles with positively- and negatively-tethered surface charges by photo-reduction of gold chloride salt using branched polyethyleneimine and sodium citrate respectively. An optimal concentration window of gold salt has been established to yield the most stable and monodispersed gold nanoparticles. 5-aminolevulinic acid (5-ALA), a photosensitizing precursor, has been successfully conjugated on to positively charged gold nanoparticles through electrostatic interactions. The 5-ALA/gold nanoparticle conjugates are biocompatible and have shown to be preferably taken up by cancer cells. Subsequent light irradiation results in the generation of reactive oxygen species (ROS) in cancer cells, leading to their destruction without adverse effects on normal fibroblasts. We have demonstrated for the first time that gold nanoparticles can enhance PDT efficacy by 50% compared to the treatment with 5-ALA alone. Collected evidence has strongly suggested that this enhancement stems from the elevated formation of ROS via the strongly localized electric field of gold nanoparticles. Through single cell imaging using surface-enhanced Raman scattering enabled by the very same gold nanoparticles, we have shown that multifunctionality of gold nanoparticles can be harvested concurrently for biomedical applications in general and for PDT in specific. In other words, gold nanoparticles can be used not only for targeted drug delivery and field-enhanced ROS formation, but also for monitoring cell destructions during PDT. Finally, our COMSOL Multiphysics simulation of the size-dependent electric
Morphology dependent electrical transport behavior in gold nanostructures
International Nuclear Information System (INIS)
Alkhatib, A.; Souier, T.; Chiesa, M.
2011-01-01
The mechanism of electron transport in ultra-thin gold films is investigated and its dependence on the gold islands size is reported. For gold films of thickness below 38 nm, the electrical transport occurs by tunneling within electrically discontinuous islands of gold. Simmons model for metal-insulator-metal junction describes the non-ohmic experimental current-voltage curves obtained by means of conductive atomic force microscopy. Field emission is the predominant transport for thicknesses below 23 nm while direct tunneling occurs in thicker films. The transition between the two regimes is controlled by the gold islands size and their inter-distance.
Formation of neutral and charged gold carbonyls on highly facetted gold nanostructures
Chau, Thoi-Dai; Visart de Bocarmé, Thierry; Kruse, Norbert; Wang, Richard L. C.; Kreuzer, Hans Jürgen
2003-12-01
We show that gold mono- and di-carbonyls are formed on gold field emitter tips during interaction with carbon monoxide gas at room temperature and in the presence of high electrostatic fields. The experiments are done in a time-of-flight atom probe to obtain mass spectra. The yield of monocarbonyl cations is about twice that of di-carbonyl ions. Density functional theory calculations are reported that explain the field stabilization of adsorbed carbonyls and the desorption yield of their cations.
Phospholipid-assisted synthesis of size-controlled gold nanoparticles
International Nuclear Information System (INIS)
He Peng; Zhu Xinyuan
2007-01-01
Morphology and size control of gold nanoparticles (AuNPs) by phospholipids (PLs) has been reported. It was found that gold entities could form nanostructures with different sizes controlled by PLs in an aqueous solution. During the preparation of 1.5 nm gold seeds, AuNPs were obtained from the reduction of gold complex by sodium borohydride and capped by citrate for stabilization. With the different ratios between seed solution and growth solution, which was composed by gold complex and PLs, gold seeds grew into larger nanoparticles step by step until enough large size up to 30 nm. The main discovery of this work is that common biomolecules, such as PLs can be used to control nanoparticle size. This conclusion has been confirmed by transmission electron micrographs, particle size analysis, and UV-vis spectra
Determination of gold coating thickness measurement by using EDXRF
International Nuclear Information System (INIS)
Meor Yusoff Meor Sulaian; Masliana Muslimin; Fadlullah Jili Fursani
2005-01-01
The paper relates a study on the development of an analysis procedure for measuring the gold coating thickness using EDXRF technique. Gold coating thickness was measured by relating the counts under the Au L? peak its thickness value. In order to get a reasonably accurate result, a calibration graph was plotted using five gold-coated reference standards of different thickness. The calibration graph shows a straight line for thin coating measurement until 0.9 μm. Beyond this the relationship was not linear and this may be resulted from the self-absorption effect. Quantitative analysis was also performed on two different samples of gold coated jewelry and a phone connector. Result from the phone connector analysis seems to agree with the manufacturer gold coating value. From the analysis of gold-coated jewelry it had been able to differentiate the two articles as gold wash and gold electroplated. (Author)
Gold nanoparticle-based electrochemical biosensors
International Nuclear Information System (INIS)
Pingarron, Jose M.; Yanez-Sedeno, Paloma; Gonzalez-Cortes, Araceli
2008-01-01
The unique properties of gold nanoparticles to provide a suitable microenvironment for biomolecules immobilization retaining their biological activity, and to facilitate electron transfer between the immobilized proteins and electrode surfaces, have led to an intensive use of this nanomaterial for the construction of electrochemical biosensors with enhanced analytical performance with respect to other biosensor designs. Recent advances in this field are reviewed in this article. The advantageous operational characteristics of the biosensing devices designed making use of gold nanoparticles are highlighted with respect to non-nanostructured biosensors and some illustrative examples are commented. Electrochemical enzyme biosensors including those using hybrid materials with carbon nanotubes and polymers, sol-gel matrices, and layer-by-layer architectures are considered. Moreover, electrochemical immunosensors in which gold nanoparticles play a crucial role in the electrode transduction enhancement of the affinity reaction as well as in the efficiency of immunoreagents immobilization in a stable mode are reviewed. Similarly, recent advances in the development of DNA biosensors using gold nanoparticles to improve DNA immobilization on electrode surfaces and as suitable labels to improve detection of hybridization events are considered. Finally, other biosensors designed with gold nanoparticles oriented to electrically contact redox enzymes to electrodes by a reconstitution process and to the study of direct electron transfer between redox proteins and electrode surfaces have also been treated
Gold nanoparticle-based electrochemical biosensors
Energy Technology Data Exchange (ETDEWEB)
Pingarron, Jose M.; Yanez-Sedeno, Paloma; Gonzalez-Cortes, Araceli [Department of Analytical Chemistry, Faculty of Chemistry, University Complutense of Madrid, 28040 Madrid (Spain)
2008-08-01
The unique properties of gold nanoparticles to provide a suitable microenvironment for biomolecules immobilization retaining their biological activity, and to facilitate electron transfer between the immobilized proteins and electrode surfaces, have led to an intensive use of this nanomaterial for the construction of electrochemical biosensors with enhanced analytical performance with respect to other biosensor designs. Recent advances in this field are reviewed in this article. The advantageous operational characteristics of the biosensing devices designed making use of gold nanoparticles are highlighted with respect to non-nanostructured biosensors and some illustrative examples are commented. Electrochemical enzyme biosensors including those using hybrid materials with carbon nanotubes and polymers, sol-gel matrices, and layer-by-layer architectures are considered. Moreover, electrochemical immunosensors in which gold nanoparticles play a crucial role in the electrode transduction enhancement of the affinity reaction as well as in the efficiency of immunoreagents immobilization in a stable mode are reviewed. Similarly, recent advances in the development of DNA biosensors using gold nanoparticles to improve DNA immobilization on electrode surfaces and as suitable labels to improve detection of hybridization events are considered. Finally, other biosensors designed with gold nanoparticles oriented to electrically contact redox enzymes to electrodes by a reconstitution process and to the study of direct electron transfer between redox proteins and electrode surfaces have also been treated. (author)
Highly active thermally stable nanoporous gold catalyst
Energy Technology Data Exchange (ETDEWEB)
Biener, Juergen; Wittstock, Arne; Biener, Monika M.; Bagge-Hansen, Michael; Baeumer, Marcus; Wichmann, Andre; Neuman, Bjoern
2016-12-20
In one embodiment, a system includes a nanoporous gold structure and a plurality of oxide particles deposited on the nanoporous gold structure; the oxide particles are characterized by a crystalline phase. In another embodiment, a method includes depositing oxide nanoparticles on a nanoporous gold support to form an active structure and functionalizing the deposited oxide nanoparticles.
Ye, Yafei; Yang, Shengnan; Han, Yanping; Sun, Jingjing; Xv, Lijuan; Wu, Lina; Wang, Yongfeng; Ming, Liang
2018-06-21
Long intergenic non-coding RNA Linc00472 has been considered as a tumor suppressor in some cancers. However, the function and mechanism of Linc00472 in colorectal cancer has not been well elucidated. In this study, we found that Linc00472 was down-regulated in colorectal cancer tissues and cells. Elevated Linc00472 expression suppressed proliferation and induced apoptosis in colorectal cancer cells. Moreover, Linc00472 acted as a competing endogenous RNA (ceRNA) of miR-196a to release programmed cell death 4 (PDCD4). Furthermore, miR-196a overexpression or PDCD4 knockdown reversed Linc00472-mediated proliferation inhibition and apoptosis induction in colorectal cancer cells. Ectopic Linc00472 expression hindered tumor growth in vivo . Our study demonstrated that Linc00472 suppressed proliferation and induced apoptosis through up-regulating PDCD4 by decoying miR-196a, which may be an effective therapeutic target for colorectal cancer.
Gold Photoluminescence: Wavelength and Polarization Engineering
DEFF Research Database (Denmark)
Andersen, Sebastian Kim Hjælm; Pors, Anders Lambertus; Bozhevolnyi, Sergey I.
2015-01-01
We demonstrate engineering of the spectral content and polarization of photoluminescence (PL) from arrayed gold nanoparticles atop a subwavelength-thin dielectric spacer and optically-thick gold film, a configuration that supports gap-surface plasmon resonances (GSPRs). Choice of shapes...... and dimensions of gold nanoparticles influences the GSPR wavelength and polarization characteristics, thereby allowing us to enhance and spectrally mold the plasmon-assisted PL while simultaneously controlling its polarization. In order to understand the underlying physics behind the plasmon-enhanced PL, we...
Gold Rushes and mineral property rights allocation
DEFF Research Database (Denmark)
Sinding, Knud
, is to handle the other projects that are generated by the "gold rush" informational externalities created by the initial discovery. At the core of the problems of dealing with a gold rush situation is both the informational externality and an institutional framework which is not designed to deal with large...... influxes of prospectors competing for a very limited area. This paper charts significant gold rush events in the mineral industry in recent decades and uses preliminary data on the areas impacted by these gold rushes to argue that many mineral tenure systems should be modified in order to be better able...
Adsorption-induced restructuring of gold nanochains
DEFF Research Database (Denmark)
Bahn, Sune Rastad; Lopez, Nuria; Nørskov, Jens Kehlet
2002-01-01
The chemical properties of single-atomic chains of gold atoms are investigated using density functional calculations. The nanochains are shown to be unusually chemically active with strong chemisorption of oxygen atoms and carbon monoxide. The chemisorption energies vary significantly with the st......The chemical properties of single-atomic chains of gold atoms are investigated using density functional calculations. The nanochains are shown to be unusually chemically active with strong chemisorption of oxygen atoms and carbon monoxide. The chemisorption energies vary significantly...... with the strain/stress conditions for the chain. Oxygen atoms are found to energetically prefer to get incorporated into a chain forming a new type of gold-oxygen nanochain with a conductance of one quantum unit. We suggest that the long bond lengths observed in electron microscopy investigations of gold chains...
International Nuclear Information System (INIS)
Clarkson, R.
1998-01-01
In the summers of 1992 and 1994, the author designed and carried out a statistically valid research program using radioactivated gold particles as tracers (radiotracers). Two types of fully cased normal circulation (N / C) drills, two types of reverse circulation (R/C) drills and three solid auger drills were evaluated under a variety of field conditions. A frozen cylindrical core of compacted gravels containing four sizes ( 1.2, 0.60, 0.30 and 0.15 mm), (+l4,+28,+48and+100 mesh)of radiotracers was placed in 44 drill holes and the holes were re drilled. Scintillometers were used to track free gold losses due to spillage and blow-by around the collar (top) of the hole. Some gold particles were located in temporary traps in the drilling equipment and these particles would have contaminated subsequent samples (as carry-over). Several myths commonly attributed to particular drilling methods were dispelled. There was no significant difference between the recovery of the four sizes of gold particles with any of the drills tested. Observations and down-hole scintillometer records indicated that the free gold particles did not follow the bit down the hole and were either carried out of the hole or forced onto the sides of the hole at or above the depth at which the radioactive gold was positioned. A comparative evaluation of the results of these tests is presented
Fabrication of gold nanoparticle arrays by block copolymer
Energy Technology Data Exchange (ETDEWEB)
Chen, Xiao Ling
2011-02-15
Gold nanoparticle is one of the widely research objects in various fields including catalysis and biotechnology. Precise control of gold nanoparticles placement and their integration is essential to take full advantage of these unique properties for applications. An approach to self-assembling of gold nanoparticles (AuNPs) from reconstructed block copolymer was introduced. Highly ordered polystyrene-block-poly(2-vinylpyridine)(PS-b-P2VP) micellar arrays were obtained by solvent annealing. Subsequent immersion of the films in a preferential solvent for P2VP caused a reorganization of the film to generate a porous structure upon drying. PEG-coated AuNPs were spin-coated onto this reconstruction PS-b-P2VP template. When such films were exposed to toluene vapor-which is non-selective solvent for PEO and P2VP, AuNPs were drawn into those porous to form ordered arrays. Gold nanospheres with size 12±1.8 nm were synthesized by reducing HAuCl{sub 4} via sodium citrate. Gold nanorods (aspect ratio about 6) were prepared from seed-mediated surfactant capping wet chemical method and the aspect ratio is tunable by changing surfactant amount. PEG ligand is used to modify gold nanoparticle surface by removing the original surfactant (sodium citrate -gold nanospheres: CTAB-gold nanorods), which have affinity with certain block copolymer component. Once gold nanoparticle is modified with PEG thiol, they were spin coated onto PS-b-P2VP template, which was prepared by solvent annealing and surface reconstruction process. So gold nanoparticle array was fabricated by this self-assembling process. The same idea can be applied on other nanoparticles.
Fabrication of gold nanoparticle arrays by block copolymer
International Nuclear Information System (INIS)
Chen, Xiao Ling
2011-02-01
Gold nanoparticle is one of the widely research objects in various fields including catalysis and biotechnology. Precise control of gold nanoparticles placement and their integration is essential to take full advantage of these unique properties for applications. An approach to self-assembling of gold nanoparticles (AuNPs) from reconstructed block copolymer was introduced. Highly ordered polystyrene-block-poly(2-vinylpyridine)(PS-b-P2VP) micellar arrays were obtained by solvent annealing. Subsequent immersion of the films in a preferential solvent for P2VP caused a reorganization of the film to generate a porous structure upon drying. PEG-coated AuNPs were spin-coated onto this reconstruction PS-b-P2VP template. When such films were exposed to toluene vapor-which is non-selective solvent for PEO and P2VP, AuNPs were drawn into those porous to form ordered arrays. Gold nanospheres with size 12±1.8 nm were synthesized by reducing HAuCl 4 via sodium citrate. Gold nanorods (aspect ratio about 6) were prepared from seed-mediated surfactant capping wet chemical method and the aspect ratio is tunable by changing surfactant amount. PEG ligand is used to modify gold nanoparticle surface by removing the original surfactant (sodium citrate -gold nanospheres: CTAB-gold nanorods), which have affinity with certain block copolymer component. Once gold nanoparticle is modified with PEG thiol, they were spin coated onto PS-b-P2VP template, which was prepared by solvent annealing and surface reconstruction process. So gold nanoparticle array was fabricated by this self-assembling process. The same idea can be applied on other nanoparticles
Effects of dissolucytotic gold ions on recovering brain lesions.
Danscher, Gorm; Larsen, Agnete
2010-04-01
Recent experimental research has shown that metallic gold releases charged gold atoms when placed intracerebrally and that the liberated gold ions affect inflammation in the brain. The observations suggest that metallic gold can be used as a safe suppressor of inflammation in the central nervous system.
Hallmarking as an essential need of gold industry
International Nuclear Information System (INIS)
Mahmood, K.; Alam, S.; Ahmed, T.
2006-01-01
As gold is a soft metal, for Jewellery making it is alloyed with Silver or Copper so that its strength may increase. Other main alloying elements include; Zinc, Cadmium and Nickel. These alloying elements help to reduce cost, improve appearance and to improve chemical properties of gold. The percentage of alloying elements determines the caratages of gold. The gold Jewellery sold in local market is often under-carated. In order to improve the quality of product sold, complete quality assessment of gold should be done. A complete quality assessment includes both Assaying and Hallmarking. Assaying is the analysis of an individual sample of gold from a customer to find out it's composition and Hallmarking refers to physically marking: a piece of Jewellery according to specific laws to certify the purity of metal. In this paper we have assessed and compared the quality of locally manufactured gold ornaments and its alloying components with international market as well as standards of gold and its alloys. And as Hallmarking is one of the main strategic initiatives to improve the quality of product sold for domestic and export consumption, this paper discusses the necessary steps leading to Hallmarking. We have used micro-XRF spectrometer for assaying and Laser Engraving machine for the purpose of Hallmarking. (author)
Gold sales forecasting: The Box-Jenkins methodology
Directory of Open Access Journals (Sweden)
Johannes Tshepiso Tsoku
2017-02-01
Full Text Available The study employs the Box-Jenkins Methodology to forecast South African gold sales. For a resource economy like South Africa where metals and minerals account for a high proportion of GDP and export earnings, the decline in gold sales is very disturbing. Box-Jenkins time series technique was used to perform time series analysis of monthly gold sales for the period January 2000 to June 2013 with the following steps: model identification, model estimation, diagnostic checking and forecasting. Furthermore, the prediction accuracy is tested using mean absolute percentage error (MAPE. From the analysis, a seasonal ARIMA(4,1,4×(0,1,112 was found to be the “best fit model” with an MAPE value of 11% indicating that the model is fit to be used to predict or forecast future gold sales for South Africa. In addition, the forecast values show that there will be a decrease in the overall gold sales for the first six months of 2014. It is hoped that the study will help the public and private sectors to understand the gold sales or output scenario and later plan the gold mining activities in South Africa. Furthermore, it is hoped that this research paper has demonstrated the significance of Box-Jenkins technique for this area of research and that they will be applied in the future.
Directory of Open Access Journals (Sweden)
BRANIMIR N. GRGUR
2005-02-01
Full Text Available Surface modification of the electrodes was conducted from sulfuric acid solutions containing the corresponding metalchloride complexes using cyclic voltammetry. Comparing the charges of the hydrogen underpotential deposition region, and the corresponding oxide reduction regions, it is concluded that a platinum overlayer on gold forms 3D islands, while gold on platinum forms 2D islands. Foreign metals present in an amount of up to one monolayer exert an influence on the change in reaction rate with respect to both hydrogen evolution (HER and oxygen reduction (ORR reactions. Aplatinum overlayer on a gold substrate increases the activity forHER and for ORR, compared with pure gold. These results can be understood in terms of a simple model, in which the change in the H and OH binding energies are directly proportional to the shift of the d-bond center of the overlayer. On the contrary, a gold layer on platinum slightly decreases the activity for both reactions compared with pure platinum.
Biodistribution of gold nanoparticles following intratracheal instillation in mouse lung
DEFF Research Database (Denmark)
Sadauskas, Evaldas; Jacobsen, Nicklas R.; Danscher, Gorm
2009-01-01
plasma mass spectrometry (ICP-MS) and neutron activation analysis (NAA). The liver is the major site of deposition of circulating gold nanoparticles. Therefore the degree of translocation was determined by the hepatic deposition of gold. Mice were instilled with 5 intratracheal doses of gold...... repeatedly during 3 weeks, the load was substantial. Ultrastructurally, AMG silver enhanced gold nanoparticles were found in lysosome-/endosome-like organelles of the macrophages and analysis with AMG, ICP-MS and NAA of the liver revealed an almost total lack of translocation of nanoparticles. In mice given...... repeated instillations of 2 nm gold nanoparticles, 1.4‰ (by ICP-MS) to 1.9‰ (by NAA) of the instilled gold was detected in the liver. With the 40 nm gold, no gold was detected in the liver (detection level 2 ng, 0.1‰) except for one mouse in which 3‰ of the instilled gold was found in the liver. No gold...
The in vitro formation of placer gold by bacteria
Southam, Gordon; Beveridge, Terrance J.
1994-10-01
A laboratory simulation was developed to provide mechanistic information about placer (nugget) gold development in the natural environment. To initiate the simulation, ionic gold was immobilized to a high capacity by Bacillus subtilis 168 (116.2 μg/mg dry weight bacteria) as fine-grained intracellular colloids (5-50 nm). During the low-temperature diagenesis experiment (60°C), the release of organics due to bacterial autolysis coincided with the in vitro formation of hexagonal-octahedral gold crystals (20 μm). This octahedral gold was observed to aggregate, forming fine-grained placer gold (50 μm). In addition to achieving a fundamental understanding into secondary gold deposition, a significant economic benefit could be realized by employing this environmentally safe procedure to concentrate widely dispersed gold in placer deposits to facilitate mining by conventional methodologies.
Site-Specific Biomolecule Labeling with Gold Clusters
Ackerson, Christopher J.; Powell, Richard D.; Hainfeld, James F.
2010-01-01
Site-specific labeling of biomolecules in vitro with gold clusters can enhance the information content of electron cryomicroscopy experiments. This chapter provides a practical overview of well-established techniques for forming biomolecule/gold cluster conjugates. Three bioconjugation chemistries are covered: Linker-mediated bioconjugation, direct gold–biomolecule bonding, and coordination-mediated bonding of nickel(II) nitrilotriacetic acid (NTA)-derivatized gold clusters to polyhistidine (...
Photoemission on gold-55-clusters derived from gold-phosphine AuP(C6H5)3Cl
International Nuclear Information System (INIS)
Quinten, M.; Sander, I.; Steiner, P.; Kreibig, U.; Fauth, K.; Schmid, G.
1991-01-01
We measured XPS and UPS spectra of gold clusters with 55 atoms, embedded in an electrically isolating phosphine matrix, and of gold-phosphine, from which the clusters were chemically derived. Compared to the spectra of bulk gold the valence band spectrum and the core level spectra of the clusters showed shifts of the peaks and the fermi level to higher binding energies. The shift of the peaks could qualitatively be interpreted by a final state effect. We succeeded in a separation of bulk and surface contributions to the core level spectra and in a reasonable quantitative analysis of the valence band spectrum of the clusters. The Au 4f core level spectrum of gold-phosphine showed two peaks at 1.5 eV higher binding energies than the corresponding peaks of the clusters. (orig.)
Study on Sumbawa gold recovery using centrifuge
Ferdana, A. D.; Petrus, H. T. B. M.; Bendiyasa, I. M.; Prijambada, I. D.; Hamada, F.; Sachiko, T.
2018-01-01
The Artisanal Small Gold Mining in Sumbawa has been processing gold with mercury (Hg), which poses a serious threat to the mining and global environment. One method of gold processing that does not use mercury is by gravity method. Before processing the ore first performed an analysis of Mineragraphy and analysis of compound with XRD. Mineragraphy results show that gold is associated with chalcopyrite and covelite and is a single particle (native) on size 58.8 μm, 117 μm up to 294 μm. characterization with XRD shows that the Sumbawa Gold Ore is composed of quartz, pyrite, pyroxene, and sericite compounds. Sentrifugation is one of separation equipment of gravity method to increase concentrate based on difference of specific gravity. The optimum concentration result is influenced by several variables, such as water flow rate and particle size. In this present research, the range of flow rate is 5 lpm and 10 lpm, the particle size - 100 + 200 mesh and -200 +300 mesh. Gold concentration in concentrate is measured by EDX. The result shows that the optimum condition is obtained at a separation with flow rate 5 lpm and a particle size of -100 + 200 mesh.
International Nuclear Information System (INIS)
Ahmed, K.; Dampare, S.B.; Addo, M.A.; Osae, S.; Adotey, D. K.; Adomako, D.
2005-01-01
This paper examines the possibility of improving the extraction process of gold from gold bearing rocks by small-scale gold miners in Ghana. The investigation involved crushing of 25 hard rock gold ore samples with a total weight of 7,126.98g to fine particles to form a composite sample and screening at a range of grind sizes. This was followed by the determination of gold distribution as a function of 'particle size' in the composite sample using INAA. The following concentrations of gold for the corresponding particle sizes are reported: 63-125 μm, 161±0.75 mg/kg; Sub 63 μm, 16.4 ± 0.17 mg/kg; 250-355 μm, 4.66 ± 0. 07; 355-425μm, 1.55 ± 0.06 mg/kg; 1000-2000 μm, 1.27±005 mg/kg; 125-250 μm, 0.53 ± 0.03 mg/kg; 425-1000 μm, 0.180 ± 0.008 mg/kg. An estimate for gold in the composite sample based on particle size yielded an average value of 3.80 mg/kg. (au)
The Complete Reconfiguration of Dendritic Gold
Paneru, Govind; Flanders, Bret
2014-03-01
Reconfigurability-by-design is an important strategy in modern materials science, as materials with this capability could potentially be used to confer hydrophobic, lipophobic, or anti-corrosive character to substrates in a regenerative manner. The present work extends the directed electrochemical nanowire assembly (DENA) methodology, which is a technique that employs alternating voltages to grow single crystalline metallic nanowires and nano-dendrites from simple salt solutions, to enable the complete dissolution of macroscopic arrays of metallic dendrites following their growth. Our main finding is that structural reconfiguration of dendritic gold is induced by changes in the MHz-level frequencies of voltages that are applied to the dendrites. Cyclic voltammetry and micro-Raman spectroscopy have been used to show that dendritic gold grows and dissolves by the same chemical mechanisms as bulk gold. Hence, the redox chemistry that occurs at the crystal-solution interface is no different than the established electrochemistry of gold. What differs in this process and allows for reconfiguration to occur is the diffusive behavior of the gold chloride molecules in the solution adjacent to the interface. We will present a simple model that captures the physics of this behavior.
Protracted elimination of gold nanoparticles from mouse liver
DEFF Research Database (Denmark)
Sadauskas, Evaldas; Wallin, Håkan; Stoltenberg, Meredin
2009-01-01
The present study aims at revealing the fate of 40-nm gold nanoparticles after intravenous injections. The gold nanoparticles were traced histochemically with light and transmission electron microscopy using autometallographic (AMG) staining, and the gold content in the liver was determined with ...
Gold Nanoparticle Microwave Synthesis
Energy Technology Data Exchange (ETDEWEB)
Krantz, Kelsie E. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Christian, Jonathan H. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Coopersmith, Kaitlin [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Washington, II, Aaron L. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Murph, Simona H. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)
2016-07-27
At the nanometer scale, numerous compounds display different properties than those found in bulk material that can prove useful in areas such as medicinal chemistry. Gold nanoparticles, for example, display promise in newly developed hyperthermia therapies for cancer treatment. Currently, gold nanoparticle synthesis is performed via the hot injection technique which has large variability in final particle size and a longer reaction time. One underdeveloped area by which these particles could be produced is through microwave synthesis. To initiate heating, microwaves agitate polar molecules creating a vibration that gives off the heat energy needed. Previous studies have used microwaves for gold nanoparticle synthesis; however, polar solvents were used that partially absorbed incident microwaves, leading to partial thermal heating of the sample rather than taking full advantage of the microwave to solely heat the gold nanoparticle precursors in a non-polar solution. Through this project, microwaves were utilized as the sole heat source, and non-polar solvents were used to explore the effects of microwave heating only as pertains to the precursor material. Our findings show that the use of non-polar solvents allows for more rapid heating as compared to polar solvents, and a reduction in reaction time from 10 minutes to 1 minute; this maximizes the efficiency of the reaction, and allows for reproducibility in the size/shape of the fabricated nanoparticles.
Gold Nanoparticle Microwave Synthesis
International Nuclear Information System (INIS)
Krantz, Kelsie E.; Christian, Jonathan H.; Coopersmith, Kaitlin; Washington II, Aaron L.; Murph, Simona H.
2016-01-01
At the nanometer scale, numerous compounds display different properties than those found in bulk material that can prove useful in areas such as medicinal chemistry. Gold nanoparticles, for example, display promise in newly developed hyperthermia therapies for cancer treatment. Currently, gold nanoparticle synthesis is performed via the hot injection technique which has large variability in final particle size and a longer reaction time. One underdeveloped area by which these particles could be produced is through microwave synthesis. To initiate heating, microwaves agitate polar molecules creating a vibration that gives off the heat energy needed. Previous studies have used microwaves for gold nanoparticle synthesis; however, polar solvents were used that partially absorbed incident microwaves, leading to partial thermal heating of the sample rather than taking full advantage of the microwave to solely heat the gold nanoparticle precursors in a non-polar solution. Through this project, microwaves were utilized as the sole heat source, and non-polar solvents were used to explore the effects of microwave heating only as pertains to the precursor material. Our findings show that the use of non-polar solvents allows for more rapid heating as compared to polar solvents, and a reduction in reaction time from 10 minutes to 1 minute; this maximizes the efficiency of the reaction, and allows for reproducibility in the size/shape of the fabricated nanoparticles.
A Comparative XAFS Study of Gold-thiolate Nanoparticles and Nanoclusters
International Nuclear Information System (INIS)
Chevrier, D M; Chatt, A; Zhang, P; Sham, T K
2013-01-01
Tiopronin-capped gold nanoparticles and gold nanoclusters of sizes 3.0 and 1.5 nm, respectively, were investigated with XAFS at the gold L 3 -edge. The specific EXAFS fitting procedure is discussed for obtaining reliable fit parameters for each system. The difficulties and challenges faced when analysing EXAFS data for gold nanoparticles and nanoclusters are also mentioned. Fitting results for gold nanoparticles reveal a small amount of surface Au-thiolate interactions with a large Au-Au metal core. For gold nanoclusters, only a one-shell fit was obtainable. Instead of Au-Au metal core, long-range interactions are expected for gold nanoclusters. Tiopronin-capped gold nanoclusters are proposed to be polymeric in nature, which helps explain the observed red luminescence.
Controlled adsorption of cytochrome c to nanostructured gold surfaces
International Nuclear Information System (INIS)
Gomes, Inês; Feio, Maria J.; Santos, Nuno C.; Eaton, Peter; Serro, Ana Paula; Saramago, Benilde; Pereira, Eulália; Franco, Ricardo
2012-01-01
Controlled electrostatic physisorption of horse heart cytochrome c (Cyt c) onto nanostructured gold surfaces was investigated using Quartz-Crystal Microbalance measurements in planar gold surfaces with or without functionalization using a self-assembled monolayer (SAM) of the alkanethiol mercaptoundecanoic acid (MUA). MUA is a useful functionalization ligand for gold surfaces, shedding adsorbed biomolecules from the excessive electron density of the metal. A parallel analysis was conducted in the corresponding curved surfaces of 15 nm gold nanoparticles (AuNPs), using zeta-potential and UV– visible spectroscopy. Atomic Force Microscopy of both types of functionalized gold surfaces with a MUA SAM, allowed for visualization of Cyt c deposits on the nanostructured gold surface. The amount of Cyt c adsorbed onto the gold surface could be controlled by the solution pH. For the assays conducted at pH 4.5, when MUA SAM- functionalized planar gold surfaces are positive or neutral, and Cyt c has a positive net charge, only 13 % of the planar gold surface area was coated with protein. In contrast, at pH 7.4, when MUA SAM-functionalized planar gold surfaces and Cyt c have opposite charges, a protein coverage of 28 % could be observed implying an adsorption process strongly governed by electrostatic forces. Cyt c adsorption on planar and curved gold surfaces are found to be greatly favored by the presence of a MUA-capping layer. In particular, on the AuNPs, the binding constant is three times larger than the binding constant obtained for the original citrate-capped AuNPs.
Controlled adsorption of cytochrome c to nanostructured gold surfaces
Energy Technology Data Exchange (ETDEWEB)
Gomes, Ines [Faculdade de Ciencias e Tecnologia, Universidade Nova de Lisboa, REQUIMTE, Departamento de Quimica (Portugal); Feio, Maria J. [Faculdade de Ciencias da Universidade do Porto, REQUIMTE, Departamento de Quimica e Bioquimica (Portugal); Santos, Nuno C. [Faculdade de Medicina da Universidade de Lisboa, Instituto de Medicina Molecular (Portugal); Eaton, Peter [Faculdade de Ciencias da Universidade do Porto, REQUIMTE, Departamento de Quimica e Bioquimica (Portugal); Serro, Ana Paula; Saramago, Benilde [Centro de Quimica Estrutural, Instituto Superior Tecnico (Portugal); Pereira, Eulalia [Faculdade de Ciencias da Universidade do Porto, REQUIMTE, Departamento de Quimica e Bioquimica (Portugal); Franco, Ricardo, E-mail: ricardo.franco@fct.unl.pt [Faculdade de Ciencias e Tecnologia, Universidade Nova de Lisboa, REQUIMTE, Departamento de Quimica (Portugal)
2012-12-15
Controlled electrostatic physisorption of horse heart cytochrome c (Cyt c) onto nanostructured gold surfaces was investigated using Quartz-Crystal Microbalance measurements in planar gold surfaces with or without functionalization using a self-assembled monolayer (SAM) of the alkanethiol mercaptoundecanoic acid (MUA). MUA is a useful functionalization ligand for gold surfaces, shedding adsorbed biomolecules from the excessive electron density of the metal. A parallel analysis was conducted in the corresponding curved surfaces of 15 nm gold nanoparticles (AuNPs), using zeta-potential and UV- visible spectroscopy. Atomic Force Microscopy of both types of functionalized gold surfaces with a MUA SAM, allowed for visualization of Cyt c deposits on the nanostructured gold surface. The amount of Cyt c adsorbed onto the gold surface could be controlled by the solution pH. For the assays conducted at pH 4.5, when MUA SAM- functionalized planar gold surfaces are positive or neutral, and Cyt c has a positive net charge, only 13 % of the planar gold surface area was coated with protein. In contrast, at pH 7.4, when MUA SAM-functionalized planar gold surfaces and Cyt c have opposite charges, a protein coverage of 28 % could be observed implying an adsorption process strongly governed by electrostatic forces. Cyt c adsorption on planar and curved gold surfaces are found to be greatly favored by the presence of a MUA-capping layer. In particular, on the AuNPs, the binding constant is three times larger than the binding constant obtained for the original citrate-capped AuNPs.
Gold and Silver Extraction from Leach Solutions
Bagdaulet K. Kenzhaliyev; Renata R. Iskhakova; Zamzagul D. Dosymbaeva; Esen N. Sulejmenov
2014-01-01
There has been carried out an investigation on the extraction of gold and silver from thiosulfate solutions: standard test and technological solutions of chemical and electrochemical leaching. The influence of related metals on the process of extracting gold from solution was studied. There has been conducted a comparative study of the IR spectra of solutions after the sorption of gold, silver and related metals.
Site-Specific Biomolecule Labeling with Gold Clusters
Ackerson, Christopher J.; Powell, Richard D.; Hainfeld, James F.
2013-01-01
Site-specific labeling of biomolecules in vitro with gold clusters can enhance the information content of electron cryomicroscopy experiments. This chapter provides a practical overview of well-established techniques for forming biomolecule/gold cluster conjugates. Three bioconjugation chemistries are covered: Linker-mediated bioconjugation, direct gold–biomolecule bonding, and coordination-mediated bonding of nickel(II) nitrilotriacetic acid (NTA)-derivatized gold clusters to polyhistidine (His)-tagged proteins. PMID:20887859
Gold and Silver Extraction from Leach Solutions
Directory of Open Access Journals (Sweden)
Bagdaulet K. Kenzhaliyev
2014-03-01
Full Text Available There has been carried out an investigation on the extraction of gold and silver from thiosulfate solutions: standard test and technological solutions of chemical and electrochemical leaching. The influence of related metals on the process of extracting gold from solution was studied. There has been conducted a comparative study of the IR spectra of solutions after the sorption of gold, silver and related metals.
The giant Kalgoorlie Gold Field revisited
Directory of Open Access Journals (Sweden)
Noreen Mary Vielreicher
2016-05-01
Direct timing constraints on gold mineralization indicate that Fimiston- and Mt Charlotte-style mineralization formed within a relative short period of time around 2.64 Ga, and, as such, support a model of progressive deformation of a rheologically heterogeneous rock package late in the structural history. Fluid characteristics, combined with the structural, metamorphic and absolute timing, support description of gold mineralization at the Golden Mile as orogenic and mesozonal, and this allows direct correlation with orogenic gold deposits worldwide, which classically formed during accretion along convergent margins throughout Earth history.
International Nuclear Information System (INIS)
Zhang, Qian-Li; Zhou, Dan-Ling; Wang, Ai-Jun; Qin, Su-Fang; Feng, Jiu-Ju; Li, Yong-Fang
2014-01-01
A simple method was developed for synthesis of network-like gold nanochains and gold nanoflowers in the presence of cytosine by reduction of tetrachloroauric acid with sodium borohydride and ascorbic acid, respectively. The resulting gold nanocrystals were coated with microperoxidase-11 via electrostatic interactions. Electrodes modified with protein-coated gold nanochains or nanoflowers display well-defined and quasi reversible redox peaks and enhanced high electrocatalytic activity toward the reduction of H 2 O 2 that is due to direct electron transfer to the protein. The effects were exploited for the amperometric detection of H 2 O 2 with a linear response from 0.5 μM to 0.13 mM (for the gold nanochains) and from 1.0 μM to 0.11 mM (for the gold nanoflowers), respectively. The sensor shows lower detection limit and faster response time than sensors based on the use of spherical gold nanoparticles. (author)
Beneficiation of the gold bearing ore by gravity and flotation
Gül, Alim; Kangal, Olgaç; Sirkeci, Ayhan A.; Önal, Güven
2012-02-01
Gold concentration usually consists of gravity separation, flotation, cyanidation, or the combination of these processes. The choice among these processes depends on the mineralogical characterization and gold content of the ore. Recently, the recovery of gold using gravity methods has gained attention because of low cost and environmentally friendly operations. In this study, gold pre-concentrates were produced by the stepwise gravity separation and flotation techniques. The Knelson concentrator and conventional flotation were employed for the recovery of gold. Gold bearing ore samples were taken from Gümüşhane Region, northern east part of Turkey. As a result of stepwise Knelson concentration experiments, a gold concentrate assaying around 620 g/t is produced with 41.4wt% recovery. On the other hand, a gold concentrate about 82 g/t is obtained with 89.9wt% recovery from a gold ore assaying 6 g/t Au by direct flotation.
Santerne, A.; Bonomo, A. S.; Hébrard, G.; Deleuil, M.; Moutou, C.; Almenara, J.-M.; Bouchy, F.; Díaz, R. F.
2011-12-01
We report the discovery of a new hot-Jupiter, KOI-196b, transiting a solar-type star with an orbital period of 1.855558 days ± 0.6 s thanks to public photometric data from the Kepler space mission and new radial velocity observations obtained by the SOPHIE spectrograph mounted on the 1.93-m telescope at the Observatoire de Haute-Provence, France. The planet KOI-196b, with a radius of 0.89 ± 0.05 RJup and a mass of 0.55 ± 0.09 MJup, orbits a G6V star with R⋆ = 1.02 ± 0.03 R⊙, M⋆ = 1.12 ± 0.07 M⊙, [Fe/H] = 0.29 ± 0.16 dex, Teff = 5620 ± 140 K, and an age of 650 +2500-300} Myr. KOI-196b is one of the rare close-in hot Jupiters with a radius smaller than Jupiter suggesting that it is a non-inflated planet. The high precision of the Kepler photometry permits us to detect the secondary transit with a depth of 64 +10-12} ppm as well as the optical phase variation. We find a geometric albedo of Ag = 0.30 ± 0.08, which is higher than most of the transiting hot Jupiters with a measured Ag. Assuming no heat recirculation, we find a day-side temperature of Tday = 1730 ± 400 K. The planet KOI-196b seems to be one of the rare hot Jupiters located in the short-period hot-Jupiter desert. Based on observations made with SOPHIE on the 1.93-m telescope at Observatoire de Haute-Provence (CNRS), France.
Gold and oil futures markets: Are markets efficient?
Energy Technology Data Exchange (ETDEWEB)
Narayan, Paresh Kumar; Zheng, Xinwei [School of Accounting, Economics and Finance, Faculty of Business and Law, Deakin University, 221 Burwood Highway, Burwood, Victoria 3125 (Australia); Narayan, Seema [School of Economics Finance and Marketing, RMIT University, Melbourne (Australia)
2010-10-15
In this paper we examine the long-run relationship between gold and oil spot and futures markets. We draw on the conceptual framework that when oil price rises, it creates inflationary pressures, which instigate investments in gold as a hedge against inflation. We test for the long-run relationship between gold and oil futures prices at different maturity and unravel evidence of cointegration. This implies that: (a) investors use the gold market as a hedge against inflation and (b) the oil market can be used to predict the gold market prices and vice versa, thus these two markets are jointly inefficient, at least for the sample period considered in this study. (author)
Gold and oil futures markets: Are markets efficient?
International Nuclear Information System (INIS)
Narayan, Paresh Kumar; Zheng, Xinwei; Narayan, Seema
2010-01-01
In this paper we examine the long-run relationship between gold and oil spot and futures markets. We draw on the conceptual framework that when oil price rises, it creates inflationary pressures, which instigate investments in gold as a hedge against inflation. We test for the long-run relationship between gold and oil futures prices at different maturity and unravel evidence of cointegration. This implies that: (a) investors use the gold market as a hedge against inflation and (b) the oil market can be used to predict the gold market prices and vice versa, thus these two markets are jointly inefficient, at least for the sample period considered in this study. (author)
Benchmarking Density Functionals for Chemical Bonds of Gold
DEFF Research Database (Denmark)
Kepp, Kasper Planeta
2017-01-01
Gold plays a major role in nanochemistry, catalysis, and electrochemistry. Accordingly, hundreds of studies apply density functionals to study chemical bonding with gold, yet there is no systematic attempt to assess the accuracy of these methods applied to gold. This paper reports a benchmark aga...
Basic electrochemical properties of sputtered gold film electrodes
International Nuclear Information System (INIS)
Libansky, Milan; Zima, Jiri; Barek, Jiri; Reznickova, Alena; Svorcik, Vaclav; Dejmkova, Hana
2017-01-01
Gold nanolayers made by sputtering of pure gold (physical vapour deposition) are commonly used for many biophysical and material applications. However, the use of sputtering method for fabrication of working electrodes for electroanalytical purposes is less common. This paper focuses on the testing and characterization of sputtered working roughened gold nanostructured film electrodes, which fall into category of upcoming desirable new generation of nanostructured gold working electrodes. Gold nanostructured films (80 nm thin) were sputtered onto 50 μm thin PTFE substrates with three different types of treatment: pristine, plasma treated, and plasma treated and subsequently spontaneously grafted with biphenyl-4,4′-dithiol. The characterization of gold nanostructured film electrodes was carried out by examination of the electrode reaction of standard redox probes (ferrocyanide/ferricyanide, hydroquinone/benzoquinone) in different types of supporting electrolytes (BR buffers of various pH, KCl, KNO 3 , H 2 SO 4 ), by exploration of the electrode surface by scanning electron microscopy, by atomic force microscopy accompanied by elementary analysis and contact angle measurements. The testing of electrodes was complemented by an attempt to calculate their real surface areas from Randles-Sevcik equation. All results were compared to conventional bulk gold electrode. The practical applicability of the nanostructured gold electrodes as sensors for the determination of environmental pollutants was verified by voltammetric determination of hydroquinone as a model electrochemically oxidisable organic environmental pollutant.
Numerical simulations of nanostructured gold films
DEFF Research Database (Denmark)
Repän, Taavi; Frydendahl, Christian; Novikov, Sergey M.
2017-01-01
We present an approach to analyse near-field effects on nanostructured gold films by finite element simulations. The studied samples are formed by fabricating gold films near the percolation threshold and then applying laser damage. Resulting samples have complicated structures, which...
Stability of gold atoms and dimers adsorbed on graphene
International Nuclear Information System (INIS)
Varns, R; Strange, P
2008-01-01
We report density functional theory (DFT) calculations for gold atoms and dimers on the surface of graphene. The calculations were performed using the plane wave pseudopotential method. Calculations were performed for a variety of geometries, and both the graphene surface and gold atoms were allowed to fully relax. In agreement with experiment, our results show that the gold-gold interaction is considerably stronger than the gold-graphene interaction, implying that uniform coverage could not be attained. The minimum energy configuration for a single gold atom is found to be directly above a carbon atom, while for the dimer it is perpendicular to the surface and directly above a carbon-carbon bond. Our results are consistent with previous similar calculations
Gold 100: proceedings of the international conference on gold. V. 1
International Nuclear Information System (INIS)
Wagner, H.; King, R.P.
1986-01-01
The papers collected in this, the first of three volumes, reflect the tremendous interest in technology of mining as it is applied to the recovery of gold from a variety of orebodies. The emphasis at 'Gold 100' was very largely associated with the problem of deep level mining of tabular orebodies and the challenges facing the mining engineer. The technical problems created by the need to overcome the threat of ever-increasing costs as the mines enter an increasingly hostile and difficult environment are prominent in the papers collected in this volume. The material collected here reflects the remarkable improvements in technology now taking place
Simple fabrication of gold nanobelts and patterns.
Directory of Open Access Journals (Sweden)
Renyun Zhang
Full Text Available Gold nanobelts are of interest in several areas; however, there are only few methods available to produce these belts. We report here on a simple evaporation induced self-assembly (EISA method to produce porous gold nanobelts with dimensions that scale across nanometer (thickness ∼80 nm and micrometer (width ∼20 µm, to decimeter (length ∼0.15 m. The gold nanobelts are well packed on the beaker wall and can be easily made to float on the surface of the solution for depositing onto other substrates. Microscopy showed that gold nanobelts had a different structure on the two sides of the belt; the density of gold nanowires on one side was greater than on the other side. Electrical measurements showed that these nanobelts were sensitive to compressive or tensile forces, indicating a potential use as a strain sensor. The patterned nanobelts were further used as a template to grow ZnO nanowires for potential use in applications such as piezo-electronics.
Moessbauer investigation of gold-bearing pyrite-rich concentrates
International Nuclear Information System (INIS)
Wagner, F.E.; Harris, D.C.
1994-01-01
A gold-bearing pyrite-rich concentrate of a refractory ore from the Golden Bear mine, northwestern British Columbia, and a pyrite-rich concentrate from Newhawk's west zone, Brucejack Lake area, northern British Columbia, containing 38 and 316 ppm Au and 0.57% and 0.19% As, respectively, have been investigated using 197 Au and 57 Fe Moessbauer spectroscopy. In the Golden Bear sample, the gold is mainly chemically bound in the pyrite with minor amounts present as an Au-Ag alloy, whereas in the Newhawk sample, the gold occurs mainly as an Au-Ag alloy with a composition close to Au 0.5 Ag 0.5 and is only partly bound in the pyrite. Having mean isomer shifts of +3.2 and +4.0 mm/s with respect to a Pt metal source, the gold in pyrite exhibits shifts similar to those observed for gold in arsenopyrite. The nature of the lattice sites occupied by the gold in pyrite is discussed. (orig.)
Marçôa, Raquel; Rodrigues, Daniela Marta; Dias, Margarida; Ladeira, Inês; Vaz, Ana Paula; Lima, Ricardo; Guimarães, Miguel
2018-02-01
Chronic Obstructive Pulmonary Disease (COPD) is a major cause of morbidity and mortality worldwide. The Global Initiative for Chronic Obstructive Lung Disease (GOLD) project has been working to improve awareness, prevention and management of this disease. The aim of this study is to evaluate how COPD patients are reclassified by the 2017 GOLD system (versus GOLD 2011), to calculate the level of agreement between these two classifications in allocation to categories and to compare the performance of each classification to predict future exacerbations. Two-hundred COPD patients (>40 years, post bronchodilator forced expiratory volume in one second/forced vital capacity<0.7) followed in pulmonology consultation were recruited into this prospective multicentric study. Approximately half of the patients classified as GOLD D [2011] changed to GOLD B [2017]. The extent of agreement between GOLD 2011 and GOLD 2017 was moderate (Cohen's Kappa = 0.511; p < 0.001) and the ability to predict exacerbations was similar (69.7% and 67.6%, respectively). GOLD B [2017] exacerbated 17% more than GOLD B [2011] and had a lower percent predicted post bronchodilator forced expiratory volume in one second (FEV1). GOLD B [2017] turned to be the predominant category, more heterogeneous and with a higher risk of exacerbation versus GOLD B [2011]. Physicians should be cautious in assessing the GOLD B [2017] patients. The assessment of patients should always be personalized. More studies are needed to evaluate the impact of the 2017 reclassification in predicting outcomes such as future exacerbations and mortality.
Geobiological Cycling of Gold: From Fundamental Process Understanding to Exploration Solutions
Directory of Open Access Journals (Sweden)
Frank Reith
2013-11-01
Full Text Available Microbial communities mediating gold cycling occur on gold grains from (sub-tropical, (semi-arid, temperate and subarctic environments. The majority of identified species comprising these biofilms are β-Proteobacteria. Some bacteria, e.g., Cupriavidus metallidurans, Delftia acidovorans and Salmonella typhimurium, have developed biochemical responses to deal with highly toxic gold complexes. These include gold specific sensing and efflux, co-utilization of resistance mechanisms for other metals, and excretion of gold-complex-reducing siderophores that ultimately catalyze the biomineralization of nano-particulate, spheroidal and/or bacteriomorphic gold. In turn, the toxicity of gold complexes fosters the development of specialized biofilms on gold grains, and hence the cycling of gold in surface environments. This was not reported on isoferroplatinum grains under most near-surface environments, due to the lower toxicity of mobile platinum complexes. The discovery of gold-specific microbial responses can now drive the development of geobiological exploration tools, e.g., gold bioindicators and biosensors. Bioindicators employ genetic markers from soils and groundwaters to provide information about gold mineralization processes, while biosensors will allow in-field analyses of gold concentrations in complex sampling media.
Synthesis method of asymmetric gold particles.
Jun, Bong-Hyun; Murata, Michael; Hahm, Eunil; Lee, Luke P
2017-06-07
Asymmetric particles can exhibit unique properties. However, reported synthesis methods for asymmetric particles hinder their application because these methods have a limited scale and lack the ability to afford particles of varied shapes. Herein, we report a novel synthetic method which has the potential to produce large quantities of asymmetric particles. Asymmetric rose-shaped gold particles were fabricated as a proof of concept experiment. First, silica nanoparticles (NPs) were bound to a hydrophobic micro-sized polymer containing 2-chlorotritylchloride linkers (2-CTC resin). Then, half-planar gold particles with rose-shaped and polyhedral structures were prepared on the silica particles on the 2-CTC resin. Particle size was controlled by the concentration of the gold source. The asymmetric particles were easily cleaved from the resin without aggregation. We confirmed that gold was grown on the silica NPs. This facile method for synthesizing asymmetric particles has great potential for materials science.
A Novel Strategy for Synthesis of Gold Nanoparticle Self Assemblies
Verma, Jyoti; Lal, Sumit; van Veen, Henk A.; van Noorden, Cornelis J. F.
2014-01-01
Gold nanoparticle self assemblies are one-dimensional structures of gold nanoparticles. Gold nanoparticle self assemblies exhibit unique physical properties and find applications in the development of biosensors. Methodologies currently available for lab-scale and commercial synthesis of gold
The Stability of Supported Gold Catalysts
Masoud, Nazila
2018-01-01
Gold has supreme cultural and financial value and, in form of nanoparticles smaller than 10 nm, is a unique catalyst for different industrially relevant reactions. Intriguing properties of the gold catalysts have spurred demand in the chemical industry for Au catalysts, the application of which
Gold-coated nanoparticles for use in biotechnology applications
Berning, Douglas E [Los Alamos, NM; Kraus, Jr., Robert H.; Atcher, Robert W [Los Alamos, NM; Schmidt, Jurgen G [Los Alamos, NM
2009-07-07
A process of preparing gold-coated magnetic nanoparticles is disclosed and includes forming a suspension of magnetic nanoparticles within a suitable liquid, adding an amount of a reducible gold compound and a reducing agent to the suspension, and, maintaining the suspension for time sufficient to form gold-coated magnetic nanoparticles.
Radiofrequency Heating Pathways for Gold Nanoparticles
Collins, C. B.; McCoy, R. S.; Ackerson, B. J.; Collins, G. J.
2015-01-01
This feature article reviews the thermal dissipation of nanoscopic gold under radiofrequency (RF) irradiation. It also presents previously unpublished data addressing obscure aspects of this phenomenon. While applications in biology motivated initial investigation of RF heating of gold nanoparticles, recent controversy concerning whether thermal effects can be attributed to nanoscopic gold highlight the need to understand the involved mechanism or mechanisms of heating. Both the nature of the particle and the nature of the RF field influence heating. Aspects of nanoparticle chemistry and physics, including the hydrodynamic diameter of the particle, the oxidation state and related magnetism of the core, and the chemical nature of the ligand shell may all strongly influence to what extent a nanoparticle heats in an RF field. Aspects of RF include: power, frequency and antenna designs that emphasize relative strength of magnetic or electric fields, and also influence the extent to which a gold nanoparticle heats in RF. These nanoparticle and RF properties are analysed in the context of three heating mechanisms proposed to explain gold nanoparticle heating in an RF field. This article also makes a critical analysis of the existing literature in the context of the nanoparticle preparations, RF structure, and suggested mechanisms in previously reported experiments. PMID:24962620
DEFF Research Database (Denmark)
Jønsson, Jesper Bosse; Bryceson, Deborah Fahy
2009-01-01
African rural dwellers have faced depressed economic prospects for several decades. Now, in a number of mineral-rich countries, multiple discoveries of gold and precious stones have attracted large numbers of prospective small-scale miners. While their 'rush' to, and activities within, mining sit...... affluent than the others, suggesting that movement can be rewarding for those willing to 'try their luck' with the hard work and social networking demands of mining another site.......African rural dwellers have faced depressed economic prospects for several decades. Now, in a number of mineral-rich countries, multiple discoveries of gold and precious stones have attracted large numbers of prospective small-scale miners. While their 'rush' to, and activities within, mining sites...
Immunological properties of gold nanoparticles
Dykman, Lev A.; Khlebtsov, Nikolai G.
2016-01-01
In the past decade, gold nanoparticles have attracted strong interest from the nanobiotechnological community owing to the significant progress made in robust and easy-to-make synthesis technologies, in surface functionalization, and in promising biomedical applications. These include bioimaging, gene diagnostics, analytical sensing, photothermal treatment of tumors, and targeted delivery of various biomolecular and chemical cargos. For the last-named application, gold nanoparticles should be...
Effects of gold coating on experimental implant fixation
DEFF Research Database (Denmark)
Zainali, Kasra; Danscher, Gorm; Jakobsen, Thomas
2009-01-01
Insertions of orthopedic implants are traumatic procedures that trigger an inflammatory response. Macrophages have been shown to liberate gold ions from metallic gold. Gold ions are known to act in an antiinflammatory manner by inhibiting cellular NF-kappa B-DNA binding and suppressing I-kappa B......-kinase activation. The present study investigated whether gilding implant Surfaces augmented early implant osseointegration and implant fixation by its modulatory effect on the local inflammatory response. Ion release was traced by autometallographic silver enhancement. Gold-coated cylindrical porous coated Ti6Al4V...
Extracellular mycosynthesis of gold nanoparticles using Fusarium solani
Gopinath, K.; Arumugam, A.
2014-08-01
The development of eco-friendly methods for the synthesis of nanomaterial shape and size is an important area of research in the field of nanotechnology. The present investigation deals with the extracellular rapid biosynthesis of gold nanoparticles using Fusarium solani culture filtrate. The UV-vis spectra of the fungal culture filtrate medium containing gold ion showed peak at 527 nm corresponding to the plasmon absorbance of gold nanoparticles. FTIR spectra provide an evidence for the presence of heterocyclic compound in the culture filtrate, which increases the stability of the synthesized gold nanoparticles. The X-ray analysis respects the Bragg's law and confirmed the crystalline nature of the gold nanoparticles. AFM analysis showed the results of particle sizes (41 nm). Transmission electron microscopy (TEM) showed that the gold nanoparticles are spherical in shape with the size range from 20 to 50 nm. The use of F. solani will offer several advantages since it is considered as a non-human pathogenic organism. The fungus F. solani has a fast growth rate, rapid capacity of metallic ions reduction, NPs stabilization and facile and economical biomass handling. Extracellular biosynthesis of gold nanoparticles could be highly advantageous from the point of view of synthesis in large quantities, time consumption, eco-friendly, non-toxic and easy downstream processing.
Natural gold composition studied by proton activation analysis (PAA)
International Nuclear Information System (INIS)
Cojocaru, V.; Badica, T.; Popescu, I.V.
2003-01-01
The minor and trace element concentration of natural gold is essential for provenance studies of gold archaeological artifacts. In this work proton activation analysis is used in order to find what elements can be put into evidence in natural gold. For that purpose some gold nuggets from Romania were used. It was found that PAA is a good supplemental method to neutron activation analysis. (authors)
Encapsulation of gold nanoparticles into self-assembling protein nanoparticles
Directory of Open Access Journals (Sweden)
Yang Yongkun
2012-10-01
Full Text Available Abstract Background Gold nanoparticles are useful tools for biological applications due to their attractive physical and chemical properties. Their applications can be further expanded when they are functionalized with biological molecules. The biological molecules not only provide the interfaces for interactions between nanoparticles and biological environment, but also contribute their biological functions to the nanoparticles. Therefore, we used self-assembling protein nanoparticles (SAPNs to encapsulate gold nanoparticles. The protein nanoparticles are formed upon self-assembly of a protein chain that is composed of a pentameric coiled-coil domain at the N-terminus and trimeric coiled-coil domain at the C-terminus. The self-assembling protein nanoparticles form a central cavity of about 10 nm in size, which is ideal for the encapsulation of gold nanoparticles with similar sizes. Results We have used SAPNs to encapsulate several commercially available gold nanoparticles. The hydrodynamic size and the surface coating of gold nanoparticles are two important factors influencing successful encapsulation by the SAPNs. Gold nanoparticles with a hydrodynamic size of less than 15 nm can successfully be encapsulated. Gold nanoparticles with citrate coating appear to have stronger interactions with the proteins, which can interfere with the formation of regular protein nanoparticles. Upon encapsulation gold nanoparticles with polymer coating interfere less strongly with the ability of the SAPNs to assemble into nanoparticles. Although the central cavity of the SAPNs carries an overall charge, the electrostatic interaction appears to be less critical for the efficient encapsulation of gold nanoparticles into the protein nanoparticles. Conclusions The SAPNs can be used to encapsulate gold nanoparticles. The SAPNs can be further functionalized by engineering functional peptides or proteins to either their N- or C-termini. Therefore encapsulation of gold
GOLD NANOPARTICLES: A REVIVAL IN PRECIOUS METAL ADMINISTRATION TO PATIENTS
Thakor, AS; Jokerst, J; Zaveleta, C; Massoud, TF; Gambhir, SS
2011-01-01
Gold has been used as a therapeutic agent to treat a wide variety of rheumatic diseases including psoriatic arthritis, juvenile arthritis and discoid lupus erythematosus. Although the use of gold has been largely superseded by newer drugs, gold nanoparticles are being used effectively in laboratory based clinical diagnostic methods whilst concurrently showing great promise in vivo either as a diagnostic imaging agent or a therapeutic agent. For these reasons, gold nanoparticles are therefore well placed to enter mainstream clinical practice in the near future. Hence, the present review summarizes the chemistry, pharmacokinetics, bio-distribution, metabolism and toxicity of bulk gold in humans based on decades of clinical observation and experiments in which gold was used to treat patients with rheumatoid arthritis. The beneficial attributes of gold nanoparticles, such as their ease of synthesis, functionalization and shape control are also highlighted demonstrating why gold nanoparticles are an attractive target for further development and optimization. The importance of controlling the size and shape of gold nanoparticles to minimize any potential toxic side effects is also discussed. PMID:21846107
International Nuclear Information System (INIS)
Lei, Kin Fong
2011-01-01
Electrical detection of the concentration of protein immobilized on a biochip is demonstrated. The concentration of the direct immobilized protein can be determined by the resistance values measured by an ohm-meter directly. Indium tin oxide interdigitated electrodes were utilized as the detection sites on the biochip. Protein, i.e. antibody, of certain concentration was first immobilized on the detection site. Gold nanoparticles were then applied to indicate the immobilized protein. Since the gold nanoparticles were tiny, a detectable electrical signal could not be generated. Hence, a gold enhancement process was performed for signal amplification. Gold nanoparticles were enlarged physically, such that a conductive metal layer was formed on the detection site. The presence and concentration of protein can be determined by the resistance value across the electrode measured by an ohm-meter. An immobilized protein concentration ranging from 50 to 1000 ng ml −1 can be detected quantitatively by the resistance values from 4300 to 1700 Ω. The proposed technique is potentially extended for the detection of immunoassay on the biochip. Since the protocol of the electrical detection does not involve sophisticated equipment, it can therefore be used for the development of a portable immunoassay device
Directory of Open Access Journals (Sweden)
Vogelmeier C
2016-12-01
Full Text Available Claus Vogelmeier,1 Nanshan Zhong,2 Michael J Humphries,3 Karen Mezzi,4 Robert Fogel,5 Giovanni Bader,4 Francesco Patalano,4 Donald Banerji5 1Department of Medicine, Pulmonary and Critical Care Medicine, University Medical Center Giessen and Marburg, Philipps-University Marburg, Member of the German Center for Lung Research (DZL, Marburg, Germany; 2State Key Laboratory, Guangzhou Institute of Respiratory Diseases, First Affiliated Hospital, Guangzhou Medical University, Guangzhou, 3Beijing Novartis Pharma Co. Ltd., Shanghai, People’s Republic of China; 4Novartis Pharma AG, Basel, Switzerland; 5Novartis Pharmaceuticals Corporation, East Hanover, NJ, USA Background: Indacaterol/glycopyrronium (IND/GLY is approved for maintenance treatment of adult patients with COPD. This post hoc analysis explored the efficacy and safety of IND/GLY versus salmeterol/fluticasone (SFC in symptomatic (Global Initiative for Chronic Obstructive Lung Disease [GOLD] B and GOLD D patients with moderate-to-severe COPD.Patients and methods: Data from LANTERN and ILLUMINATE studies were pooled and analyzed. In both studies, symptomatic COPD patients were randomized to once-daily IND/GLY 110 µg/50 µg or twice-daily SFC 50 µg/500 µg. End points were pre-dose trough forced expiratory volume in one second (FEV1, standardized area under the curve for FEV1 from 0 to 12 hours (FEV1 AUC0–12 hours, peak FEV1, peak forced vital capacity (FVC, pre-dose trough FVC, Transition Dyspnea Index (TDI total score, St George’s Respiratory Questionnaire total score, rescue medication use and safety.Results: A total of 1,263 patients were classified as either GOLD B (n=809 or GOLD D (n=454. At week 26, IND/GLY demonstrated statistically significant improvement in all lung function parameters versus SFC in patients in both the GOLD B and GOLD D subgroups. TDI total score and rescue medication use were significantly improved with IND/GLY versus SFC in the overall population and in the
The activation analysis of gold in small refractory pebbles
International Nuclear Information System (INIS)
Bibby, D.M.; Chaix, R.P.
1975-08-01
The gold content of a suite of small pebbles, residual to the milling and leach of a gold bearing ore, has been investigated by means of neutron activation analysis (NAA). An NAA technique presenting a sensitivity of 0.02μgm gold, was used as being appropriate to the samples under investigation. An alternative NAA technique developed with the same sample suite showed a sensitivity of the order of 10 -4 to 10 -5 μgm gold. The NAA techniques developed, are appropriate to the determination of gold in small samples of ore not normally amenable to milling and/or dissolution
A new route to gold nanoflowers
Liebig, Ferenc; Henning, Ricky; Sarhan, Radwan M.; Prietzel, Claudia; Bargheer, Matias; Koetz, Joachim
2018-05-01
Catanionic vesicles spontaneously formed by mixing the anionic surfactant bis(2-ethylhexyl) sulfosuccinate sodium salt with the cationic surfactant cetyltrimethylammonium bromide were used as a reducing medium to produce gold clusters, which are embedded and well-ordered into the template phase. The gold clusters can be used as seeds in the growth process that follows by adding ascorbic acid as a mild reducing component. When the ascorbic acid was added very slowly in an ice bath round-edged gold nanoflowers were produced. When the same experiments were performed at room temperature in the presence of Ag+ ions, sharp-edged nanoflowers could be synthesized. The mechanism of nanoparticle formation can be understood to be a non-diffusion-limited Ostwald ripening process of preordered gold nanoparticles embedded in catanionic vesicle fragments. Surface-enhanced Raman scattering experiments show an excellent enhancement factor of 1.7 · 105 for the nanoflowers deposited on a silicon wafer.
International Nuclear Information System (INIS)
McDougall, G.J.; Hancock, R.D.
1980-01-01
The literature on activated carbon is reviewed so as to provide a general background with respect to the effect of source material and activation procedure on carbon properties, the structure and chemical nature of the surface of the activated carbon, and the nature of absorption processes on carbon. The various theories on the absorption of gold and silver from cyanide solutions are then reviewed, followed by a discussion of processes for the recovery of gold and silver from cyanide solutions using activated carbon, including a comparison with zinc precipitation
Gold recovery from low concentrations using nanoporous silica adsorbent
Aledresse, Adil
The development of high capacity adsorbents with uniform porosity denoted 5%MP-HMS (5% Mercaptopropyl-Hexagonal Mesoporous Structure) to extract gold from noncyanide solutions is presented. The preliminary studies from laboratory simulated noncyanide gold solutions show that the adsorption capacities of these materials are among the highest reported. The high adsorption saturation level of these materials, up to 1.9 mmol/g (37% of the adsorbent weight) from gold chloride solutions (potassium tetrachloroaurate) and 2.9 mmol/g (57% of the adsorbent weight) from gold bromide solutions (potassium tetrabromoaurate) at pH = 2, is a noteworthy feature of these materials. This gold loading from [AuC4]- and [AuBr4 ]- solutions corresponds to a relative Au:S molar ratio of 2.5:1 and 3.8:1, respectively. These rates are significantly higher than the usual 1:1 (Au:S) ratio expected for metal ion binding with the material. The additional gold ions loaded have been spontaneously reduced to metallic gold in the mesoporous material. Experimental studies indicated high maximum adsorptions of gold as high as 99.9% recovery. Another promising attribute of these materials is their favourable adsorption kinetics. The MP-HMS reaches equilibrium (saturation) in less than 1 minute of exposure in gold bromide and less than 10 minutes in gold chloride. The MP-HMS materials adsorption is significantly improved by agitation and the adsorption capacity of Au (III) ions increases with the decrease in pH. The recovery of adsorbed gold and the regeneration of spent adsorbent were investigated for MP-HMS adsorbent. The regenerated adsorbent (MP-HMS) maintained its adsorption capacity even after repeated use and all the gold was successfully recovered from the spent adsorbent. For the fist time, a promising adsorbent system has been found that is capable of effectively concentrating gold thiosulphate complexes, whereas conventional carbon-inpulp (CIP) and carbon-in-leach (CIL) systems fail. The
A grand unified model for liganded gold clusters
Xu, Wen Wu; Zhu, Beien; Zeng, Xiao Cheng; Gao, Yi
2016-12-01
A grand unified model (GUM) is developed to achieve fundamental understanding of rich structures of all 71 liganded gold clusters reported to date. Inspired by the quark model by which composite particles (for example, protons and neutrons) are formed by combining three quarks (or flavours), here gold atoms are assigned three `flavours' (namely, bottom, middle and top) to represent three possible valence states. The `composite particles' in GUM are categorized into two groups: variants of triangular elementary block Au3(2e) and tetrahedral elementary block Au4(2e), all satisfying the duet rule (2e) of the valence shell, akin to the octet rule in general chemistry. The elementary blocks, when packed together, form the cores of liganded gold clusters. With the GUM, structures of 71 liganded gold clusters and their growth mechanism can be deciphered altogether. Although GUM is a predictive heuristic and may not be necessarily reflective of the actual electronic structure, several highly stable liganded gold clusters are predicted, thereby offering GUM-guided synthesis of liganded gold clusters by design.
Ben Haddada , Maroua; Hübner , Maria; Casale , Sandra; Knopp , Dietmar; Niessner , Reinhard; Salmain , Michele; Boujday , Souhir
2016-01-01
International audience; We investigated the assembly of Gold nanoparticles (AuNPs) on Gold and Silicon sensors with two final objectives: (i) understanding the factors governing the interaction and (ii) building up a nanostructured piezoelectric immunosensor for diclofenac, a small-sized pharmaceutical pollutant. Different surface chemistries were devised to achieve AuNPs assembly on planar substrates. These surface chemistries included amines to immobilize AuNPs via electrostatic interaction...
78 FR 9355 - Influenza Viruses Containing the Hemagglutinin From the Goose/Guangdong/1/96 Lineage
2013-02-08
... DEPARTMENT OF HEALTH AND HUMAN SERVICES [Docket: CDC-2012-0010] 42 CFR Part 73 Influenza Viruses... influenza (HPAI) H5N1 viruses that contain a hemagglutinin (HA) from the Goose/Guangdong/1/96 lineage, and... concerning highly pathogenic avian influenza (HPAI) H5N1 viruses that contain a hemagglutinin (HA) from the...
Ionization model for nickel-like gold
International Nuclear Information System (INIS)
Busquet, M.; Bruneau, J.
1986-04-01
Before we build an extensive population model for gold ionized 49 to 52 times, we have studied with a more simple model the effect of accounting for cascades (or dielectronic recombination) and Δn = 0 transitions. These transitions allow some understanding of typical feature of experimental gold spectra
Formation of gold nanoparticles by glycolipids of Lactobacillus casei
Kikuchi, Fumiya; Kato, Yugo; Furihata, Kazuo; Kogure, Toshihiro; Imura, Yuki; Yoshimura, Etsuro; Suzuki, Michio
2016-01-01
Gold nanoparticles have particular properties distinct from those of bulk gold crystals, and such nanoparticles are used in various applications in optics, catalysis, and drug delivery. Many reports on microbial synthesis of gold nanoparticles have appeared. However, the molecular details (reduction and dispersion) of such synthesis remain unclear. In the present study, we studied gold nanoparticle synthesis by Lactobacillus casei. A comparison of L. casei components before and after addition...
Directory of Open Access Journals (Sweden)
Ali Assadi
2016-06-01
Full Text Available Background: Conventional chemical coagulation is considered as an old method to dye and COD removal in textile effluent. Electrocoagulation (EC process is a robust method to achieve maximum removal. Methods: This study was designed to compare the result of operational parameters including optimum pH and coagulant concentration for chemical coagulation with ferric chloride and alum also, voltage, electrolysis time, initial pH, and conductivity for EC with iron electrodes to remove reactive red 196 (RR 196. Results: The outcomes show that ferric chloride and alum at optimum concentration were capable of removing dye and COD by 79.63 % and 84.83% and 53% and 55%, respectively. In contrast, EC process removed the dye and COD by 99.98% and 90.4%, respectively. Conclusion: The highest treatment efficiency was obtained by increasing the voltage, electrolysis time, pH and conductivity. Increase initial dye concentration reduces removal efficiency. Ultimately, it could be concluded that EC technology is an efficient procedure for handling of colored industrial wastewaters.
A series of intrinsically chiral gold nanocage structures.
Liu, X J; Hamilton, I P
2017-07-27
We present a series of intrinsically chiral gold nanocage structures, Au 9n+6 , which are stable for n ≥ 2. These structures consist of an Au 9n tube which is capped with Au 3 units at each end. Removing the Au 3 caps, we obtain a series of intrinsically chiral gold nanotube structures, Au 9n , which are stable for n ≥ 4. The intrinsic chirality of these structures results from the helicity of the gold strands which form the tube and not because an individual Au atom is a chiral center. The symmetry of these structures is C 3 and substructures of gold hexagons with a gold atom in the middle are particularly prominent. We focus on the properties of Au 42 (C 3 ) and Au 105 (C 3 ) which are the two smallest gold nanocage structures to be completely tiled by these Au 7 "golden-eye" substructures. Our main focus is on Au 42 (C 3 ) since gold clusters in the 40-50 atom regime are currently being investigated in gas phase experiments. We show that the intrinsically chiral Au 42 cage structure is energetically comparable with previously reported achiral cage and compact Au 42 structures. Cage structures are of particular interest because species can be encapsulated (and stabilized) inside the cage and we provide strong evidence that Au 6 @Au 42 (C 3 ) is the global minimum Au 48 structure. The intrinsically chiral gold nanocage structures, which exhibit a range of size-related properties, have potential applications in chiral catalysis and as components in nanostructured devices.
Biosensors based on gold nanostructures
Vidotti,Marcio; Carvalhal,Rafaela F.; Mendes,Renata K.; Ferreira,Danielle C. M.; Kubota,Lauro T.
2011-01-01
The present review discusses the latest advances in biosensor technology achieved by the assembly of biomolecules associated with gold nanoparticles in analytical devices. This review is divided in sections according to the biomolecule employed in the biosensor development: (i) immunocompounds; (ii) DNA/RNA and functional DNA/RNA; and (iii) enzymes and Heme proteins. In order to facilitate the comprehension each section was subdivided according to the transduction mode. Gold nanoparticles bas...
Luan Truong, Xuan; Luong Le, Van; Quang Truong, Xuan
2015-04-01
Daksa gold deposit is the biggest gold deposits in Vietnam. The Daksa geological structure complicated, distributed mainly metamorphosed sedimentary NuiVu formation (PR3-?1nv2). The sulfide gold ore bodies distributed in quartz schist, quartz - biotite related to faut and distribution wing anticline. The gold ore bodies form circuits, network circuits, circuits lenses; fill the cup surface layer of the developing northeast - southwest; is the less than or west longitude north - SE. The results show that, Au and accompanying elements (Ag, Pb and Zn) have correlated pretty closely. All of its consistent with the logarithmic distribution standard, in accordance with the law of distribution of content mineral rare. The structure functions have nugget effect and spherical models with show that Au and accompanying elements special variation are changes. Au contents shown local anisotropy, no clearly anisotropy (K=1,17) and weakly anisotropy (K=1,4). Intensity mineralization of the ore bodies are quite high with demand spherical conversion coefficient ranging from 0.49 to 0.75 and from 0.66 to 0.97 (for other body). With nugget effects, ore bodies shown that it is consistent with mineralization in the ore bodies study, ore erasable, micro vein, infilling fractures in quartz vein. All of variogram presents local anisotropy, indicated gold mineralization at study area has least two-mineralization stages, consistent with the analysis of mineralography samples. By the results of the structure function study, the authors present the system optimization for exploration deposit and used to evaluate gold reserves by Ordinary Kriging. High accuracy of Kriging estimation results are expressed in the minimum Kriging variance, by compare the results calculated by some other methods (such as distance inverse weighting method, ..) and specially compare to the results of a some blocks have been exploited. Key words: Geostat and gold deposits VN. Daksa and gold mineralization. Geostat
Interaction of β-sheet folds with a gold surface.
Directory of Open Access Journals (Sweden)
Martin Hoefling
Full Text Available The adsorption of proteins on inorganic surfaces is of fundamental biological importance. Further, biomedical and nanotechnological applications increasingly use interfaces between inorganic material and polypeptides. Yet, the underlying adsorption mechanism of polypeptides on surfaces is not well understood and experimentally difficult to analyze. Therefore, we investigate here the interactions of polypeptides with a gold(111 surface using computational molecular dynamics (MD simulations with a polarizable gold model in explicit water. Our focus in this paper is the investigation of the interaction of polypeptides with β-sheet folds. First, we concentrate on a β-sheet forming model peptide. Second, we investigate the interactions of two domains with high β-sheet content of the biologically important extracellular matrix protein fibronectin (FN. We find that adsorption occurs in a stepwise mechanism both for the model peptide and the protein. The positively charged amino acid Arg facilitates the initial contact formation between protein and gold surface. Our results suggest that an effective gold-binding surface patch is overall uncharged, but contains Arg for contact initiation. The polypeptides do not unfold on the gold surface within the simulation time. However, for the two FN domains, the relative domain-domain orientation changes. The observation of a very fast and strong adsorption indicates that in a biological matrix, no bare gold surfaces will be present. Hence, the bioactivity of gold surfaces (like bare gold nanoparticles will critically depend on the history of particle administration and the proteins present during initial contact between gold and biological material. Further, gold particles may act as seeds for protein aggregation. Structural re-organization and protein aggregation are potentially of immunological importance.
Accumulation of gold using Baker's yeast, Saccharomyces cerevisiae
International Nuclear Information System (INIS)
Roy, Kamalika; Lahiri, Susanta; Sinha, P.
2006-01-01
Authors have reported preconcentration of 152 Eu, a long-lived fission product, by yeast cells, Saccharomyces cerevisiae. Gold being a precious metal is used in electroplating, hydrogenation catalyst, etc. Heterogeneous composition of samples and low concentration offers renewed interest in its selective extraction of gold using various extractants. Gold can be recovered from different solutions using various chemical reagents like amines, organophosphorus compounds, and extractants containing sulphur as donor atom, etc. In the present work, two different strains of baker's yeast, Saccharomyces cerevisiae have been used to study the preconcentration of gold at various experimental conditions
The use of gold nanoparticles to enhance radiotherapy in mice
International Nuclear Information System (INIS)
Hainfeld, James F; Slatkin, Daniel N; Smilowitz, Henry M
2004-01-01
Mice bearing subcutaneous EMT-6 mammary carcinomas received a single intravenous injection of 1.9 nm diameter gold particles (up to 2.7 g Au/kg body weight), which elevated concentrations of gold to 7 mg Au/g in tumours. Tumour-to-normal-tissue gold concentration ratios remained ∼8:1 during several minutes of 250 kVp x-ray therapy. One-year survival was 86% versus 20% with x-rays alone and 0% with gold alone. The increase in tumours safely ablated was dependent on the amount of gold injected. The gold nanoparticles were apparently non-toxic to mice and were largely cleared from the body through the kidneys. This novel use of small gold nanoparticles permitted achievement of the high metal content in tumours necessary for significant high-Z radioenhancement. (note)
Chromaticity and Glossiness of Gold, Silver, and Bronze Colors
Directory of Open Access Journals (Sweden)
Tomohisa Matsumoto
2011-05-01
Full Text Available Appearance of metallic colors, such as gold, silver and bronze, depends on chromaticity and glossiness of a surface. We aim to obtain the chromaticity region of gold, silver, and bronze by using CG simulated surfaces with various glossiness. The physical glossiness was defined by the intensity ratio of specular reflectance of the surface stimulus. The observer estimated degree of perceived glossiness, and also degree of gold, silver, or bronze appearance of the stimulus with a physical glossiness and a chromaticity. The results showed that the stimulus began to appear gold, silver or bronze at a certain chromaticity point only when the stimulus had glossiness. The chromaticity range, where gold, silver and bronze colors were observed, expanded as the degree of glossiness increased. Furthermore the ratio of the degree of gold, silver or bronze colors to that of glossiness of the stimulus was found to be different among the chromaticity points of the stimulus. This ratio was highest with highly saturated stimuli for gold and bronze colors, and with achromatic stimuli for silver color.
Recovery of Silver and Gold from Copper Anode Slimes
Chen, Ailiang; Peng, Zhiwei; Hwang, Jiann-Yang; Ma, Yutian; Liu, Xuheng; Chen, Xingyu
2015-02-01
Copper anode slimes, produced from copper electrolytic refining, are important industrial by-products containing several valuable metals, particularly silver and gold. This article provides a comprehensive overview of the development of the extraction processes for recovering silver and gold from conventional copper anode slimes. Existing processes, namely pyrometallurgical processes, hydrometallurgical processes, and hybrid processes involving the combination of pyrometallurgical and hydrometallurgical technologies, are discussed based in part on a review of the form and characteristics of silver and gold in copper anode slimes. The recovery of silver and gold in pyrometallurgical processes is influenced in part by the slag and matte/metal chemistry and related characteristics, whereas the extraction of these metals in hydrometallurgical processes depends on the leaching reagents used to break the structure of the silver- and gold-bearing phases, such as selenides. By taking advantage of both pyrometallurgical and hydrometallurgical techniques, high extraction yields of silver and gold can be obtained using such combined approaches that appear promising for efficient extraction of silver and gold from copper anode slimes.
Peptide-functionalized iron oxide magnetic nanoparticle for gold mining
Energy Technology Data Exchange (ETDEWEB)
Shen, Wei-Zheng; Cetinel, Sibel; Sharma, Kumakshi; Borujeny, Elham Rafie; Montemagno, Carlo, E-mail: montemag@ualberta.ca [Ingenuity Lab, 1-070C (Canada)
2017-02-15
Here, we present our work on preparing a novel nanomaterial composed of inorganic binding peptides and magnetic nanoparticles for inorganic mining. Two previously selected and well-characterized gold-binding peptides from cell surface display, AuBP1 and AuBP2, were exploited. This nanomaterial (AuBP-MNP) was designed to fulfill the following two significant functions: the surface conjugated gold-binding peptide will recognize and selectively bind to gold, while the magnetic nano-sized core will respond and migrate according to the applied external magnetic field. This will allow the smart nanomaterial to mine an individual material (gold) from a pool of mixture, without excessive solvent extraction, filtration, and concentration steps. The working efficiency of AuBP-MNP was determined by showing a dramatic reduction of gold nanoparticle colloid concentration, monitored by spectroscopy. The binding kinetics of AuBP-MNP onto the gold surface was determined using surface plasmon resonance (SPR) spectroscopy, which exhibits around 100 times higher binding kinetics than peptides alone. The binding capacity of AuBP-MNP was demonstrated by a bench-top mining test with gold microparticles.
Liquid Nitrogen (-196°C effect under pollen of some cultured or ornamental species
Directory of Open Access Journals (Sweden)
Sabina GLIGOR
2006-05-01
Full Text Available The criopreservation involve the stock of the vegetal material at low temperatures (-196°C in liquid nitrogen, in thermal conditions in which the division of cells and metabolic processes slow down, thus that the samplings may be conserved for long periods without suffering any genetic modifications. This stock technique is applied till present only on 80 vegetal species, keeping their seeds and vitrocultures preponderantly; researches were made regarding the maintenance of pollen in liquid nitrogen.The mature pollen, able to resist a higher degree of desiccation, may be conserved at low temperatures, without criopreservation. It was made researches on criopreservation of rise, maize, wheat, roses, sun flower and soy pollen. Our study purpose was to follow the impact of liquid nitrogen (-196°C about on viability of some cultured and ornamental species. The designed time of criopreservation it was 30 minutes and 7 days, using the TTC (tripheniltetrazole chloride method which allows testing the viability of vegetal material based on dehydrogenase activity.It was observed at Petunia hybrida species, that the pollen viability was low - in relevance with the witness represented from the pollen which was not resigned to the nitrogen liquid treatment - between percentage limits of 3.5-8%, in the case when the vegetal material was submersed 30 minutes in liquid nitrogen and 7.5-14.5% 7 days at (-196°C. The submersing of Nicotiana alata var. grandiflora species at 7 days, determined a low viability with 11.53%. The following two studied species Cucurbita and Hosta were proved to be the most resistant at submersing and maintenance in liquid nitrogen. The most affected pollen was Campsis radicans species. At Datura stramonium species was observed 2.59% a low viability of pollen, after 30 minutes of liquid nitrogen treatment, was 19.56%, after 7 days of submersing, the most pollen granules losing completely their viability.
Photochemical Synthesis of the Bioconjugate Folic Acid-Gold Nanoparticles
DEFF Research Database (Denmark)
León, John Jairo Castillo; Bertel, Linda; Páez-Mozo, Edgar
2013-01-01
In this paper we present a rapid and simple onepot method to obtain gold nanoparticles functionalized with folic acid using a photochemistry method. The bioconjugate folic acid-gold nanoparticle was generated in one step using a photo-reduction method, mixing hydrogen tetrachloroaurate with folic...... at 4°C prolongs the stability of folic acid-gold nanoparticle suspensions to up to 26 days. Ultraviolet visible and Fourier transform infrared spectroscopy showed a surface plasmon band of around 534nm and fluorescence spectroscopy exhibited a quenching effect on gold nanoparticles in the fluorescence...... emission of folic acid and thus confirmed the conjugation of folic acid to the surface of gold nanoparticles. In this study we demonstrate the use of a photochemistry method to obtain folic acid-gold nanoparticles in a simple and rapid way without the use of surfactants and long reaction times...
Synthesis and catalytic activity of the metastable phase of gold phosphide
Energy Technology Data Exchange (ETDEWEB)
Fernando, Deshani; Nigro, Toni A.E.; Dyer, I.D. [Department of Chemistry, 107 Physical Sciences I, Oklahoma State University, Stillwater, OK 74078 (United States); Alia, Shaun M.; Pivovar, Bryan S. [Chemical and Materials Science Center, National Renewable Energy Laboratory, Golden, CO 80401 (United States); Vasquez, Yolanda, E-mail: yolanda.vasquez@okstate.edu [Department of Chemistry, 107 Physical Sciences I, Oklahoma State University, Stillwater, OK 74078 (United States)
2016-10-15
Recently, transition metal phosphides have found new applications as catalysts for the hydrogen evolution reaction that has generated an impetus to synthesize these materials at the nanoscale. In this work, Au{sub 2}P{sub 3} was synthesized utilizing the high temperature decomposition of tri-n-octylphosphine as a source of elemental phosphorous. Gold nanorods were used as morphological templates with the aim of controlling the shape and size of the resulting gold phosphide particles. We demonstrate that the surface capping ligand of the gold nanoparticle precursors can influence the purity and extent to which the gold phosphide phase will form. Gold nanorods functionalized with 1-dodecanethiol undergo digestive ripening to produce discrete spherical particles that exhibit reduced reactivity towards phosphorous, resulting in low yields of the gold phosphide. In contrast, gold phosphide was obtained as a phase pure product when cetyltrimethylammonium bromide functionalized gold nanorods are used instead. The Au{sub 2}P{sub 3} nanoparticles exhibited higher activity than polycrystalline gold towards the hydrogen evolution reaction. - Graphical abstract: Au{sub 2}P{sub 3} was synthesized utilizing the high temperature decomposition of tri-n-octylphosphine as a source of elemental phosphorous and gold nanoparticles as reactants. We demonstrate that the surface capping ligand of the gold nanoparticle precursors influence the purity and extent to which the Au{sub 2}P{sub 3} phase will form. Gold nanorods functionalized with 1-dodecanethiol undergo digestive ripening to produce discrete spherical particles that exhibit reduced reactivity towards phosphorous, resulting in low yields of the gold phosphide. In contrast, gold phosphide was obtained as a phase pure product when cetyltrimethylammonium bromide functionalized gold nanoparticles are used instead. The Au{sub 2}P{sub 3} nanoparticles exhibited higher activity than polycrystalline gold towards the hydrogen evolution
The Golden Target: Analyzing the Tracking Performance of Leveraged Gold ETFs
Tim Leung; Brian Ward
2015-01-01
This paper studies the empirical tracking performance of leveraged ETFs on gold, and their price relationships with gold spot and futures. For tracking the gold spot, we find that our optimized portfolios with short-term gold futures are highly effective in replicating prices. The market-traded gold ETF (GLD) also exhibits a similar tracking performance. However, we show that leveraged gold ETFs tend to underperform their corresponding leveraged benchmark. Moreover, the underperformance worse...
Characterisation of a thiosulphate-sulphite gold electrodeposition process
International Nuclear Information System (INIS)
J-Liew, M.; Sobri, S.; Roy, S.
2005-01-01
Electrodeposition of soft gold is an important process in the fabrication of micro devices for electronics, optics etc. Traditional gold electroplating is based on a gold cyanide process which is not applicable for the stringent requirements in state of the art micro device manufacture. Newcastle University has been involved in the development of an industrial process based on a mixed ligand electrolyte-the gold thiosulphate-sulphite system. Here we present methods for the formulation of this electrolyte in the laboratory which ensure bath stability and process compatibility. In addition, we have carried out spectrophotometry to elucidate the possible reasons of its chemical stability. Standard rotating disk and cyclic voltammetry has been carried out to determine the electrochemical behaviour of the gold thiosulphate-sulphite system. The changes in electrochemical behaviour as the bath ages are also discussed
Naked Gold Nanoparticles and hot Electrons in Water.
Ghandi, Khashayar; Wang, Furong; Landry, Cody; Mostafavi, Mehran
2018-05-08
The ionizing radiation in aqueous solutions of gold nanoparticles, stabilized by electrostatic non-covalent intermolecular forces and steric interactions, with antimicrobial compounds, are investigated with picosecond pulse radiolysis techniques. Upon pulse radiolysis of an aqueous solution containing very low concentrations of gold nanoparticles with naked surfaces available in water (not obstructed by chemical bonds), a change to Cerenkov spectrum over a large range of wavelengths are observed and pre-solvated electrons are captured by gold nanoparticles exclusively (not by ionic liquid surfactants used to stabilize the nanoparticles). The solvated electrons are also found to decay rapidly compared with the decay kinetics in water. These very fast reactions with electrons in water could provide an enhanced oxidizing zone around gold nanoparticles and this could be the reason for radio sensitizing behavior of gold nanoparticles in radiation therapy.
Gold-Pluronic core-shell nanoparticles: synthesis, characterization and biological evaluation
Energy Technology Data Exchange (ETDEWEB)
Simon, Timea; Boca, Sanda [Babes-Bolyai University, Nanobiophotonics and Laser Microspectroscopy Center, Interdisciplinary Research Institute on Bio-Nano-Sciences and Faculty of Physics (Romania); Biro, Dominic [Sapientia University, Department of Mechanical Engineering, Faculty of Technical and Human Sciences (Romania); Baldeck, Patrice [Universite Joseph Fourier and CNRS, Laboratoire Interdisciplinaire de Physique, UMR 5588, CNRS (France); Astilean, Simion, E-mail: simion.astilean@phys.ubbcluj.ro [Babes-Bolyai University, Nanobiophotonics and Laser Microspectroscopy Center, Interdisciplinary Research Institute on Bio-Nano-Sciences and Faculty of Physics (Romania)
2013-04-15
This study presents the synthesis of gold-Pluronic core-shell nanoparticles by a two-step method and investigates their biological impact on cancer cells, specifically nanoparticle internalization and cytotoxicity. Uniform, 9-10-nm-sized, hydrophobic gold nanoparticles were synthesized in organic phase by reducing gold salt with oleylamine, after which oleylamine-protected gold nanoparticles were phase-transferred into aqueous medium using Pluronic F127 block copolymer, resulting in gold-Pluronic core-shell nanoparticles with a mean hydrodynamic diameter of {approx}35 nm. The formation and phase-transfer of gold nanoparticles were analyzed by UV-Vis absorption spectroscopy, transmission electron microscopy, and dynamic light scattering. The obtained gold-Pluronic core-shell nanoparticles proved to be highly stable in salted solution. Cytotoxicity tests showed no modification of cellular viability in the presence of properly purified particles. Furthermore, dark-field cellular imaging demonstrated that gold-Pluronic nanoparticles were able to be efficiently uptaken by cells, being internalized through nonspecific endocytosis. The high stability, proven biocompatibility, and imaging properties of gold-Pluronic core-shell nanoparticles hold promise for relevant intracellular applications, with such a design providing the feasibility to combine all multiple functionalities in one nanoparticle for simultaneous detection and imaging.
Quinone-Enriched Gold Nanoparticles in Bioelectrochemistry and Charge Storage
DEFF Research Database (Denmark)
Wagner, Michal; Qvortrup, Katrine; Tanner, David Ackland
for merging gold nanoparticles with resultant anthraquinones include one-pot microwave assisted synthesis or after-mixing of separately prepared gold nanoparticles with selected compounds. The quinone-enriched gold nanoparticles can be transferred onto different electrode surfaces, thus enabling facile...
International Nuclear Information System (INIS)
Wei Gehong; Fan Lianmei; Zhu Wenfei; Fu Yunyun; Yu Jianfu; Tang Ming
2009-01-01
A total of 108 strains of bacteria were isolated from root nodules of wild legumes growing in gold mine tailings in northwest of China and were tested for heavy metal resistance. The results showed that the bacterial strain CCNWRS33-2 isolated from Lespedeza cuneata was highly resistant to copper, cadmium, lead and zinc. The strain had a relatively high mean specific growth rate under each heavy metal stress test and exhibited a high degree of bioaccumulation ability. The partial sequence of the copper resistance gene copA was amplified from the strain and a sequence comparison with our Cu-resistant PCR fragment showed a high homology with Cu-resistant genes from other bacteria. Phylogenetic analysis based on the 16S rRNA gene sequence showed that CCNWRS33-2 belongs to the Rhizobium-Agrobacterium branch and it had 98.9% similarity to Agrobactrium tumefaciens LMG196
Energy Technology Data Exchange (ETDEWEB)
Wei Gehong [College of Life Science, Shaanxi Key Laboratory of Molecular Biology for Agriculture, Northwest A and F University, Yangling Shaanxi 712100 (China)], E-mail: weigehong@yahoo.com.cn; Fan Lianmei; Zhu Wenfei; Fu Yunyun; Yu Jianfu; Tang Ming [College of Life Science, Shaanxi Key Laboratory of Molecular Biology for Agriculture, Northwest A and F University, Yangling Shaanxi 712100 (China)
2009-02-15
A total of 108 strains of bacteria were isolated from root nodules of wild legumes growing in gold mine tailings in northwest of China and were tested for heavy metal resistance. The results showed that the bacterial strain CCNWRS33-2 isolated from Lespedeza cuneata was highly resistant to copper, cadmium, lead and zinc. The strain had a relatively high mean specific growth rate under each heavy metal stress test and exhibited a high degree of bioaccumulation ability. The partial sequence of the copper resistance gene copA was amplified from the strain and a sequence comparison with our Cu-resistant PCR fragment showed a high homology with Cu-resistant genes from other bacteria. Phylogenetic analysis based on the 16S rRNA gene sequence showed that CCNWRS33-2 belongs to the Rhizobium-Agrobacterium branch and it had 98.9% similarity to Agrobactrium tumefaciens LMG196.
Enhancement of radiation effect on cancer cells by gold-pHLIP
Antosh, Michael P.; Wijesinghe, Dayanjali D.; Shrestha, Samana; Lanou, Robert; Huang, Yun Hu; Hasselbacher, Thomas; Fox, David; Neretti, Nicola; Sun, Shouheng; Katenka, Natallia; Cooper, Leon N; Andreev, Oleg A.; Reshetnyak, Yana K.
2015-01-01
Previous research has shown that gold nanoparticles can increase the effectiveness of radiation on cancer cells. Improved radiation effectiveness would allow lower radiation doses given to patients, reducing adverse effects; alternatively, it would provide more cancer killing at current radiation doses. Damage from radiation and gold nanoparticles depends in part on the Auger effect, which is very localized; thus, it is important to place the gold nanoparticles on or in the cancer cells. In this work, we use the pH-sensitive, tumor-targeting agent, pH Low-Insertion Peptide (pHLIP), to tether 1.4-nm gold nanoparticles to cancer cells. We find that the conjugation of pHLIP to gold nanoparticles increases gold uptake in cells compared with gold nanoparticles without pHLIP, with the nanoparticles distributed mostly on the cellular membranes. We further find that gold nanoparticles conjugated to pHLIP produce a statistically significant decrease in cell survival with radiation compared with cells without gold nanoparticles and cells with gold alone. In the context of our previous findings demonstrating efficient pHLIP-mediated delivery of gold nanoparticles to tumors, the obtained results serve as a foundation for further preclinical evaluation of dose enhancement. PMID:25870296
International Nuclear Information System (INIS)
Rezvani Nikabadi, H; Shahtahmasebi, N; Rezaee Rokn-Abadi, M; Bagheri Mohagheghi, M M; Goharshadi, E K
2013-01-01
In this paper, a facile method for the synthesis of gold nanoseeds on the functionalized surface of silica nanoparticles has been investigated. Mono-dispersed silica particles and gold nanoparticles were prepared by the chemical reduction method. The thickness of the Au shell was well controlled by repeating the reduction time of HAuCl 4 on silica/3-aminopropyltriethoxysilane (APTES)/initial gold nanoparticles. The prepared SiO 2 -gold core/shell nanoparticles were studied using x-ray diffraction, scanning electron microscopy, transmission electron microscopy (TEM), Fourier transform infrared spectroscopy and ultraviolet visible (UV-Vis) spectroscopy. The TEM images indicated that the silica nanoparticles were spherical in shape with 100 nm diameters and functionalizing silica nanoparticles with a layer of bi-functional APTES molecules and tetrakis hydroxy methyl phosphonium chloride. The gold nanoparticles show a narrow size of up to 5 nm and by growing gold nanoseeds over the silica cores a red shift in the maximum absorbance of UV-Vis spectroscopy from 524 to 637 nm was observed.
GOLD CLUSTER LABELS AND RELATED TECHNOLOGIES IN MOLECULAR MORPHOLOGY.
Energy Technology Data Exchange (ETDEWEB)
HAINFELD,J.F.; POWELL,R.D.
2004-02-04
Although intensely colored, even the largest colloidal gold particles are not, on their own, sufficiently colored for routine use as a light microscopy stain: only with very abundant antigens or with specialized illumination methods can bound gold be seen. Colloidal gold probes were developed primarily as markers for electron microscopy, for which their very high electron density and selectivity for narrow size distributions when prepared in different ways rendered them highly suited. The widespread use of gold labeling for light microscopy was made possible by the introduction of autometallographic enhancement methods. In these processes, the bound gold particles are exposed to a solution containing metal ions and a reducing agent; they catalyze the reduction of the ions, resulting in the deposition of additional metal selectively onto the particles. On the molecular level, the gold particles are enlarged up to 30-100 nm in diameter; on the macroscale level, this results in the formation of a dark stain in regions containing bound gold particles, greatly increasing visibility and contrast. The applications of colloidal gold have been described elsewhere in this chapter, we will focus on the use of covalently linked cluster complexes of gold and other metals. A gold cluster complex is a discrete molecular coordination compound comprising a central core, or ''cluster'' of electron-dense metal atoms, ligated by a shell of small organic molecules (ligands), which are linked to the metal atoms on the surface of the core. This structure gives clusters several important advantages as labels. The capping of the metal surface by ligands prevents non-specific binding to cell and tissue components, which can occur with colloidal gold. Cluster compounds are more stable and may be used under a wider range of conditions. Unlike colloidal gold, clusters do not require additional macromolecules such as bovine serum albumin or polyethylene glycol for
Gold deposits of the southern Piedmont
Pardee, J.T.; Park, C.F.
1948-01-01
This report deals chiefly with the gold mines in the Southern Appalachian gold belt whose workings were accessible at the time of examination, but it also · summarizes available information concerning many mines that were not accessible. Most of the mines lie within a belt, 10 to 100 miles wide, that extends
Characterisation of gold from Fiji
Naden, Jon; Henney, P.J.
1995-01-01
This is a study of the variation in chemistry and inclusion mineralogy of bedrock and placer gold from Fiji. It forms part of a large project, undertaking gold characterisation from a wide range of geological environments in Ecuador, Zimbabwe, Malaysia and Fiji. The work was carried out under the Overseas Development AdministratiodBritish Geological Survey Technology Development and Research programme (Project R5549) as part of the British Government’s provision of technical...
Chemically functionalized gold nanoparticles: Synthesis, characterization, and applications
Daniel, Weston Lewis
This thesis focuses on the development and application of gold nanoparticle based detection systems and biomimetic structures. Each class of modified nanoparticle has properties that are defined by its chemical moieties that interface with solution and the gold nanoparticle core. In Chapter 2, a comparison of the biomolecular composition and binding properties of various preparations of antibody oligonucleotide gold nanoparticle conjugates is presented. These constructs differed significantly in terms of their structure and binding properties. Chapter 3 reports the use of electroless gold deposition as a light scattering signal enhancer in a multiplexed, microarray-based scanometric immunoassay using the gold nanoparticle probes evaluated in Chapter 2. The use of gold development results in greater signal enhancement than the typical silver development, and multiple rounds of metal development were found to increase the resulting signal compared to one development. Chapter 4 describes an amplified scanometric detection method for human telomerase activity. Gold nanoparticles functionalized with specific oligonucleotide sequences can efficiently capture telomerase enzymes and subsequently be elongated. Both the elongated and unmodified oligonucleotide sequences are simultaneously measured. At low telomerase concentrations, elongated strands cannot be detected, but the unmodified sequences, which come from the same probe particles, can be detected because their concentration is higher, providing a novel form of amplification. Chapter 5 reports the development of a novel colorimetric nitrite and nitrate ion assay based upon gold nanoparticle probes functionalized with Griess reaction reagents. This assay takes advantage of the distance-dependent plasmonic properties of the gold nanoparticles and the ability of nitrite ion to facilitate the cross coupling of novel nanoparticle probes. The assay works on the concept of a kinetic end point and can be triggered at the EPA
Refractory concentrate gold leaching: Cyanide vs. bromine
Dadgar, Ahmad
1989-12-01
Gold extraction, recovery and economics for two refractory concentrates were investigated using cyanide and bromine reagents. Gold extractions for cyanide leaching (24-48 hours) and bromine leaching (six hours) were the same and ranged from 94 to 96%. Gold recoveries from bromine pregnant solutions using carbon adsorption, ion exchange, solvent extraction, and zinc and aluminum precipitation methods were better than 99.9%. A preliminary economic analysis indicates that chemical costs for cyanidation and bromine process are 11.70 and 11.60 respectively, per tonne of calcine processed.
Gold's monetary roll will be strengthened - Plumbridge
International Nuclear Information System (INIS)
Anon.
1977-01-01
Delivering his Presidential address at the Chamber's annual general meeting, Mr Plumbridge said the gold market would enter a new phase and listed seven reasons why gold's monetary role would be strengthened. There was a dramatic increase in the demand for gold jewellery. He also forecasted that South African uranium production would again attain its former peak annual production of about 6000t. There is an essential need for a sustained growth in nuclear power and the prospects for uranium mining industry remain encouraging
Gold nanoparticles extraction from dielectric scattering background
Hong, Xin; Wang, Jingxin
2014-11-01
The unique advantages such as brightness, non-photobleaching, good bio-compatibility make gold nanoparticles desirable labels and play important roles in biotech and related research and applications. Distinguishing gold nanoparticles from other dielectric scattering particles is of more importance, especially in bio-tracing and imaging. The enhancement image results from the localized surface plasmon resonance associated with gold nanopartilces makes themselves distinguishable from other dielectric particles, based on which, we propose a dual-wavelength detection method by employing a high sensitive cross-polarization microscopy.
Booster gold beam injection efficiency and beam loss
International Nuclear Information System (INIS)
Zhang, S.Y.; Ahrens, L.A.
1998-01-01
The Relativistic Heavy Ion Collider (RHIC) at the BNL requires the AGS to provide Gold beam with the intensity of 10 9 ions per bunch. Over the years, the Tandem Van de Graaff has provided steadily increasing intensity of gold ion beams to the AGS Booster. However, the gold beam injection efficiency at the Booster has been found to decrease with the rising intensity of injected beams. As the result, for Tandem beams of the highest intensity, the Booster late intensity is lower than with slightly lower intensity Tandem beam. In this article, the authors present two experiments associated with the Booster injection efficiency and beam intensity. One experiment looks at the Booster injection efficiency by adjusting the Tandem beam intensity, and another looks at the beam life time while scraping the beam in the Booster. The studies suggest that the gold beam injection efficiency at the AGS Booster is related to the beam loss in the ring, rather than the intensity of injected beam or circulating beam. A close look at the effect of the lost gold ion at the Booster injection leads to the prediction that the lost gold ion creates large number of positive ions, and even larger number of electrons. The lost gold beam is also expected to create large numbers of neutral particles. In 1998 heavy ion run, the production of positive ions and electrons due to the lost gold beam has been observed. Also the high vacuum pressure due to the beam loss, presumably because of the neutral particles it created, has been measured. These results will be reported elsewhere
Use of Soybean Lecithin in Shape Controlled Synthesis of Gold Nanoparticles
Ayres, Benjamin Robert
The work presented in this dissertation is a composite of experiments in the growth of gold nanoparticles with specific optical properties of interest. The goal is to synthesize these gold nanoparticles using soybean extract for not only shape control, but for propensity as a biocompatible delivery system. The optical properties of these nanoparticles has found great application in coloring glass during the Roman empire and, over the centuries, has grown into its own research field in applications of nanoparticulate materials. Many of the current functions include use in biological systems as biosensors and therapeutic applications, thus making biocompatibility a necessity. Current use of cetyltrimethylammonium bromide leads to rod-shaped gold nanoparticles, however, the stability of these gold nanoparticles does not endure for extended periods of time in aqueous media. In my research, two important components were found to be necessary for stable, anisotropic growth of gold nanoparticles. In the first experiments, it was found that bromide played a key role in shape control. Bromide exchange on the gold atoms led to specific packing of the growing crystals, allowing for two-dimensional growth of gold nanoparticles. It was also discerned that soybean lecithin contained ligands that blocked specific gold facets leading to prismatic gold nanoparticle growth. These gold nanoprisms give a near infrared plasmon absorption similar to that of rod-shaped gold nanoparticles. These gold nanoprisms are discovered to be extremely stable in aqueous media and remain soluble for extended periods of time, far longer than that of gold nanoparticles grown using cetyltrimethylammonium bromide. Since soy lecithin has a plethora of compounds present, it became necessary to discover which compound was responsible for the shape control of the gold nanoprisms in order to optimize the synthesis and allow for a maximum yield of the gold nanoprisms. Many of these components were identified
Size control synthesis of starch capped-gold nanoparticles
International Nuclear Information System (INIS)
Tajammul Hussain, S.; Iqbal, M.; Mazhar, M.
2009-01-01
Metallic gold nanoparticles have been synthesized by the reduction of chloroaurate anions [AuCl 4 ] - solution with hydrazine in the aqueous starch and ethylene glycol solution at room temperature and at atmospheric pressure. The characterization of synthesized gold nanoparticles by UV-vis spectroscopy, high resolution transmission electron microscopy (HRTEM), electron diffraction analysis, X-ray diffraction (XRD), and X-rays photoelectron spectroscopy (XPS) indicate that average size of pure gold nanoparticles is 3.5 nm, they are spherical in shape and are pure metallic gold. The concentration effects of [AuCl 4 ] - anions, starch, ethylene glycol, and hydrazine, on particle size, were investigated, and the stabilization mechanism of Au nanoparticles by starch polymer molecules was also studied by FT-IR and thermogravimetric analysis (TGA). FT-IR and TGA analysis shows that hydroxyl groups of starch are responsible of capping and stabilizing gold nanoparticles. The UV-vis spectrum of these samples shows that there is blue shift in surface plasmon resonance peak with decrease in particle size due to the quantum confinement effect, a supporting evidence of formation of gold nanoparticles and this shift remains stable even after 3 months.
Antibacterial properties and mechanisms of gold-silver nanocages
Wang, Yulan; Wan, Jiangshan; Miron, Richard J.; Zhao, Yanbin; Zhang, Yufeng
2016-05-01
Despite the number of antibiotics used in routine clinical practice, bacterial infections continue to be one of the most important challenges faced in humans. The main concerns arise from the continuing emergence of antibiotic-resistant bacteria and the difficulties faced with the pharmaceutical development of new antibiotics. Thus, advancements in the avenue of novel antibacterial agents are essential. In this study, gold (Au) was combined with silver (Ag), a well-known antibacterial material, to form silver nanoparticles producing a gold-silver alloy structure with hollow interiors and porous walls (gold-silver nanocage). This novel material was promising in antibacterial applications due to its better biocompatibility than Ag nanoparticles, potential in photothermal effects and drug delivery ability. The gold-silver nanocage was then tested for its antibacterial properties and the mechanism involved leading to its antibacterial properties. This study confirms that this novel gold-silver nanocage has broad-spectrum antibacterial properties exerting its effects through the destruction of the cell membrane, production of reactive oxygen species (ROS) and induction of cell apoptosis. Therefore, we introduce a novel gold-silver nanocage that serves as a potential nanocarrier for the future delivery of antibiotics.
Time series analysis of gold production in Malaysia
Muda, Nora; Hoon, Lee Yuen
2012-05-01
Gold is a soft, malleable, bright yellow metallic element and unaffected by air or most reagents. It is highly valued as an asset or investment commodity and is extensively used in jewellery, industrial application, dentistry and medical applications. In Malaysia, gold mining is limited in several areas such as Pahang, Kelantan, Terengganu, Johor and Sarawak. The main purpose of this case study is to obtain a suitable model for the production of gold in Malaysia. The model can also be used to predict the data of Malaysia's gold production in the future. Box-Jenkins time series method was used to perform time series analysis with the following steps: identification, estimation, diagnostic checking and forecasting. In addition, the accuracy of prediction is tested using mean absolute percentage error (MAPE). From the analysis, the ARIMA (3,1,1) model was found to be the best fitted model with MAPE equals to 3.704%, indicating the prediction is very accurate. Hence, this model can be used for forecasting. This study is expected to help the private and public sectors to understand the gold production scenario and later plan the gold mining activities in Malaysia.
Gold and not so real gold in Medieval treatises
Directory of Open Access Journals (Sweden)
Srebrenka Bogovic-Zeskoski
2015-01-01
Full Text Available The aim of this study is to evidence diverse materials and processes used by artisans (and alchemists required to synthesize a visually viable replacement for gold. The emphasis of the research is upon the production of mosaic gold or porporina, a pigment that has survived into modern times, which was used as ink and as paint. Base metals, mostly tin, but also alloys were used both into foils coated with glazes and varnishes and as pigment. The research focuses upon recipes documented in treatises dating from Antiquity to the late Medieval period (ca. 1500 and an attempt is made to answer two questions. In the first place, why was there a need for a surrogate? Secondly, why are there so few tangible examples detected on surviving artifacts? In conclusion, an argument is offered pointing out that, although much can be learned by scientific examination of artifacts, textual analysis is equally important and necessary to unravel mysteries of ancient technologies
Preparation of gold ethanol colloid by the arc discharge method
International Nuclear Information System (INIS)
Tseng, K.-H.; Huang, J.-C.; Liao, C.-Y.; Tien, D.-C.; Tsung, T.-T.
2009-01-01
A new method using the arc discharge method (ADM) to synthesize gold nanoparticles in an anhydrous ethanol was studied. Fabricated gold nanoparticles were characterized by different techniques. Unlike conventional methods for metal nanoparticles synthesis, the ADM method does not require application of chemical surfactants and stabilizers. The microstructure of ADM-produced gold nanoparticles was examined by transmission electron microscope (TEM) and scanning electron microscope (SEM). The particle size was found in the range of 2-40 nm. The chemical composition of gold nanoparticles has been confirmed by the energy dispersive X-ray analysis (EDX). The crystal structure of the nanoscale gold particles was studied using the X-ray diffraction (XRD) method. Images of the gold nanoparticles, Zeta potential, size distribution, and ultraviolet-visible (UV-vis) absorbance were investigated. This innovative approach for gold nanoparticles preparation has been successfully established. The experimental results showed that the ADM technique is easy, cheap and clean method which can be used to manufacture gold nanoparticles suspended in ethanol solution without any surfactant
International Nuclear Information System (INIS)
Vulcu, Adriana; Grosan, Camelia; Muresan, Liana Maria; Pruneanu, Stela; Olenic, Liliana
2013-01-01
The present paper describes the preparation of new modified surfaces for electrodes based on guanine/thiocytosine and gold nanoparticles. The gold nanoparticles were analyzed by UV–vis spectroscopy and transmission electron microscopy (TEM) and it was found that they have diameters between 30 and 40 nm. The layers were characterized by specular reflectance infrared spectroscopy (FTIR-RAS) and by atomic force microscopy (AFM). The thickness of layers was found to be approximately 30 nm for TC layers and 300 nm for GU layers. Every layer was characterized as electrochemical sensor (by cyclic voltammetry) both for uric acid and ascorbic acid determinations, separately and in their mixture. The modified sensors have good calibration functions with good sensitivity (between 1.145 and 1.406 mA cm −2 /decade), reproducibility ( t hiocytosine (Au T C) and gold g uanine (Au G U) layers
International Nuclear Information System (INIS)
Shen Maogen; Yao Liying.
1989-01-01
The gold determination method is described by cold leaching gold in dilute aqua regia and collection on activated charcoal and presents the results obtained in determining gold of uranium deposits and soil samples
Some developments in the extraction of gold from Witwatersrand ores
International Nuclear Information System (INIS)
Laxen, P.A.
1975-01-01
The extraction of gold from most ores of the Witwatersrand has been consistently high - approximately 95 per cent - for many years. The present high price of gold has stimulated research and development into potential improvements of the standard procedures. The occurrence of the gold and its association with other minerals is described briefly. The Witwatersrand reefs also contain uranium and pyrite, and some of the improvements to the standard gold-extraction process are associated with the recovery or concentration of one or both of these valuable constituents. For instance, the 'reverse-leach' process, in which acid treatment for the extraction of uranium precedes cyanidation, results in improved gold extraction. Some concentration techniques used on the present residues from cyanidation offer promise in improving the overall gold recoveries. Thucholite is an important carrier of residual gold, and its recovery from some residues by flotation appears to be economically justifiable. Wet high-intensity magnetic separation has given promising results, in the laboratory and on the pilot plant, for the recovery of both uranium and gold from a number of cyanide tailings. The benefits of gravity concentration and of the application of empirical modelling to the gold-extraction process have been demonstrated by a mining group. Some developments in instrumentation for control during cyanidation are discussed briefly [af
Lime in gold and uranium mining
International Nuclear Information System (INIS)
Van Staden, C.M.
1979-01-01
In this article the author discusses the role of lime in gold and uranium extraction and looks more closely at the industry's efforts to improve the environment by vegetation of sand dumps and slimes dams. He then comes to the conclusion that lime has been and still is the most effective, practical and cheapest chemical that can be used in the South African gold and uranium mining industry to settle pulps, protect cyanide solutions, aid the vegetation of dumps and neutralise acidic waters and residues. The gold and uranium industry is very pollution concious, and in South Africa the importance of the role that lime plays in combating air and water pollution cannot be over emphasised
Erdman, J.A.; Cookro, T.M.; O'Leary, R. M.; Harms, T.F.
1988-01-01
Big sagebrush - a cold-desert species that dominates the terrain over large parts of western United States - was sampled along several traverses that crossed thermally metamorphosed limestone, phyllitic shale, and schist of the Middle and Upper Cambrian Preble Formation that host skarn-, disseminated gold and silver-, and hot springs gold-type mineral occurrences. Patterns of detectable levels of gold (8 to 28 ppb or ng g-1) in ash of new growth were consistent with areas affected by known or suspected gold mineralization. Soils collected along one of the traverses where a selenium-indicator plant was common contained no gold above background levels of 2ppb, but were consistently high in As, Sb, and Zn, and several samples were unusually high in Se (maximum 11 ppm or ??g g-1). Sagebrush along this traverse contained Li at levels above norms for this species. We also found a puzzling geochemical anomaly at a site basinward from active hot springs along a range-front fault scarp. Sagebrush at this site contained a trace of gold and an unusually high concentration of Cd (13 ppm) and the soil had anomalous concentrations of Cd and Bi (3.2 and 6 ppm, respectively). The source of this anomaly could be either metal-rich waters from an irrigation ditch or leakage along a buried fault. Despite the limited nature of the study, we conclude that gold in sagebrush could be a cost-effective guide to drilling locations in areas where the geology seems favorable for disseminated and vein precious metals. ?? 1988.
International Nuclear Information System (INIS)
Reitz, B.; Heydorn, K.
1993-01-01
A new method is presented for the determination of Au and Pt in biological materials based on neutron activation analysis with radiochemical separation of gold. Separation of gold by electrolytic deposition on a niobium cathode ascertains thee highest radiochemical purity without any interference from calcium or other major elements. With 199 Au as indicator for platinum the gold content of the sample not only strongly affects the limit of detection, but also causes interference by double neutron capture. Replicate analyses of BCR Certified Reference Materials No. 184, 185 and 186 were carried out. (author) 18 refs.; 3 figs.; 2 tabs
Using mineralogy to optimize gold recovery by direct cyanidation
Venter, D.; Chryssoulis, S. L.; Mulpeter, T.
2004-08-01
The complete and accurate gold deportments of direct cyanide leach residues provide a clear picture of the occurrence of unrecovered gold and identify causes for poor extraction. Based on the independent measurement of each form and carrier of unleached gold, opportunities for recovery optimization can be assessed more accurately by providing meaningful targets and can help identify the means to achieve such targets. In ten of 14 leach plants surveyed, 23% of the unrecovered gold could be extracted without finer grinding.
Recovering gold from thiosulfate leach pulps via ion exchange
Nicol, Michael J.; O'Malley, Glen
2002-10-01
Increasing environmental and occupational safety concerns about the use of cyanide in gold processing has increased interest in more acceptable alternative lixiviants, the most promising of which is thiosulfate. However, the thiosulfate process lacks a proven inpulp method of recovering the dissolved gold because activated carbon is not effective for the absorption of the gold-thiosulfate complex. This paper describes work aimed at evaluating the effectiveness of commercially available anion exchange resins for the recovery of gold from thiosulfate leach liquors and pulps.
Breaking gold nano-junctions simulation and analysis
DEFF Research Database (Denmark)
Lauritzen, Kasper Primdal
, to predict the structure of a gold junction just as it breaks. This method is based on artificial neural networks and can be used on experimental data, even when it is trained purely on simulated data. The method is extended to other types of experimental traces, where it is trained without the use......Simulating the movements of individual atoms allows us to look at and investigate the physical processes that happen in an experiment. In this thesis I use simulations to support and improve experimental studies of breaking gold nano-junctions. By using molecular dynamics to study gold nanowires, I...... can investigate their breaking forces under varying conditions, like stretching rate or temperature. This resolves a confusion in the literature, where the breaking forces of two different breaking structures happen to coincide. The correlations between the rupture and reformation of a gold junction...
Venugopal, Priyanka; Lavu, Vamsi; RangaRao, Suresh; Venkatesan, Vettriselvi
2017-04-01
Periodontitis is an inflammatory disease caused by bacterial triggering of the host immune-inflammatory response, which in turn is regulated by microRNAs (miRNA). Polymorphisms in the miRNA pathways affect the expression of several target genes such as tumor necrosis factor-α and interleukins, which are associated with progression of disease. The objective of this study was to identify the association between the MiR-146a single nucleotide polymorphisms (SNPs) (rs2910164, rs57095329, and rs73318382), the MiR-196a2 (rs11614913) SNP and chronic periodontitis. Genotyping was performed for the MiR-146a (rs2910164, rs57095329, and rs73318382) and the MiR-196a2 (rs11614913) polymorphisms in 180 healthy controls and 190 cases of chronic periodontitis by the direct Sanger sequencing technique. The strength of the association between the polymorphisms and chronic periodontitis was evaluated using logistic regression analysis. Haplotype and linkage analyses among the polymorphisms was performed. Multifactorial dimensionality reduction was performed to determine epistatic interaction among the polymorphisms. The MiR-196a2 polymorphism revealed a significant inverse association with chronic periodontitis. Haplotype analysis of MiR-146a and MiR-196a2 polymorphisms revealed 13 different combinations, of which 5 were found to have an inverse association with chronic periodontitis. The present study has demonstrated a significant inverse association of MiR-196a2 polymorphism with chronic periodontitis.
Nuclear analyses of the Pietroasa gold hoard
International Nuclear Information System (INIS)
Cojocaru, V.; Besliu, C.
1999-01-01
By means of nuclear analyses the concentrations of Au, Ag, Cu, Ir, Os, Pt, Co and Hg were measured in the 12 artifacts of the gold hoard discovered in 1837 at Pietroasa, Buzau country in Romania. The concentrations of the first four elements were used to compare different stylistic groups assumed by historians. Comparisons with gold nuggets from the old Dacian territory and gold Roman imperial coins were also made. A good agreement was found with the oldest hypothesis which considers that the hoard is represented by three styles appropriated mainly by the Goths. (author)
Ligations of Gold Atoms with Iron Porphyrin
DEFF Research Database (Denmark)
Zhang, Ling; Kepp, Kasper Planeta; Ulstrup, Jens
Gold is an exotic material with d-electrons deciding electronic mappings andconfigurations of adsorbed molecules. The specific interaction of Au atoms and S-, Ncappedmolecules make gold nanoparticles widely applied in the medicine transport andimmunoassay. Density functional theory demonstrates t...
Corrosion of gold alloys and titanium in artificial saliva
International Nuclear Information System (INIS)
Brune, D.; Evje, D.
1982-01-01
Two types of gold alloys and one type of pure titanium have been submitted to corrosion in artificial saliva for periods of up to about 2 months. The release of copper, gold and silver from the gold alloys as well as titanium from the titanium matrix was measured with nuclear tracer technique. The physical/chemical state of the corrosion products of gold alloys referring to the ionic state or presence in particulate form has been examined retaining the particulate matter on a glass filter. Copper was observed to be mainly present in the ionic state. Considerable amounts of gold were observed to be retained on the glass filter explained by the presence of gold in particulate form or as a compentent of a dispersed collloidal phase. The estimation of the release of titanium was registered by the tracer nuclide 46 Sc assuming particulate matter to be deteriorated from the titanium surface. (author)
Gold nanoparticles stabilized by chitosan
International Nuclear Information System (INIS)
Geraldes, Adriana N.; Oliveira, Maria Jose A.; Silva, Andressa A. da; Leal, Jessica; Batista, Jorge G.S.; Lugao, Ademar B.
2015-01-01
In our laboratory has been growing the interest in studying gold nanoparticles and for this reason, the aim of this work is report the first results of the effect of chitosan as stabilizer in gold nanoparticle formulation. AuNPs were synthesized by reducing hydrogen tetrachloroaurate (HAuCl 4 ) using NaBH 4 or gamma irradiation (25kGy) as reduction agent. The chitosan (3 mol L -1 ) was added at 0.5; 1.0 and 1.5 mL. The gold nanoparticles were characterized by UV-Vis absorption spectroscopy, X-ray diffraction (XRD) and Transmission electron microscopy (TEM). Their physical stability was determined using a UV-Vis spectrophotometer over one week during storage at room temperature. Absorption measurements indicated that the plasmon resonance wavelength appears at a wavelength around 530 nm. Has been observed that Chitosan in such quantities were not effective in stabilizing the AuNPs. (author)
Gold Nanoparticle Labels Amplify Ellipsometric Signals
Venkatasubbarao, Srivatsa
2008-01-01
The ellipsometric method reported in the immediately preceding article was developed in conjunction with a method of using gold nanoparticles as labels on biomolecules that one seeks to detect. The purpose of the labeling is to exploit the optical properties of the gold nanoparticles in order to amplify the measurable ellipsometric effects and thereby to enable ultrasensitive detection of the labeled biomolecules without need to develop more-complex ellipsometric instrumentation. The colorimetric, polarization, light-scattering, and other optical properties of nanoparticles depend on their sizes and shapes. In the present method, these size-and-shape-dependent properties are used to magnify the polarization of scattered light and the diattenuation and retardance of signals derived from ellipsometry. The size-and-shape-dependent optical properties of the nanoparticles make it possible to interrogate the nanoparticles by use of light of various wavelengths, as appropriate, to optimally detect particles of a specific type at high sensitivity. Hence, by incorporating gold nanoparticles bound to biomolecules as primary or secondary labels, the performance of ellipsometry as a means of detecting the biomolecules can be improved. The use of gold nanoparticles as labels in ellipsometry has been found to afford sensitivity that equals or exceeds the sensitivity achieved by use of fluorescence-based methods. Potential applications for ellipsometric detection of gold nanoparticle-labeled biomolecules include monitoring molecules of interest in biological samples, in-vitro diagnostics, process monitoring, general environmental monitoring, and detection of biohazards.
Gold recovery from printed wiring board using bioleaching
Energy Technology Data Exchange (ETDEWEB)
Kita, Y. [Faculty of Engineering, Osaka Univ. (Japan); Nishikawa, H. [Center for Advanced Science and Innovation, Osaka Univ. (Japan); Takemoto, T. [Joining and Welding Research Inst., Osaka Univ. (Japan)
2004-07-01
In the electronic assembly, gold is frequently used as surface plating and a bonding wire. To recover gold from waste electronics, the dissolution process using cyan is a popular method, however, the solution is highly toxic. Accordingly, the environmentally conscious substitute process is preferable. In this study the possibility of Au dissolution from printed wiring boards using bioleaching has been investigated. Chromobacterium violaceum having ability of cyanide formation was used to dissolve Au. The printed wiring boards with gold plating of 0.07nm in thickness were immersed in synthetic medium with C. violaceum. After immersion test for 480h, the gold plating was completely dissolved. The increase in cyanide concentration gave little effect on the enhancement of dissolution of gold, however, the dissolution rate of Au was increased with increasing of dissolved oxygen in the medium. Chromobacterium violaceum produced 0.8mmol/l cyanide but it also decomposed about 60% of cyanide generated, therefore, this dissolution process could be used as an environmentally conscious method. (orig.)
Crystal growth, structure and phase studies on gold halides
Janssen, Eugenius Maria Wilhelmus Janssen
1977-01-01
Only very corrosive substances attack gold, the most noble metal. In this study the reactivity and the phase diagrams of gold with the halogens chlorine, bromine and iodine have been investigated. owing to the noble behaviour of gold, its halides are sensitive to heat; on heating they decompose into
Chow, Philippe K.; Yang, Wenjie; Hudspeth, Quentin; Lim, Shao Qi; Williams, Jim S.; Warrender, Jeffrey M.
2018-04-01
We demonstrate that pulsed laser melting (PLM) of thin 1, 5, and 10 nm-thick vapor-deposited gold layers on silicon enhances its room-temperature sub-band gap infrared absorption, as in the case of ion-implanted and PLM-treated silicon. The former approach offers reduced fabrication complexity and avoids implantation-induced lattice damage compared to ion implantation and pulsed laser melting, while exhibiting comparable optical absorptance. We additionally observed strong broadband absorptance enhancement in PLM samples made using 5- and 10-nm-thick gold layers. Raman spectroscopy and Rutherford backscattering analysis indicate that such an enhancement could be explained by absorption by a metastable, disordered and gold-rich surface layer. The sheet resistance and the diode electrical characteristics further elucidate the role of gold-supersaturation in silicon, revealing the promise for future silicon-based infrared device applications.
South African gold and uranium ore mining in 1976
International Nuclear Information System (INIS)
Hentrich, W.
1977-01-01
1976 was a difficult year for the South African gold and uranium ore mining industry, the region of Witwatersrand (Transvaal province) producing some 75% of all the gold mined in the western world besides being an important producer of uranium oxide. Despite the gold production, declining since 1971, not showing a downward tendency anymore as far as the quantity was concerned, the economic result, however, deteriorated as a consequence of continuously falling gold prices, but also on account of the inflationary rise in wages and the prices for energy and materials. Much higher prices for uranium oxide, which some mines produce as interim products from the 'degolded' slurries of their gold ore leaching plants, improved the economic overall result only to a small degree. (orig.) [de
Synthesis of PEGylated gold nanostars and bipyramids for intracellular uptake
International Nuclear Information System (INIS)
Navarro, Julien R G; Lerouge, Frédéric; Chaput, Frédéric; Micouin, Guillaume; Gabudean, Ana-Maria; Baldeck, Patrice L; Kamada, Kenji; Parola, Stephane; Manchon, Delphine; Mosset, Alexis; Cottancin, Emmanuel; Blanchard, Nicholas P; Marotte, Sophie; Leverrier, Yann; Marvel, Jacqueline
2012-01-01
A great number of works have focused their research on the synthesis, design and optical properties of gold nanoparticles for potential biological applications (bioimaging, biosensing). For this kind of application, sharp gold nanostructures appear to exhibit the more interesting features since their surface plasmon bands are very sensitive to the surrounding medium. In this paper, a complete study of PEGylated gold nanostars and PEGylated bipyramidal-like nanostructures is presented. The nanoparticles are prepared in high yield and their surfaces are covered with a biocompatible polymer. The photophysical properties of gold bipyramids and nanostars, in suspension, are correlated with the optical response of single and isolated objects. The resulting spectra of isolated gold nanoparticles are subsequently correlated to their geometrical structure by transmission electron microscopy. Finally, the PEGylated gold nanoparticles were incubated with melanoma B16-F10 cells. Dark-field microscopy showed that the biocompatible gold nanoparticles were easily internalized and most of them localized within the cells. (paper)
Yigit, O.; Hofstra, A.H.
2003-01-01
The Gold Bar district contains five Carlin-type gold deposits and four resources for a combined gold endowment of 1.6 M oz [50 t]. The gold deposits are hosted in Devonian carbonate rocks below parautochthonous and allochthonous Paleozoic siliciclastic rocks emplaced during the Early Mississippian Antler orogeny. The district is in the Battle Mountain-Eureka trend, a long-lived structural feature that localized intrusions and ore deposits of different types and ages. The whole-rock geochemistry of four different mineralized and unmineralized Devonian carbonate rock units (two favorable and two unfavorable) were determined and interpreted in the context of the regional geology. A combination of basic statistics, R-mode factor analysis, isocon plots, and alteration diagrams were utilized to (1) identify favorable geochemical attributes of the host rocks, (2) characterize alteration and associated element enrichments and depletions, and (3) identify the mechanism of gold precipitation. This approach also led to the recognition of other types of alteration and mineralization in host rocks previously thought to be solely affected by Carlin-type mineralization. Unit 2 of the Upper Member of the Denay Formation, with the highest Al2O3, Fe2O3 and SiO2 contents and the lowest CaO content, is the most favorable host rock. Based on the high regression coefficients of data arrays on X-Y plots that project toward the origin, Al2O3 and TiO2 were immobile and K2O and Fe2O3 were relatively immobile during alteration and mineralization. Specific element associations identified by factor analysis are also prominent on isocon diagrams that compare the composition of fresh and altered equivalents of the same rock units. The most prominent associations are: Au, As, Sb, SiO2, TI, -CaO and -LOI, the main gold mineralizing event and related silicification and decalcification; Cd, Zn, Ag, P, Ni and Tl, an early base metal event; and MgO, early dolomitization. Alteration diagrams
Method for aqueous gold thiosulfate extraction using copper-cyanide pretreated carbon adsorption
Young, Courtney; Melashvili, Mariam; Gow, Nicholas V
2013-08-06
A gold thiosulfate leaching process uses carbon to remove gold from the leach liquor. The activated carbon is pretreated with copper cyanide. A copper (on the carbon) to gold (in solution) ratio of at least 1.5 optimizes gold recovery from solution. To recover the gold from the carbon, conventional elution technology works but is dependent on the copper to gold ratio on the carbon.
Gold particle formation via photoenhanced deposition on lithium niobate
Energy Technology Data Exchange (ETDEWEB)
Zaniewski, A.M., E-mail: azaniews@asu.edu; Meeks, V.; Nemanich, R.J.
2017-05-31
Highlights: • Gold chloride is reduced into solid gold nanoparticles at the surface of a polarized semiconductor. • Reduction processes are driven by ultraviolet light. • Gold nanoparticle and silver nanoparticle deposition patterns are compared. - Abstract: In this work, we report on a technique to reduce gold chloride into sub-micron particles and nanoparticles. We use photoelectron transfer from periodically polarized lithium niobate (PPLN) illuminated with above band gap light to drive the surface reactions required for the reduction and particle formation. The particle sizes and distributions on the PPLN surface are sensitive to the solution concentration, with inhibited nucleation and large particles (>150 nm) for both low (2E−8M to 9E−7M) and high (1E−5M to 1E−3M) concentrations of gold chloride. At midrange values of the concentration, nucleation is more frequent, resulting in smaller sized particles (<150 nm). We compare the deposition process to that for silver, which has been previously studied. We find that the reduction of gold chloride into nanoparticles is inhibited compared to silver ion reduction, due to the multi-step reaction required for gold particle formation. This also has consequences for the resulting deposition patterns: while silver deposits into nanowires along boundaries between areas with opposite signed polarizations, such patterning of the deposition is not observed for gold, for a wide range of concentrations studied (2E−8 to 1E−3M).
International Nuclear Information System (INIS)
1988-01-01
The Jabiluka gold-uranium deposit, 230km east of Darwin in the Alligator Rivers Region of the Northern Territory, was discovered by Pancontinental Mining Limited in 1971. Jabiluka, with reserves in excess of 200,000 tonnes of contained U 3 O 8 in two deposits 500 metres apart, is the world's largest high grade uranium deposit and also contains nearly 12 tonnes of gold. It is proposed that only the larger deposit, Jabiluka II will be mined - by underground extraction methods, and that 275,000 tonnes of ore per year will be mined and processed to produce 1,500 tonnes of U 3 O 8 and up to 30,000 oz of gold. The revenue from the uranium sales is estimated to be of the order of A$100 million per year at A$30/lb. By the end of 1982 all necessary mining and environmental approvals had been obtained and significant marketing progress made. With the Australian Labor Party winning Commonwealth Government in the 1983 election, Pancontinental's permission to seek sales contracts was withdrawn and development of the Jabiluka deposit ceased. Jabiluka remains undeveloped - awaiting a change in Australian Government policy on uranium. figs., maps
Gold Nanoparticle Conjugation Enhances the Antiacanthamoebic Effects of Chlorhexidine
Aqeel, Yousuf; Siddiqui, Ruqaiyyah; Anwar, Ayaz; Shah, Muhammad Raza
2015-01-01
Acanthamoeba keratitis is a serious infection with blinding consequences and often associated with contact lens wear. Early diagnosis, followed by aggressive topical application of drugs, is a prerequisite in successful treatment, but even then prognosis remains poor. Several drugs have shown promise, including chlorhexidine gluconate; however, host cell toxicity at physiologically relevant concentrations remains a challenge. Nanoparticles, subcolloidal structures ranging in size from 10 to 100 nm, are effective drug carriers for enhancing drug potency. The overall aim of the present study was to determine whether conjugation with gold nanoparticles enhances the antiacanthamoebic potential of chlorhexidine. Gold-conjugated chlorhexidine nanoparticles were synthesized. Briefly, gold solution was mixed with chlorhexidine and reduced by adding sodium borohydride, resulting in an intense deep red color, indicative of colloidal gold-conjugated chlorhexidine nanoparticles. The synthesis was confirmed using UV-visible spectrophotometry that shows a plasmon resonance peak of 500 to 550 nm, indicative of gold nanoparticles. Further characterization using matrix-assisted laser desorption ionization-mass spectrometry showed a gold-conjugated chlorhexidine complex at m/z 699 ranging in size from 20 to 100 nm, as determined using atomic force microscopy. To determine the amoebicidal and amoebistatic effects, amoebae were incubated with gold-conjugated chlorhexidine nanoparticles. For controls, amoebae also were incubated with gold and silver nanoparticles alone, chlorhexidine alone, neomycin-conjugated nanoparticles, and neomycin alone. The findings showed that gold-conjugated chlorhexidine nanoparticles exhibited significant amoebicidal and amoebistatic effects at 5 μM. Amoebicidal effects were observed by parasite viability testing using a Trypan blue exclusion assay and flow-cytometric analysis using propidium iodide, while amoebistatic effects were observed using growth
Plasmonic Horizon in Gold Nanosponges.
Vidal, Cynthia; Sivun, Dmitry; Ziegler, Johannes; Wang, Dong; Schaaf, Peter; Hrelescu, Calin; Klar, Thomas A
2018-02-14
An electromagnetic wave impinging on a gold nanosponge coherently excites many electromagnetic hot-spots inside the nanosponge, yielding a polarization-dependent scattering spectrum. In contrast, a hole, recombining with an electron, can locally excite plasmonic hot-spots only within a horizon given by the lifetime of localized plasmons and the speed carrying the information that a plasmon has been created. This horizon is about 57 nm, decreasing with increasing size of the nanosponge. Consequently, photoluminescence from large gold nanosponges appears unpolarized.
Gold nanoparticle-pentacene memory-transistors
Novembre , Christophe; Guerin , David; Lmimouni , Kamal; Gamrat , Christian; Vuillaume , Dominique
2008-01-01
We demonstrate an organic memory-transistor device based on a pentacene-gold nanoparticles active layer. Gold (Au) nanoparticles are immobilized on the gate dielectric (silicon dioxide) of a pentacene transistor by an amino-terminated self-assembled monolayer. Under the application of writing and erasing pulses on the gate, large threshold voltage shift (22 V) and on/off drain current ratio of ~3E4 are obtained. The hole field-effect mobility of the transistor is similar in the on and off sta...
78 FR 72139 - Nevada Gold Corp.; Order of Suspension of Trading
2013-12-02
... current and accurate information concerning the securities of Nevada Gold Corp. (``Nevada Gold'') because of questions regarding the accuracy of assertions by Nevada Gold, and by others, to investors in..., and financial condition. Nevada Gold is a Delaware corporation based in Del Mar, California. The...
Enhanced performance of VOx-based bolometer using patterned gold black absorber
Smith, Evan M.; Panjwani, Deep; Ginn, James; Warren, Andrew; Long, Christopher; Figuieredo, Pedro; Smith, Christian; Perlstein, Joshua; Walter, Nick; Hirschmugl, Carol; Peale, Robert E.; Shelton, David J.
2015-06-01
Patterned highly absorbing gold black film has been selectively deposited on the active surfaces of a vanadium-oxide-based infrared bolometer array. Patterning by metal lift-off relies on protection of the fragile gold black with an evaporated oxide, which preserves gold black's near unity absorption. This patterned gold black also survives the dry-etch removal of the sacrificial polyimide used to fabricate the air-bridge bolometers. Infrared responsivity is substantially improved by the gold black coating without significantly increasing noise. The increase in the time constant caused by the additional mass of gold black is a modest 14%.
Multifunctional gold nanoparticles for diagnosis and therapy of disease
Mieszawska, Aneta J.; Mulder, Willem J. M.; Fayad, Zahi A.
2013-01-01
Gold nanoparticles (AuNPs) have a number of physical properties that make them appealing for medical applications. For example, the attenuation of X-rays by gold nanoparticles has led to their use in computed tomography imaging and as adjuvants for radiotherapy. AuNPs have numerous other applications in imaging, therapy and diagnostic systems. The advanced state of synthetic chemistry of gold nanoparticles offers precise control over physicochemical and optical properties. Furthermore gold cores are inert and are considered to be biocompatible and non-toxic. The surface of gold nanoparticles can easily be modified for a specific application and ligands for targeting, drugs or biocompatible coatings can be introduced. AuNPs can be incorporated into larger structures such as polymeric nanoparticles or liposomes that deliver large payloads for enhanced diagnostic applications, efficiently encapsulate drugs for concurrent therapy or add additional imaging labels. This array of features has led to the afore-mentioned applications in biomedical fields, but more recently in approaches where multifunctional gold nanoparticles are used for multiple methods, such as concurrent diagnosis and therapy, so called theranostics. The following review covers basic principles and recent findings in gold nanoparticle applications for imaging, therapy and diagnostics, with a focus on reports of multifunctional AuNPs. PMID:23360440
Preg-robbing of Gold by Carbonaceous Materials Encountered in ...
African Journals Online (AJOL)
Processing of gold from refractory ores containing carbonaceous materials (CM) poses challenges due to the ability of the CM to preg-rob dissolved gold. Depending on the type and maturity of CM encountered, preg-robbing of aurocyanide ion can lead to reduction in gold recovery ranging from a few percentages to more ...
Thiosulphate leaching of gold-, silver-, copper flotation concentrates
International Nuclear Information System (INIS)
Samikhov, Sh.R.; Zinchenko, Z.A.
2015-01-01
Present article is devoted to thiosulphate leaching of gold-, silver-, copper flotation concentrates. For the purpose to improve the process of thiosulphate leaching the ore samples were calcined at temperature 600 ℃ during two hours. During the calcination process of gold-sulphide ores and concentrates the minerals pyrite and arsenopyrite oxidize which lead to opening of gold contains in them. It was defined that thiosulphate leaching can be recommended as an alternative to cyanic process.
International Nuclear Information System (INIS)
Bacso, J.; Uzonyi, I.; Dezsoe, B.
1986-08-01
Human autopsy tissues from five patients with rheumatoid arthritis treated earlier with aqueous solution of gold and those from untreated control with the same disease were analyzed by x-ray fluorescence spectrometry using a conventional Si(Li) detection system. The gold and zinc concentrations of tissues were determined and compared with literature data. Correlation was found between Zn and Au concentrations in heart, lung, kidney and liver tissues. (author)
Energy Technology Data Exchange (ETDEWEB)
Stahlmecke, Burkhard
2008-01-15
Electromigration is the current induced mass transport in metallic wires. It is the main reason for electrical breakdown in integrated circuits and has been studied for more than 50 years. In this thesis, the electromigration behavior in polycrystalline gold as well as in self-organized single crystalline silver wires are studied. To study the electromigration behavior in detail, in-situ investigations of the wires are performed in a scanning electron microscope, for which a new test rig was successfully installed. During electromigration, the development of voids on the cathode and hillocks on the anode side of the wire are observed. This behavior is studied in detail in this thesis. Electrical breakdown in the gold wires takes place due to the presence of slit-like voids perpendicular to the current direction. The void area grows linearly during the course of the experiments, and the electrical breakdown takes place when the total void area reaches a value of 2 % to 4 % of the total wire area. The influence of single voids on the electrical resistance during high current stressing is determined. The dependence of the electromigration behavior on the width and height as well as on the crystallinity and temperature of the gold wires is studied in detail. For high resolution imaging of the wires during the experiments, a special layout with arbitrary kinks is used. The dependence of electromigration effects on current density and on the influence of the measurement setup itself are also discussed in this thesis. When reversing the current direction, a reversible electromigration behavior is observed. Also, the lifetime of the wires grows considerably. According to the resistance data, a remarkable stabilization of the polycrystalline wires is observed during this experiments. Furthermore, it is possible to define an alternative sheet length according to the position of voids and hillocks in the wires. This leads also to the determination of the critical product for
Determination of thorium in native gold by radiochemical neutron activation analysis
International Nuclear Information System (INIS)
Liu, Y.; Kraehenbuehl, U.
1995-01-01
Thorium concentrations in 11 native gold samples from different sources, e.g. placer gold, vein and lode gold were determined. Thorium was determined by radiochemical separation and measurement of protactinium from irradiated native gold samples. The chemical yield of the separation procedures is 90%. Other elements were measured by gamma-ray spectroscopy. The radiochemical separation procedures described in this work make accurate determination of Th concentrations in native gold at picogram concentrations possible. (orig.)
Pseudo-template synthesis of gold nanoparticles based on polyhydrosilanes
International Nuclear Information System (INIS)
Sacarescu, Liviu; Simionescu, Mihaela; Sacarescu, Gabriela
2011-01-01
Highly stable colloidal gold nanoparticles are obtained in a pseudo-template system using a specific polyhydrosilane copolymeric structure. This process takes place in situ by microwaves activation of the polymer solution in a non-polar solvent followed by stirring with solid HAuCl 4 in natural light. The experimental procedure is very simple and the resulted colloidal gold solution is indefinitely stable. The specific surface plasmon resonance absorption band of the gold nanoparticles is strongly red shifted and is strictly related to their size. AFM correlated with DLS analysis showed flattened round shaped colloidal polymer-gold nanoparticles with large diameters. SEM-EDX combined analysis reveals that the polysilane-gold nanoparticles show a natural tendency to auto-assemble in close packed structures which form large areas over the polymer film surface.
Nondestructive analysis of the gold quarter liras
International Nuclear Information System (INIS)
Cakir, C.; Guerol, A.; Demir, L.; Sahin, Y.
2009-01-01
In this study, we have prepared seven Au-Cu standards in the concentration range of 18-24 (as carat) for nondestructive control of gold quarter liras. Some calibration curves for quantitative analysis of Au in the gold quarter liras that commercially present in Turkey have been plotted using these standard samples. The characteristic X-rays of Au and Cu emitted from these standard samples and the test sample with known composition are recorded by using a Ge(Li) detector. These calibration curves provide a nondestructive analysis of gold quarter liras with the uncertainties about 1.18%. (author)
Effective Opacity for Gold-Doped Foam Plasmas
International Nuclear Information System (INIS)
Huang Cheng-Wu; Song Tian-Ming; Zhao Yang; Zhu Tuo; Shang Wan-Li; Xiong Gang; Zhang Ji-Yan; Yang Jia-Min; Jiang Shao-En
2012-01-01
Radiation flow through gold-doped hydrocarbon foam is investigated and a model is presented to calculate effective opacity for an inhomogeneous, pressure-equilibrated gold/foam mixture based on the Levermore—Pomraning method for binary stochastic media. The effective opacity dependance on the size of the gold particles and the foam temperature are studied. The results suggest that when the mixture temperature is lower than 250 eV, the opacity difference between the 5 μm particle mix case and the atomic mix case is large enough to induce a significant discrepancy in radiation transport, which is confirmed by the hydrodynamic simulation
Nuclear-technical applications in gold extraction metallurgy
International Nuclear Information System (INIS)
Smith, S.W.; De Jesus, A.S.M.
1986-01-01
Radioisotopes have been used for a number of years by the South African gold mining industry in a variety of measuring techniques, not only in conventional on-line process instrumentation, but also to investigate problem areas in extraction processes. These include, inter alia, tracer investigations on recirculating underground water, measurement of air ventilation rates in a mine, residence time measurements in milling and leaching circuits, and gold purity determinations. Applications of both sealed sources and radioactive tracer techniques are reviewed by means of examples of work done in South Africa, with pertinent reference to the benefits accruing to the gold mining industry
Biosynthesis of Gold Nanoparticles Using Pseudomonas Aeruginosa
International Nuclear Information System (INIS)
Abd El-Aziz, M.; Badr, Y.; Mahmoud, M. A.
2007-01-01
Pseudomonas aeruginosa were used for extracellular biosynthesis of gold nanoparticles (Au NPs). Consequently, Au NPs were formed due to reduction of gold ion by bacterial cell supernatant of P. aeruginos ATCC 90271, P. aeruginos (2) and P. aeruginos (1). The UV-Vis. and fluorescence spectra of the bacterial as well as chemical prepared Au NPs were recorded. Transmission electron microscopy (TEM) micrograph showed the formation of well-dispersed gold nanoparticles in the range of 15-30 nm. The process of reduction being extracellular and may lead to the development of an easy bioprocess for synthesis of Au NPs
Marrandi, Hiie
2006-01-01
Euroopa Kohtu eelotsusetaotluse alusel tehtud lahendist (12. 09. 2006 C-196/04) Cadbury Schweppes´i ja Suurbritannia maksuhalduri vaidluse kohta, mis puudutas madala maksumääraga territooriumil asuva tütarühingu tulu omistamist Suurbritannia emaühingule
Substoichiometric neutron activation determination of gold
International Nuclear Information System (INIS)
Mitchell, J.W.; Riley, J.E. Jr.; Payne, V.
1978-01-01
A highly precise and selective method is described for the determination of traces of gold by substoichiometric extraction from hydrochloric acid with tri-n-octylphosphine sulfide in cyclohexane following thermal neutron activation. Fundamental aspects of the extraction system are discussed and results are reported for the determination of gold in an effluent from a recovery process containing a complexed species of gold and unknown amounts of cyanide, citrate, phosphate, potassium and sodium. Other constituents of the effluent stream include traces of the transition elements Co, Ni, Fe, Cu, Zn, Pb and Sn at concentrations less than 50 ppm. One hour was allowed for the Au 3+ carrier and the 198 Au complexed species in samples and standards to oxidize, exchange, and reach chemical equilibrium. Samples were then equilibrated by shaking with the organic phase for thirty min. The percentage extractions (%E) for the substoichiometric separation of gold from the effluent and from the corresponding comparison standards were monitored. The mean percentage extractions for the substoichiometric separations of carrier from the effluent, and its corresponding standard were 75.3 and 59.3, respectively. These data are estimated to be accurate within +-2.0%. (T.G.)
Grafting of gold nanoparticles on polyethyleneterephthalate using dithiol interlayer
International Nuclear Information System (INIS)
Reznickova, A.; Kolska, Z.; Zaruba, K.; Svorcik, V.
2014-01-01
Two different procedures of grafting of polyethyleneterephthalate (PET), modified by plasma treatment, with gold nanoparticles (nanospheres) are studied. In the first procedure the PET foil was grafted with biphenyl-4,4′-dithiol and subsequently with gold nanoparticles. In the second one the PET foil was grafted with gold nanoparticles previously coated by the same dithiol. X-ray photoelectron spectroscopy, Fourier transform infrared spectroscopy and electrokinetic analysis were used for characterization of the polymer surface at different modification steps. Gold nanoparticles were characterized by ultraviolet–visible spectroscopy. The first procedure was found to be more effective. It was proved that the dithiol was chemically bonded to the surface of the plasma activated PET and it mediates subsequent grafting of the gold nanoparticles. - Highlights: • Two different techniques were used for coating of PET with gold nanoparticles. • Grafted GNPs were characterized by XPS, FTIR, UV–vis, zeta potential, AFM. • More effective coating is achieved by deposition of GNPs earlier grafted with thiol. • The studied structures may have potential application in electronics or biomedicine
Gold in Accessory Zircon (the Kozhim Massif, Subpolar Urals)
Denisova, Yuliya; Pystin, Aleksandr
2017-12-01
The crystals of zircon due to their resistance to external impact of various processes can reveal information about the environment of their formation and the inclusions observed of them. Zircon contains different mineral inclusions: biotite, plagioclase, quartz, apatite, etc. However, there is no information about gold inclusions in the zircons from granites of the Sudpolar Urals. The study results of the inclusions of gold in accessory zircon of the Kozhim granitic massif are presented in this paper. The studied mineral is a dark-brown translucent short-prismatic crystal containing the inclusion of gold and the allocations of quartz. According to studies, the inclusion of gold formed during the growth of zircon and it is the gold covered with a thin film of oxide gold. It was confirmed that the crystallization of the studied zircon occurred at a temperature of 800°C and above on the stage of formation of granites of Kozhim massif. The assumption is made about the additional temperature in the course of which was caused by decreasing of temperature up to 700° C and below during postmagmatic stage.
Study on gold concentrate leaching by iodine-iodide
Wang, Hai-xia; Sun, Chun-bao; Li, Shao-ying; Fu, Ping-feng; Song, Yu-guo; Li, Liang; Xie, Wen-qing
2013-04-01
Gold extraction by iodine-iodide solution is an effective and environment-friendly method. In this study, the method using iodine-iodide for gold leaching is proved feasible through thermodynamic calculation. At the same time, experiments on flotation gold concentrates were carried out and encouraging results were obtained. Through optimizing the technological conditions, the attained high gold leaching rate is more than 85%. The optimum process conditions at 25°C are shown as follows: the initial iodine concentration is 1.0%, the iodine-to-iodide mole ratio is 1:8, the solution pH value is 7, the liquid-to-solid mass ratio is 4:1, the leaching time is 4 h, the stirring intensity is 200 r/mim, and the hydrogen peroxide consumption is 1%.
Mechanism of the Transmetalation of Organosilanes to Gold
Falivene, Laura
2015-09-01
Density functional theory (DFT) calculations were carried out to study the reaction mechanism of the first transmetalation of organosilanes to gold as a cheap fluoride-free process. The versatile gold(I) complex [Au(OH)(IPr)] permits very straightforward access to a series of aryl-, vinyl-, and alkylgold silanolates by reaction with the appropriate silane reagent. These silanolate compounds are key intermediates in a fluoride-free process that results in the net transmetalation of organosilanes to gold, rather than the classic activation of silanes as silicates using external fluoride sources. However, here we propose that the gold silanolate is not the active species (as proposed during experimental studies) but is, in fact, a resting state during the transmetalation process, as a concerted step is preferred.
Mechanism of the Transmetalation of Organosilanes to Gold
Falivene, Laura; Nelson, David J.; Dupuy, Sté phanie; Nolan, Steven P.; Poater, Albert; Cavallo, Luigi
2015-01-01
Density functional theory (DFT) calculations were carried out to study the reaction mechanism of the first transmetalation of organosilanes to gold as a cheap fluoride-free process. The versatile gold(I) complex [Au(OH)(IPr)] permits very straightforward access to a series of aryl-, vinyl-, and alkylgold silanolates by reaction with the appropriate silane reagent. These silanolate compounds are key intermediates in a fluoride-free process that results in the net transmetalation of organosilanes to gold, rather than the classic activation of silanes as silicates using external fluoride sources. However, here we propose that the gold silanolate is not the active species (as proposed during experimental studies) but is, in fact, a resting state during the transmetalation process, as a concerted step is preferred.
Toraih, Eman A.; Ibrahiem, Afaf; Abdeldayem, Hala; Mohamed, Amany O.; Abdel-Daim, Mohamed M.
2017-01-01
Previous reports have suggested the significant association of miRNAs aberrant expression with tumor initiation, progression and metastasis in cancer, including gastrointestinal (GI) cancers. The current preliminary study aimed to evaluate the relative expression levels of miR-196a2 and three of its selected apoptosis-related targets; ANXA1, DFFA and PDCD4 in a sample of GI cancer patients. Quantitative real-time PCR for miR-196a2 and its selected mRNA targets, as well as immunohistochemical assay for annexin A1 protein expression were detected in 58 tissues with different GI cancer samples. In addition, correlation with the clinicopathological features and in silico network analysis of the selected molecular markers were analyzed. Stratified analyses by cancer site revealed elevated levels of miR-196a2 and low expression of the selected target genes. Annexin protein expression was positively correlated with its gene expression profile. In colorectal cancer, miR-196a over-expression was negatively correlated with annexin A1 protein expression (r = -0.738, p < 0.001), and both were indicators of unfavorable prognosis in terms of poor differentiation, larger tumor size, and advanced clinical stage. Taken together, aberrant expression of miR-196a2 and the selected apoptosis-related biomarkers might be involved in GI cancer development and progression and could have potential diagnostic and prognostic roles in these types of cancer; particularly colorectal cancer, provided the results experimentally validated and confirmed in larger multi-center studies. PMID:29091952
Nonlinear optical studies of single gold nanoparticles
Dijk, Meindert Alexander van
2007-01-01
Gold nanoparticles are spherical clusters of gold atoms, with diameters typically between 1 and 100 nanometers. The applications of these particles are rather diverse, from optical labels for biological experiments to data carrier for optical data storage. The goal of my project was to develop new
CSIR Research Space (South Africa)
Manzi, MSD
2013-11-01
Full Text Available The gold-bearing Upper Elsburg Reef clastic wedge (UER) in the South Deep gold mine in the Witwatersrand basin (South Africa) hosts the highly auriferous basal conglomerate known as the Elsburg Conglomerate (EC) reef. The reef is less than 20 m...
M.R.S. Boland (Melinde); A. Tsiachristas (Apostolos); A.L. Kruis (Annemarije); N.H. Chavannes (Nicolas); M.P.M.H. Rutten-van Mölken (Maureen)
2014-01-01
markdownabstract__Abstract__ Aims: To investigate the association of the GOLD ABCD groups classification with costs and health-related quality of life (HR-QoL) and to compare this with the GOLD 1234 grades classification that was primarily based on lung function only. Methods: In a
Silk fibroin/gold nanocrystals: a new example of biopolymer-based nanocomposites
Noinville, S.; Garnier, A.; Courty, A.
2017-05-01
The dispersion of nanoparticles in ordered polymer nanostructures can provide control over particle location and orientation, and pave the way for tailored nanomaterials that have enhanced mechanical, electrical, or optical properties. Here we used silk fibroin, a natural biopolymer, to embed gold nanocrystals (NCs), so as to obtain well-ordered structures such as nanowires and self-assembled triangular nanocomposites. Monodisperse gold NCs synthesized in organic media are mixed to silk fibroin and the obtained nanocomposites are characterized by UV-visible spectroscopy, transmission electron microscopy (TEM), scanning electron microscopy (FE-SEM), atomic force microscopy (AFM) and Infrared spectroscopy. The optical properties study of gold NCs and silk-gold nanocomposites shows that the Surface Plasmon band is blue shifted compared to gold NCs. The size and shape of NCs gold superlattices can be well controlled by the presence of silk fibroin giving nanowires and also self-assembled triangular nanocomposites as characterized by TEM, FE-SEM and AFM. The strong interaction between gold NCs and silk fibroin is also revealed by the conformation change of silk protein in presence of gold NCs, as shown by FTIR analysis. The formation of such ordered nanocomposites (gold NCs/silk fibroin) will provide new nanoplasmonic devices.
Eggshell membrane-templated porous gold membranes using nanoparticles as building blocks
International Nuclear Information System (INIS)
Ashraf, S.; Khalid, Z. M.; Hussain, I.
2013-01-01
Highly porous gold membrane-like structures are formed using eggshell membrane, as such and heat denatured, as a template and gold nanoparticles as building blocks. Gold nanoparticles were produced in-situ on the eggshell membranes without using additional reducing agents. The morphology and loading of gold nanoparticles can easily be controlled by adjusting the pH and thus the redox potential of eggshell membranes. Lower pH favored the formation of irregularly-shaped but dense gold macro/ nanocrystals whereas higher pH(8-9) favored the formation of fairly uniform but less dense gold nanoparticles onto the eggshell membranes. Heat treatment of eggshell membrane-gold nanoparticle composites formed at pH 8-9 led to the formation of highly porous membrane like gold while mimicking the original structure of eggshell membrane. All these materials have been thoroughly characterized using field emission scanning electron microscopy (FESEM), energy dispersive X-ray spectroscopy (EDX), and inductively coupled plasma - atomic emission spectroscopy (ISP-AES). These highly porous membrane-like gold materials may have potential applications in catalysis, biosensors, electrode materials, optically selective coatings, heat dissipation and biofiltration. (author)
Directing self-assembly of gold nanoparticles in diblock copolymer scaffold
Li, Qifang; He, Jinbo; Glogowski, Elizabeth; Emrick, Todd; Russell, Thomas
2007-03-01
A versatile hierarchical approach for directing self -assembly of gold nanostructures with size 2-3nm in diblock copolymer scaffolds is found. Diblock copolymer polystyrene-b-poly(2-vinylpyridine) (PS-b-P2VP) is used to form a regular scaffold of highly anisotropic, stripe-like domains, and controlled differential wetting by dichloromethane and thermal annealing guides gold nanoparticles with half hydrophilic ligand to aggregate selectively along the scaffold, producing highly organized metal nanostructures. In as-cast block-copolymer and gold nanoparticles thin films, micelle structure and gold nanoparticles random distribution on scaffold are typically observed. However, samples annealed in dichloromethane exhibit well-defined short-range ordered nanostructure with gold nanoparticles located at the interface of PS and P2VP nanoscale domain. After annealing at 170 C, the gold nanoparticles at interface migrated into the middle of P2VP phase and exhibited long-range ordered hierarchical structures. Synergistic interactions between the gold nanoparticles and the PS-b-P2VP caused an orientation of the microdomains normal to the film surface.
Gold-Based Medicine: A Paradigm Shift in Anti-Cancer Therapy?
Yeo, Chien Ing; Ooi, Kah Kooi; Tiekink, Edward R T
2018-06-11
A new era of metal-based drugs started in the 1960s, heralded by the discovery of potent platinum-based complexes, commencing with cisplatin [(H₃N)₂PtCl₂], which are effective anti-cancer chemotherapeutic drugs. While clinical applications of gold-based drugs largely relate to the treatment of rheumatoid arthritis, attention has turned to the investigation of the efficacy of gold(I) and gold(III) compounds for anti-cancer applications. This review article provides an account of the latest research conducted during the last decade or so on the development of gold compounds and their potential activities against several cancers as well as a summary of possible mechanisms of action/biological targets. The promising activities and increasing knowledge of gold-based drug metabolism ensures that continued efforts will be made to develop gold-based anti-cancer agents.
Large, R.R.; Danyushevsky, L.; Hollit, C.; Maslennikov, V.; Meffre, S.; Gilbert, S.; Bull, S.; Scott, R.; Emsbo, P.; Thomas, H.; Singh, B.; Foster, J.
2009-01-01
Laser ablation ICP-MS imaging of gold and other trace elements in pyrite from four different sediment- hosted gold-arsenic deposits has revealed two distinct episodes of gold enrichment in each deposit: an early synsedimentary stage where invisible gold is concentrated in arsenian diagenetic pyrite along with other trace elements, in particular, As, Ni, Pb, Zn, Ag, Mo, Te, V, and Se; and a later hydrothermal stage where gold forms as either free gold grains in cracks in overgrowth metamorphic and/or hydrothermal pyrite or as narrow gold- arsenic rims on the outermost parts of the overgrowth hydrothermal pyrite. Compared to the diagenetic pyrites, the hydrothermal pyrites are commonly depleted in Ni, V, Zn, Pb, and Ag with cyclic zones of Co, Ni, and As concentration. The outermost hydrothermal pyrite rims are either As-Au rich, as in moderate- to high- grade deposits such as Carlin and Bendigo, or Co-Ni rich and As-Au poor as in moderate- to low-grade deposits such as Sukhoi Log and Spanish Mountain. The early enrichment of gold in arsenic-bearing syngenetic to diagenetic pyrite, within black shale facies of sedimentary basins, is proposed as a critical requirement for the later development of Carlin-style and orogenic gold deposits in sedimentary environments. The best grade sediment-hosted deposits appear to have the gold climax event, toward the final stages of deformation-related hydrothermal pyrite growth and fluid flow. ?? 2009 Society of Economic Geologists, Inc.
Level Density In Interacting Boson-Fermion-Fermion Model (IBFFM) Of The Odd-Odd Nucleus 196Au
International Nuclear Information System (INIS)
Kabashi, Skender; Bekteshi, Sadik
2007-01-01
The level density of the odd-odd nucleus 196Au is investigated in the interacting boson-fermion-fermion model (IBFFM) which accounts for collectivity and complex interaction between quasiparticle and collective modes.The IBFFM total level density is fitted by Gaussian and its tail is also fitted by Bethe formula and constant temperature Fermi gas model
Recovery of gold from arsenopyrite concentrates by cyanidation-carbon adsorption
Energy Technology Data Exchange (ETDEWEB)
Heinen, H.J.; McClelland, G.E., Lindstrom, R.E.
1980-01-01
The Bureau of Mines, investigated a cyanidation-carbon adsorption technique for extracting gold from arsenopyrite concentrates. Agitation leach experiments were conducted on 85%-minus-35-mesh gravity concentrates containing 21.8 oz gold and 6.4 oz silver per ton. Results obtained in leaching the concentrates showed that 96.9% gold and 90.7% silver extraction could be achieved in 96 hours of agitation. Gold and silver were recovered from the resulting pregnant solution by exposure to granular activated carbon in a countercurrent system. Carbon loadings of 2556 oz of gold and 502 oz of silver per ton were achieved. These loadings are significantly higher than heretofore thought practical.
Spontaneous formation of gold nanostructures in aqueous microdroplets.
Lee, Jae Kyoo; Samanta, Devleena; Nam, Hong Gil; Zare, Richard N
2018-04-19
The synthesis of gold nanostructures has received widespread attention owing to many important applications. We report the accelerated synthesis of gold nanoparticles (AuNPs), as well as the reducing-agent-free and template-free synthesis of gold nanoparticles and nanowires in aerosol microdroplets. At first, the AuNP synthesis are carried out by fusing two aqueous microdroplet streams containing chloroauric acid and sodium borohydride. The AuNPs (~7 nm in diameter) are produced within 60 µs at the rate of 0.24 nm µs -1 . Compared to bulk solution, microdroplets enhance the size and the growth rate of AuNPs by factors of about 2.1 and 1.2 × 10 5 , respectively. Later, we find that gold nanoparticles and nanowires (~7 nm wide and >2000 nm long) are also formed in microdroplets in the absence of any added reducing agent, template, or externally applied charge. Thus, water microdroplets not only accelerate the synthesis of AuNPs by orders of magnitude, but they also cause spontaneous formation of gold nanostructures.
Extraction of gold and silver from geothermal fluid
Energy Technology Data Exchange (ETDEWEB)
Brown, K.L.; Roberts, P.J. (Geothermal Research Center, Wairakei (New Zealand); Spectrum Resources Ltd., Auckland (New Zealand))
1988-11-10
This paper describes the results of five experiments of the extraction of gold and silver from hydrothermal fluids with a experimental vessel settled up at KA35 well at the Kawerau geothermal field in New Zealand. The experimental vessel was designed to absorb the fluids from orifice plate controlled to be low pressure and had a chamber having within many collecting plates. The first experiment is a fundamental one in which a mild steel was used as metal collector plate. The rates of deposition of gold and silver on the plate were estimated. The second experiment showed that the rate on deposition of gold on the mild steel plate was controlled by the flux rate of hydrothermal fluid. The third experiment showed that a mild steel seemed to be better for the collection plate of gold and silver than copper and aluminium. The fourth experiment clarified that the activated charcoal was not suitable for the collector plate for gold and silver. The fifth experiment showed that a mild steel was better for metal collector than activated charcoal. 1 ref., 4 figs.
Flower-shaped gold nanoparticles: Preparation, characterization, and electro
Directory of Open Access Journals (Sweden)
Islam M. Al-Akraa
2017-09-01
Full Text Available The modification of a glassy carbon electrode with gold nanoparticles was pursued, characterized, and examined for electrocatalytic applications. The fabrication process of this electrode involved assembling the gold nanoparticles atop of amino group grafted glassy carbon electrode. The scanning electron microscopy indicated the deposition of gold nanoparticles in flower-shaped nanostructures with an average particle size of ca. 150 nm. Interestingly, the electrode exhibited outstanding enhancement in the electrocatalytic activity toward the oxygen evolution reaction, which reflected from the large negative shift (ca. 0.8 V in its onset potential, in comparison with that observed at the bulk unmodified glassy carbon and gold electrodes. Alternatively, the Tafel plot of the modified electrode revealed a significant increase (∼one order of magnitude in the apparent exchange current density of the oxygen evolution reaction upon the modification, which infers a faster charge transfer. Kinetically, gold nanoparticles are believed to facilitate a favorable adsorption of OH− (fundamental step in oxygen evolution reaction, which allows the charge transfer at reasonably lower anodic polarizations.
Mukherjee, R.; Venkatesh, A. S.; Fareeduddin, F.
2016-12-01
Bhukia is a unique gold prospect in terms of its host lithologies such as albitite and carbonates with respect to greenstone hosted Archean gold deposits from India. Tourmaline occurs along with apatite, magnetite, graphite, chalcopyrite and gold-sulfide association in Bhukia gold prospect preserve geochemical record of changing physico-chemical conditions during its growth. Tourmalinization is one of the distinct hydrothermal alterations present in the study area. Chemical composition of two varieties of tourmalines presents as significant amounts within albitite and carbonate rocks from Bhukia gold prospect. EPMA analysis of two varieties of tourmalines viz. 1) rounded to sub-rounded, euhedral, green colored tourmalines and 2) elongated, zoned, brown colored tourmalines unlocks their chemical compositions as well as variations from core to rim. In some albitite litho-units, tourmaline occurs as major constituents (>15%), present as layers, termed as tourmalinites. Al-Fe-Mg and Na/ (Na+Ca) vs Fe/ (Fe+Mg) suggests that tourmalines from the Bhukia gold prospect are Mg-rich dravite to Fe-rich schrol in composition. Tourmalines present within the albitite rocks show variations in iron and sodium content from core to rim whereas similarity exist from core to rim in case of carbonate rocks. Presence of albite confirms the role of Na-rich fluids during the formation of tourmalines. Tourmalines present in Bhukia gold prospect is mainly influenced by boron influx and the source may be boron bearing hydrothermal fluid or boron bearing minerals. Dewatering of original un-metamorphosed rock during progressive metamorphism may remove boron from the metasedimentary rocks. Due to the mobile nature of boron, it dispersed and mixed with hydrothermal fluids and alumina that is required for the formation of the tourmaline might have been leached from metasedimentary rocks present in Bhukia gold prospect. Presence of hydrothermal alterations such as tourmalinization and albitization
International Nuclear Information System (INIS)
Liang Liang; Zhong Zhiyun.
1988-01-01
Principal types of Precambrian uranium-gold deposits are follows: paleo-conglomerate uranium-deposit, stratified or strata-bound uranium-gold deposit, unconformity-related uranium deposit (no or seldem gold) and greenstone gold deposit. The main types of gold deposits in China is greenstone one which is characterized by later age, high grade metamorphism and a large time difference between diagenesis of host rocks and gold metallogenesis. Gold deposits are spatially distributed in the uplift area, whereas uranium deposits are distributed in the downfaulted belt. Furthermore, both uranium and gold deposits are controlled by regional fractures
Gold and arsenic concentrations in plants as an indication of gold mineralisation
International Nuclear Information System (INIS)
Girling, C.A.; Peterson, P.J.; Minski, M.J.
1978-01-01
A range of plant species growing on derelict gold mines and a lead-silver mine (background site) in Merionethshire, Wales, United Kingdom, was analysed simultaneously for Au and As by neutron activation analysis. The γ-emitting 198 Au and 76 As isotopes were determined in dried compact plant material following irradiation. Many plant species collected from the gold mines contained Au concentrations significantly above background values, but the extent of Au accumulation varied between and within species. Grasses, and herbs associated with the equatic environment contained the most Au, the highest value recorded was 95 ppb (dry weight) in the leaves of the grass Festuca rubra L. Species which contained high concentrations of Au also contained high concentrations of As. (Auth.)
International Nuclear Information System (INIS)
Nyarku, M.; Nyarko, B.J.B.; Serfor-Armah, Y.; Osae, S.
2010-01-01
Instrumental neutron activation analysis (INAA) has been used to quantify concentrations of arsenic (As), gold (Au) and antimony (Sb) in grain-size fractions of a gold ore. The ore, which was taken from the Ahafo project site of Newmont Ghana Gold Ltd., was fractionated into 14 grain-size fractions using state-of-the-art analytical sieve machine. The minimum sieve mesh size used was 36 μm and grains >2000 μm were not considered for analysis. Result of the sieving was analysed with easysieve (registered) software. The<36 μm subfraction was found to be the optimum, hosting bulk of all three elements. Arsenic was found to be highly concentrated in<36-100 μm size fractions and erratically distributed in from 150 μm fraction and above. For gold, with the exception of the subfraction <36 μm which had exceptionally high concentration, the element was found to be approximately equally distributed in all the size fractions but slightly 'played out' in 150-400 μm size fractions. Antimony occurrence in the sample was relatively high in <36 μm size fraction followed by 600, 800, 400 and 36 μm size fractions in that order. Gold content in the sample was comparatively far greater than arsenic and antimony; this is indicative of level of gold mineralization in the concession where the sample ore was taken. The concentration of gold in the composite sample was in the range 564-8420 ppm as compared to 14.33-186.92 ppm for arsenic and 1.09-9.48 ppm for antimony. Elemental concentrations were correlated with each other and with grain-size fractions and the relationships between these descriptive parameters were established.
Recovery of gold from electronic scrap by hydrometallurgical processes
Energy Technology Data Exchange (ETDEWEB)
Lee, Churl Kyoung; Rhee, Kang-In [Korea Institute of Geology Mining and Materials, Taejon (Korea, Republic of); Sohn, Hun Joon [Seoul National University, Seoul (Korea, Republic of)
1997-09-30
A series of processes has been developed to recover the gold from electronic scrap containing about 200{approx}600 ppm Au. First, mechanical beneficiation including shredding, crushing and screening was employed. Results showed that 99 percent of gold component leaves in the fraction of under 1 mm of crushed scrap and its concentration was enriched to about 800 ppm without incineration. The crushed scrap was leached in 50% aqua regia solution and gold was completely dissolved at 60 deg. C within 2 hours. Other valuable metals such as silver, copper, nickel and iron were also dissolved. The resulting solution was boiled to remove nitrous compounds in the leachate. Finally, a newly designed electrolyzer was tested to recover the gold metal. More than 99% of gold and silver were recovered within an hour by electrowinning process. (author). 10 refs., 5 tabs., 6 figs.
Emerging advances in nanomedicine with engineered gold nanostructures.
Webb, Joseph A; Bardhan, Rizia
2014-03-07
Gold nanostructures possess unique characteristics that enable their use as contrast agents, as therapeutic entities, and as scaffolds to adhere functional molecules, therapeutic cargo, and targeting ligands. Due to their ease of synthesis, straightforward surface functionalization, and non-toxicity, gold nanostructures have emerged as powerful nanoagents for cancer detection and treatment. This comprehensive review summarizes the progress made in nanomedicine with gold nanostructures (1) as probes for various bioimaging techniques including dark-field, one-photon and two-photon fluorescence, photothermal optical coherence tomography, photoacoustic tomography, positron emission tomography, and surface-enhanced Raman scattering based imaging, (2) as therapeutic components for photothermal therapy, gene and drug delivery, and radiofrequency ablation, and (3) as a theranostic platform to simultaneously achieve both cancer detection and treatment. Distinct from other published reviews, this article also discusses the recent advances of gold nanostructures as contrast agents and therapeutic actuators for inflammatory diseases including atherosclerotic plaque and arthritis. For each of the topics discussed above, the fundamental principles and progress made in the past five years are discussed. The review concludes with a detailed future outlook discussing the challenges in using gold nanostructures, cellular trafficking, and translational considerations that are imperative for rapid clinical viability of plasmonic nanostructures, as well as the significance of emerging technologies such as Fano resonant gold nanostructures in nanomedicine.
Goudafzettingen in Suriname (Gold deposits in Surinam)
Brinck, J.W.
1956-01-01
THE GOLD DEPOSITS IN SURINAM AND THE DISTRIBUTION OF CONCESSIONS THROUGH THE COUNTRY The fieldwork on the occurrence of primary and secondary gold deposits in Surinam on which this thesis is based was carried out by order of the Welfare Fund Surinam (Welvaarts Fonds Suriname) during the periods
Characterization and treatment of artisanal gold mine tailings
International Nuclear Information System (INIS)
Andrade Lima, L.R.P. de; Bernardez, L.A.; Barbosa, L.A.D.
2008-01-01
The solid waste generated by artisanal gold mining, with high mercury and gold contents, can be found in several areas in the South America. The present study focused on the tailings of an artisanal gold mine area located in the Brazilian northeastern. Samples of the mine tailings were taken and used to perform a physical and chemical characterization study using X-ray diffraction, scanning electron microscopy, neutron activation, X-ray fluorescence, induced coupled plasma-mass spectrometry, among others analytical methods. The results indicate that the material is composed mainly by quartz and goethite, the characteristic size of the particles (d 50 ) is about 150 μm, and the density is close of that of quartz. The main constituents are silicon, iron, and aluminum. The tailings gold content is of about 1.8 mg/kg and the mercury content is of about 10 mg/kg. A remarkable feature of this solid waste is that the gold and mercury are both concentrated in both the fine and the coarse particles, but not in particles of intermediary size. Leaching studies indicated that the tailings are stable in weak organic acids, but soluble in alkaline and aired cyanide solutions, in which 89% of gold and 100% of mercury are extracted in 24 h. Electroleaching experiments, performed using sodium chloride as electrolyte, indicated that mercury and gold are extracted simultaneously and the recovery of both metals can be as high as 70% in 4 h. In addition, chromium, nickel, and lead are found in relatively large amounts in the solution, which indicate an effectively action of the electroleaching method to clean up solid wastes contaminated with metals
DEFF Research Database (Denmark)
Jensen, Louise Helene Søgaard; Skjolding, Lars Michael; Thit, Amalie
2017-01-01
techniques are used to investigate internalization of 10 nm gold nanoparticles in Daphnia magna gut lumen and gut epithelial cells upon 24h exposure and outline potential artefacts, i.e. high contract precipitates from sample preparation related to these techniques. Light sheet microscopy confirmed...... accumulation of gold nanoparticles in the gut lumen. Scanning transmission electron microscopy and elemental analysis revealed gold nanoparticles attached to the microvilli of gut cells. Interestingly, the peritrophic membrane appeared to act as a semipermeable barrier between the lumen and the gut epithelium...
Directory of Open Access Journals (Sweden)
Elnaz Shaabani
2017-04-01
Full Text Available Objective(s: Biological applications of gold nanoparticles have limitations because of the toxic chemicals used in their synthesis. Curcumin can be used as reducing as well as capping agent in synthesis of GNPs to eliminate the cytotoxicity. Conjugation of curcumin to gold also helps in increasing its solubility and bioavailability. Materials and Methods: Here we report synthesis of gold nanoparticles coated with citrate and curcumin and of two different sizes via chemical routes. UV-Vis absorbance spectroscopy, Dynamic Light Scattering and Transmission Electron Microscopy were applied to study the average particle size, size stability of the samples and zeta potential. Fourier transform infrared, Raman Spectroscopy and Fluorescence Spectroscopy were applied for detection of curcumin on the surface of GNPs. The antioxidant activity was evaluated using DPPH assay and Cytotoxicity was evaluated by MTT assay.Results: Particles were synthesized of 6 and 16 nm size. The average particle size was found to be 21.7 ± 5.7 by TEM. The zeta potential on the surface of Cur-GNPs was negative and larger than 25 mV which is a sign of their high stability. The stability of these particles (with different coatings but with similar sizes at different time intervals (up to 3 months and also in different media like cell culture medium, different buffers, glucose and at different pH conditions have been investigated thoroughly. Appearance of functional groups assigned to curcumin in FTIR and SERS spectra are sign of presence of curcumin in the sample. The quenching of the fluorescence in the presence of GNPs reveals the clear indication of the capping and binding of curcumin with GNPs. Cur-GNP1 (16 nm were found to exhibit highest antioxidant activity than other gold nanoparticles. Cytotoxicity evaluation using MTT assay on L929 cell line proved curcumin coated gold nanoparticles were non-toxic up to 40 ppm.Conclusion: The results revealed that larger curcumin
International Nuclear Information System (INIS)
Viewing, K.
1983-01-01
Sulphur-isotope studies had been applied by Dr. I. Lambert to a number of deposits in Western Australia and also to certain samples from Vubachickwe and other deposits in Zimbabwe. A study of the sulphur isotopes at the Dickenson Mine, revealed a wide spread of values in the mineralised zones. Metamorphic processes were likely to be significant in the concentration of gold. The iron formations at the Old Jardine Mine had been unfolded by Dr. W.S. Hallager and the pattern of sedimentation was unraveled. A gold-rich zone was separated by a barren gap from the other part of the mineralised zone. Research was also done on the effects of the metamorphic processes, and the ages of mineralisation
De Greef, Yves; Dekker, Lukas; Boersma, Lucas; Murray, Stephen; Wieczorek, Marcus; Spitzer, Stefan G; Davidson, Neil; Furniss, Steve; Hocini, Mélèze; Geller, J Christoph; Csanádi, Zoltan
2016-05-01
This prospective, multicentre study (PRECISION GOLD) evaluated the incidence of asymptomatic cerebral embolism (ACE) after pulmonary vein isolation (PVI) using a new gold multi-electrode radiofrequency (RF) ablation catheter, pulmonary vein ablation catheter (PVAC) GOLD. Also, procedural efficiency of PVAC GOLD was compared with ERACE. The ERACE study demonstrated that a low incidence of ACE can be achieved with a platinum multi-electrode RF catheter (PVAC) combined with procedural manoeuvres to reduce emboli. A total of 51 patients with paroxysmal atrial fibrillation (AF) (age 57 ± 9 years, CHA2DS2-VASc score 1.4 ± 1.4) underwent AF ablation with PVAC GOLD. Continuous oral anticoagulation using vitamin K antagonists, submerged catheter introduction, and heparinization (ACT ≥ 350 s prior to ablation) were applied. Cerebral magnetic resonance imaging (MRI) scans were performed within 48 h before and 16-72 h post-ablation. Cognitive function assessed by the Mini-Mental State Exam at baseline and 30 days post-ablation. New post-procedural ACE occurred in only 1 of 48 patients (2.1%) and was not detectable on MRI after 30 days. The average number of RF applications per patient to achieve PVI was lower in PRECISION GOLD (20.3 ± 10.0) than in ERACE (28.8 ± 16.1; P = 0.001). Further, PVAC GOLD ablations resulted in significantly fewer low-power (GOLD in combination with established embolic lowering manoeuvres results in a low incidence of ACE. Pulmonary vein ablation catheter GOLD demonstrates improved biophysical efficiency compared with platinum PVAC. ClinicalTrials.gov NCT01767558. © The Author 2016. Published by Oxford University Press on behalf of the European Society of Cardiology.
Synthesis of gold nanoparticles with graphene oxide.
Wang, Wenshuo; He, Dawei; Zhang, Xiqing; Duan, Jiahua; Wu, Hongpeng; Xu, Haiteng; Wang, Yongsheng
2014-05-01
Single sheets of functionalized graphene oxide are derived through chemical exfoliation of natural flake graphite. We present an effective synthetic method of graphene-gold nanoparticles hybrid nanocomposites. AFM (Atomic Force Microscope) was used to measure the thickness of the individual GO nanosheet. FTIR (Fourier transform infrared) spectroscopy was used to verify the attachment of oxygen functionalities on the surface of graphene oxide. TEM (Transmission Electron Microscope) data revealed the average diameters of the gold colloids and characterized the composite particles situation. Absorption spectroscopy showed that before and after synthesis the gold particle size did not change. Our studies indicate that the hybrid is potential substrates for catalysts and biosensors.
Microbial deposition of gold nanoparticles by the metal-reducing bacterium Shewanella algae
International Nuclear Information System (INIS)
Konishi, Y.; Tsukiyama, T.; Tachimi, T.; Saitoh, N.; Nomura, T.; Nagamine, S.
2007-01-01
Microbial reduction and deposition of gold nanoparticles was achieved at 25 deg. C over the pH range 2.0-7.0 using the mesophilic bacterium Shewanella algae in the presence of H 2 as the electron donor. The reductive deposition of gold by the resting cells of S. algae was a fast process: 1 mM AuCl 4 - ions were completely reduced to elemental gold within 30 min. At a solution pH of 7, gold nanoparticles 10-20 nm in size were deposited in the periplasmic space of S. algae cells. At pH 2.8, gold nanoparticles 15-200 nm in size were deposited on the bacterial cells, and the biogenic nanoparticles exhibited a variety of shapes that included nanotriangles: in particular, single crystalline gold nanotriangles 100-200 nm in size were microbially deposited. At a solution pH of 2.0, gold nanoparticles about 20 nm in size were deposited intracellularly, and larger gold particles approximately 350 nm in size were deposited extracellularly. The solution pH was an important factor in controlling the morphology of the biogenic gold particles and the location of gold deposition. Microbial deposition of gold nanoparticles is potentially attractive as an environmentally friendly alternative to conventional methods
Directory of Open Access Journals (Sweden)
Ali Kamiar
2013-08-01
Full Text Available Purpose: The aim of the present study was preparation, physicochemical characterization and performance evaluation of gold nanoparticles (GNPs in radiotherapy. Another objective was the investigation of anti-bacterial efficacy of gold nanoparticle against E. coli clinical strains. Methods: Gold nanoparticles prepared by controlled reduction of an aqueous HAuCl4 solution using Tri sodium citrate. Particle size analysis and Transmission electron microscopy were used for physicochemical characterization. Polymer gel dosimetry was used for evaluation of the enhancement of absorbed dose. Diffusion method in agar media was used for investigation of anti-bacterial effect. Results: Gold nanoparticles synthesized in size range from 57 nm to 346 nm by planning different formulation. Gold nanoparticle in 57 nm size increased radiation dose effectiveness with the magnitude of about 21 %. At the concentration of 400 ppm, Nano gold exhibited significant anti-bacterial effect against E. coli clinical strains. Conclusion: It is concluded that gold nanoparticles can be applied as dose enhancer in radiotherapy. The Investigation of anti-bacterial efficacy showed that gold nanoparticle had significant effect against E. coli clinical strains.
Ernawati, Rika; Idrus, Arifudin; TBMP, Himawan
2017-06-01
Lamuntet is one of gold ore mining area carried out by the Artisanal Small scale Gold Mining (ASGM) located in West Sumbawa, Indonesia. Most of the miners at this area are not the local miners but also those from other regions. Mineralization of this area is strong identified as low sulfidation epithermal system. There are two blocks of this mining location, namely, Ngelampar block with an area of 0.164 km2 and Song block with an area of 0.067 km2. This study was focused on Ngelampar block. The characteristic of epithermal system is the existence of quartz vein with comb, vuggy, and sugary texture. The aim of this research was to analyze the gold grade and other metals, such as Cu, Ag, Pb, As, Zn, and Hg. The research methods included literature study from previous researches, field work, laboratory work, and interpretation. The literature study was performed on previous researches with similar study area. The field work comprised of direct observation and sampling. Fieldwork was done for a week to obtain gold ore/vein. Sixteen samples were analyzed to obtain the grade of ore/metal. The Hg laboratory analysis was then performed on the six samples with the highest gold grade. Laboratory works were conducted at Intertek Jakarta by using Fire Assay (FA) for gold grade and Atomic Absorption Spectrophotometry (AAS) for Cu, Ag, Pb, As, Zn, and Hg. Results of the analysis showed the range of Au was grade (0.1 ppm - 27.8 ppm), Cu was 26 ppm -1740 ppm, Pb was 101 ppm- >4000 ppm, Zn of 73 ppm- >10,000 ppm, Ag of 3 ppm -185 ppm, As was 150 ppm-6530 ppm, and Hg of 0.08 ppm - 1.89 ppm. L1 and L15 had high grade for all values (Au, Ag, Zn, Cu, As, and Hg). Gold mineralization was formed as electrum because of Ag content is higher than 20%. Associated minerals of the samples in the study area were galena, sphalerite, arsenopyrite, and chalcopyrite which showed the characteristic of rich base metal of Pb, Zn, and Cu at LS epithermal.
Extraction of gold (Au) particles from sea water by Delftia Acidovorans microbes
Yusoff, A. H. M.; Nading, M. E.; Salimi, M. N.
2017-10-01
Gold-mining activities have been an issue, especially when it involves in contamination of chemicals, for example arsenic and mercury. However, despite of these hazards, gold-mining activities are still being conducted. This is because the gold is worth, regardless of the problems. Gold-mining, as known needs a very large area of land, or site plant. Vast amount of labor force, mechanical force and fund are a must in order for the mining process to be continued. High demand of gold, made gold-mining industries as ones of the most profitable industries in the world. Thus, this has encouraged another alternative way to extract gold. At the mining site, researchers found that biomineralization of gold by Delftia acidovorans can be conducted. How it is done still cannot be understood. It is said that the bacteria secretes secondary metabolites, Delftibactin as a defensive mechanism against the toxicity of the soluble gold. Researchers try to find another source of elemental gold besides of the earth’s core. The options are either lava of a volcano or ocean. Here, the focus is seawater. The problem of seawater is that its composition still not yet to be proved. Dissolve gold existed as gold chloride in seawater, but in a very small amount. So, the gold separation should be focused, in order to make this process to be a successful one. Factors such as depth, climate, region, temperature need to be considered. If this difference affecting the separating process, standardized seawater composition have to be proposed.
Ion induced segregation in gold nanostructured thin films on silicon
International Nuclear Information System (INIS)
Ghatak, J.; Satyam, P.V.
2008-01-01
We report a direct observation of segregation of gold atoms to the near surface regime due to 1.5 MeV Au 2+ ion impact on isolated gold nanostructures deposited on silicon. Irradiation at fluences of 6 x 10 13 , 1 x 10 14 and 5 x 10 14 ions cm -2 at a high beam flux of 6.3 x 10 12 ions cm -2 s -1 show a maximum transported distance of gold atoms into the silicon substrate to be 60, 45 and 23 nm, respectively. At a lower fluence (6 x 10 13 ions cm -2 ) transport has been found to be associated with the formation of gold silicide (Au 5 Si 2 ). At a high fluence value of 5 x 10 14 ions cm -2 , disassociation of gold silicide and out-diffusion lead to the segregation of gold to defect - rich surface and interface regions.
Strain study of gold nanomaterials as HR-TEM calibration standard.
Peng, X Y; Zhou, L Q; Li, X; Tao, X F; Ren, L L; Cao, W H; Xu, G F
2015-12-01
This work presents the use of high resolution electron microscopy (HREM) and geometric phase analysis (GPA) to measure the interplanar spacing and strain distribution of three gold nanomaterials, respectively. The results showed that the {111} strain was smaller than the {002} strain for any kind of gold materials at the condition of same measuring method. The 0.65% of {111} strain in gold film measured by HREM (0.26% measured by GPA) was smaller than the {111} strains in two gold particles. The presence of lattice strain was interpreted according to the growth mechanism of metallic thin film. It is deduced that the {111} interplanar spacing of the gold thin film is suitable for high magnification calibration of transmission electron microscopy (TEM) and the gold film is potential to be a new calibration standard of TEM. Copyright © 2015 Elsevier Ltd. All rights reserved.
An application of gold diffusion for defect investigation in silicon
International Nuclear Information System (INIS)
Feklisova, O.V.; Yakimov, E.B.
2009-01-01
The application of gold diffusion for defect investigation in Si is illustrated by the diffusion experiments carried out on crystals containing grown-in or specially introduced defects. The efficiency of gold diffusion experiments for monitoring the concentration and spatial distribution of these defects is shown. The effect of vacancy type defects on gold diffusion is illustrated by investigations of nitrogen-doped FZ Si and of Cz Si after rapid thermal annealing. In both these cases the gold depth profile is distinctive for trap limited diffusion. The effect of sinks for self-interstitials on gold diffusion is illustrated by the results obtained on the plastically deformed Si. It is shown that in silicon deformed at relatively low temperatures the gold diffusion is to a great extent determined by the defects in the dislocation trails while in high temperature deformed Si the sinks for self-interstitials are associated with dislocations themselves.
Uranium extraction from gold-uranium ores
Energy Technology Data Exchange (ETDEWEB)
Laskorin, B.N.; Golynko, Z.Sh.
1981-01-01
The process of uranium extraction from gold-uranium ores in the South Africa is considered. Flowsheets of reprocessing gold-uranium conglomerates, pile processing and uranium extraction from the ores are presented. Continuous counter flow ion-exchange process of uranium extraction using strong-active or weak-active resins is noted to be the most perspective and economical one. The ion-exchange uranium separation with the succeeding extraction is also the perspective one.
Biological and Geochemical Development of Placer Gold Deposits at Rich Hill, Arizona, USA
Directory of Open Access Journals (Sweden)
Erik B. Melchiorre
2018-02-01
Full Text Available Placer gold from the Devils Nest deposits at Rich Hill, Arizona, USA, was studied using a range of micro-analytical and microbiological techniques to assess if differences in (paleo-environmental conditions of three stratigraphically-adjacent placer units are recorded by the gold particles themselves. High-angle basin and range faulting at 5–17 Ma produced a shallow basin that preserved three placer units. The stratigraphically-oldest unit is thin gold-rich gravel within bedrock gravity traps, hosting elongated and flattened placer gold particles coated with manganese-, iron-, barium- (Mn-Fe-Ba oxide crusts. These crusts host abundant nano-particulate and microcrystalline secondary gold, as well as thick biomats. Gold surfaces display unusual plumate-dendritic structures of putative secondary gold. A new micro-aerophilic Betaproteobacterium, identified as a strain of Comamonas testosteroni, was isolated from these biomats. Significantly, this ‘black’ placer gold is the radiogenically youngest of the gold from the three placer units. The middle unit has well-rounded gold nuggets with deep chemical weathering rims, which likely recorded chemical weathering during a wetter period in Arizona’s history. Biomats, nano-particulate gold and secondary gold growths were not observed here. The uppermost unit is a pulse placer deposited by debris flows during a recent drier period. Deep cracks and pits in the rough and angular gold from this unit host biomats and nano-particulate gold. During this late arid period, and continuing to the present, microbial communities established within the wet, oxygen-poor bedrock traps of the lowermost placer unit, which resulted in biological modification of placer gold chemistry, and production of Mn-Fe-Ba oxide biomats, which have coated and cemented both gold and sediments. Similarly, deep cracks and pits in gold from the uppermost unit provided a moist and sheltered micro-environment for additional gold
pH induced protein-scaffold biosynthesis of tunable shape gold nanoparticles
International Nuclear Information System (INIS)
Zhang Xiaorong; He Xiaoxiao; Wang Kemin; Ren Fang; Qin Zhihe
2011-01-01
In this paper, a pH-inductive protein-scaffold biosynthesis of shape-tunable crystalline gold nanoparticles at room temperature has been developed. By simple manipulation of the reaction solution's pH, anisotropic gold nanoparticles including spheres, triangles and cubes could be produced by incubating an aqueous solution of sodium tetrachloroaurate with Dolichomitriopsis diversiformis biomasses after immersion in ultrapure Millipore water overnight. A moss protein with molecular weight of about 71 kDa and pI of 4.9 was the primary biomolecule involved in the biosynthesis of gold nanoparticles. The secondary configuration of the proteins by CD spectrum implied that the moss protein could display different secondary configurations including random coil, α-helix and intermediate conformations between random coil and α-helix for the experimental pH solution. The growth process of gold nanoparticles further showed that the moss protein with different configurations provided the template scaffold for the shape-controlled biosynthesis of gold nanoparticles. The constrained shape of the gold nanoparticles, however, disappeared in boiled moss extract. The gold nanoparticles with designed morphology were successfully reconstructed using the moss protein purified from the gold nanoparticles. Structural characterizations by SEM, TEM and SAED showed that the triangular and cubic gold nanoparticles were single crystalline.
Radiation-enhanced thermal processes during implantation of gold into copper
Energy Technology Data Exchange (ETDEWEB)
Perret, N.E.; King, B.V.; Dastoor, P.C. [Newcastle Univ., NSW (Australia). Dept. of Physics
1996-12-31
A copper (100) single crystal has been implanted with gold ions at temperatures ranging from 133 K to 673 K. Rutherford Backscattering Spectroscopy (RBS) has been used to observe the changes in the gold implant distribution that occur as a function of the sample temperature during implantation. Two distinct effects have been observed. Firstly the gold implant distribution, as a function of depth, broadens with sample temperature. This broadening of the gold depth profile is most marked at temperatures above 473 K. Secondly, the gold is implanted deeper into the copper crystal as the sample temperature is increased. These results are discussed in terms of radiation enhanced diffusion and radiation-induced segregation processes. 10 refs., 3 figs.
Radiation-enhanced thermal processes during implantation of gold into copper
Energy Technology Data Exchange (ETDEWEB)
Perret, N E; King, B V; Dastoor, P C [Newcastle Univ., NSW (Australia). Dept. of Physics
1997-12-31
A copper (100) single crystal has been implanted with gold ions at temperatures ranging from 133 K to 673 K. Rutherford Backscattering Spectroscopy (RBS) has been used to observe the changes in the gold implant distribution that occur as a function of the sample temperature during implantation. Two distinct effects have been observed. Firstly the gold implant distribution, as a function of depth, broadens with sample temperature. This broadening of the gold depth profile is most marked at temperatures above 473 K. Secondly, the gold is implanted deeper into the copper crystal as the sample temperature is increased. These results are discussed in terms of radiation enhanced diffusion and radiation-induced segregation processes. 10 refs., 3 figs.
Radiation-enhanced thermal processes during implantation of gold into copper
International Nuclear Information System (INIS)
Perret, N.E.; King, B.V.; Dastoor, P.C.
1996-01-01
A copper (100) single crystal has been implanted with gold ions at temperatures ranging from 133 K to 673 K. Rutherford Backscattering Spectroscopy (RBS) has been used to observe the changes in the gold implant distribution that occur as a function of the sample temperature during implantation. Two distinct effects have been observed. Firstly the gold implant distribution, as a function of depth, broadens with sample temperature. This broadening of the gold depth profile is most marked at temperatures above 473 K. Secondly, the gold is implanted deeper into the copper crystal as the sample temperature is increased. These results are discussed in terms of radiation enhanced diffusion and radiation-induced segregation processes. 10 refs., 3 figs
Authentication of gold products by nuclear methods
International Nuclear Information System (INIS)
De Jesus, A.S.M.
1985-01-01
The falsification of valuable gold items is a threat to the authenticity of gold products. To solve this, there is a continuous search for reliable, practicle and cost-effective means of identifying forgeries. Because nuclear techniques as applied to elemental analysis have a high degree of specificity, are non-destructive and permit the availability of results within a relatively short time, a few of these techniques were investigated and reviewed in the article. Work on some promising methods in the author's laboratory is also discussed. Constraints such as those imposed by the time taken by the measurement, negligible residual activity within a relatively short time were also considered. The techniques that were investigated include: the transmission of electromagnetic radiation through a medium; scattering of electromagnetic radiation; x-ray fluorescence analysis; neutron activation analysis; activation by the inelastic scattering of gamma radiation; activation by the inelastic scattering of fast neutrons; absorption and scattering of fast neutrons; self-attenuation of gamma radiation. The shape of the object being investigated, should also be considered. It is concluded that a system based on the inelastic scattering of neutrons emitted by a 241 Am/Be source (halflife = 433 years) is practical and capable of authenticating gold and gold alloy coins such as Krugerrands. The feasibility study on the assaying of gold jewelry by means of nuclear methods also showed it to be impractical
Growth of pentacene on clean and modified gold surfaces
International Nuclear Information System (INIS)
Kaefer, Daniel; Ruppel, Lars; Witte, Gregor
2007-01-01
The growth and evolution of pentacene films on gold substrates have been studied. By combining complementary techniques including scanning tunneling microscopy, atomic force microscopy, scanning electron microscopy, near-edge x-ray-absorption fine structure, and x-ray diffraction, the molecular orientation, crystalline structure, and morphology of the organic films were characterized as a function of film thickness and growth parameters (temperature and rate) for different gold substrates ranging from Au(111) single crystals to polycrystalline gold. Moreover, the influence of precoating the various gold substrates with self-assembled monolayers (SAM's) of organothiols with different chemical terminations has been studied. On bare gold the growth of pentacene films is characterized by a pronounced dewetting while the molecular orientation within the resulting crystalline three-dimensional islands depends distinctly on the roughness and cleanliness of the substrate surface. After completion of the first wetting layer where molecules adopt a planar orientation parallel to the surface the molecules continue to grow in a tilted fashion: on Au(111) the long molecular axis is oriented parallel to the surface while on polycrystalline gold it is upstanding oriented and thus parallels the crystalline orientation of pentacene films grown on SiO 2 . On SAM pretreated gold substrates the formation of a wetting layer is effectively suppressed and pentacene grows in a quasi-layer-by-layer fashion with an upstanding orientation leading to rather smooth films. The latter growth mode is observed independently of the chemical termination of the SAM's and the roughness of the gold substrate. Possible reasons for the different growth mechanism as well as consequences for the assignment of spectroscopic data of thin pentacene film are discussed
Adsorption of gold (III) from aqueous solutions on bagasse ash
International Nuclear Information System (INIS)
Hussain, G.; Khan, M.A.
2011-01-01
To assess the potential of cheap biomass materials for the recovery of gold from industrial, and electroplating waste water effluents, adsorption of gold (III) from dilute solutions of hydrochloric acid on bagasse ash has been studied under various experimental conditions by using batch technique. Percentage extraction of gold (III) on bagasse ash was determined from its distribution coefficients as a function of contact time, pH, adsorbent, adsorbate concentrations, and temperature. The uptake of gold (III) by bagasse ash is time, pH, metal concentration, amount of adsorbate, and temperature dependent. Adsorption data have been interpreted in terms of Langmuir, and the Freundlich equations. Thermodynamic parameters for the adsorption of gold (III) on bagasse ash have been determined at three different temperatures. The positive value of heat of adsorption; delta H 44.52 kJ/mol shows that the adsorption of gold (III) on bagasse ash is endothermic where as the negative value of delta G = -0.5303 kJ/mol at 318 K shows the spontaneity of the process. Delta G becomes more negative with increase in temperature which shows that the adsorption is more favorable at higher temperatures. Under the optimal adsorption conditions the adsorption capacity of gold is 0.70 mg /g of the adsorbent out of which 0.65 mg of gold gets desorbed with 0.1 % thiourea solution. (author)
Catalase coupled gold nanoparticles: Comparison between carbodiimide and biotin-streptavidin methods
Chirra, Hariharasudhan D.; Sexton, Travis; Biswal, Dipti; Hersh, Louis B.; Hilt, J. Zach
2011-01-01
The use of proteins for therapeutic applications requires the protein to maintain sufficient activity for the period of in vivo treatment. Many proteins exhibit a short half-life in vivo and, thus, require delivery systems for them to be applied as therapeutics. The relative biocompatibility and the ability to form functionalized bioconjugates via simple chemistry make gold nanoparticles excellent candidates as protein delivery systems. Herein, two protocols for coupling proteins to gold nanoparticles were compared. In the first, the strong biomolecular binding between biotin and streptavidin was used to couple catalase to the surface of gold nanoparticles. In the second protocol, the formation of an amide bond between carboxylic acid coated gold nanoparticles and free surface amines of catalase using carbodiimide chemistry was performed. The stability and kinetics of the different steps involved in these protocols were studied using UV-Visible spectroscopy, dynamic light scattering, and transmission electron microscopy. The addition of mercaptoundecanoic acid in conjugation with (N-(6-(biotinamido)hexyl)-3′-(2′-pyridyldithio)-propionamide increased the stability of biotinylated gold nanoparticles. Although the carbodiimide chemistry based bioconjugation approach exhibited a decrease in catalase activity, the carbodiimide chemistry based bioconjugation approach resulted in more active catalase per gold nanoparticle compared to that of mercaptoundecanoic acid stabilized biotinylated gold nanoparticles. Both coupling protocols resulted in gold nanoparticles loaded with active catalase. Thus, these gold nanoparticle systems and coupling protocols represent promising methods for the application of gold nanoparticles for protein delivery. PMID:21232642
One-step synthesis of gold bimetallic nanoparticles with various metal-compositions
International Nuclear Information System (INIS)
Bratescu, Maria Antoaneta; Takai, Osamu; Saito, Nagahiro
2013-01-01
Highlights: ► Synthesis of bimetallic nanoparticles in an aqueous solution discharge. ► Alloying gold with divalent sp metals, trivalent sp metals, 3d or 4d metals. ► Formation mechanism of bimetallic nanoparticles by metal reduction and gold erosion. ► Blue and red shift of surface plasmon resonance. -- Abstract: A rapid, one-step process for the synthesis of bimetallic nanoparticles by simultaneous metal reduction and gold erosion in an aqueous solution discharge was investigated. Gold bimetallic nanoparticles were obtained by alloying gold with various types of metals belonging to one of the following categories: divalent sp metals, trivalent sp metals, 3d or 4d metals. The composition of the various gold bimetallic nanoparticles obtained depends on electrochemical factors, charge transfer between gold and other metal, and initial concentration of metal in solution. Transmission electron microscopy and energy dispersive spectroscopy show that the gold bimetallic nanoparticles were of mixed pattern, with sizes of between 5 and 20 nm. A red-shift of the surface plasmon resonance band in the case of the bimetallic nanoparticles Au–Fe, Au–Ga, and Au–In, and a blue-shift of the plasmon band of the Au–Ag nanoparticles was observed. In addition, the interaction of gold bimetallic nanoparticles with unpaired electrons, provided by a stable free radical molecule, was highest for those NPs obtained by alloying gold with a 3d metal
Diverse Near-Infrared Resonant Gold Nanostructures for Biomedical Applications
Huang, Jianfeng
2015-12-08
The ability of near-infrared (NIR) light to penetrate tissues deeply and to target malignant sites with high specificity via precise temporal and spatial control of light illumination makes it useful for diagnosing and treating diseases. Owing to their unique biocompatibility, surface chemistry and optical properties, gold nanostructures offer advantages as in vivo NIR photosensitizers. This chapter describes the recent progress in the varied use of NIR-resonant gold nanostructures for NIR-light-mediated diagnostic and therapeutic applications. We begin by describing the unique biological, chemical and physical properties of gold nanostructures that make them excellent candidates for biomedical applications. From here, we make an account of the basic principles involved in the diagnostic and therapeutic applications where gold nanostructures have set foot. Finally, we review recent developments in the fabrication and use of diverse NIR-resonant gold nanostructures for cancer imaging and cancer therapy.
Plasmonic properties of gold-coated nanoporous anodic alumina ...
Indian Academy of Sciences (India)
gold-coated NAA is strongly quenched due to the strong plasmonic coupling. Keywords. Plasmon ... When coated by a thin film of gold, these templates can support surface plasmon resonance. ... 2.2 Equipment for characterization. Surface ...
International Nuclear Information System (INIS)
Neumayr, P.; Hagemann, S.G.; Groves, D.I.
1999-01-01
Full text: Large to giant (>1t) gold deposits are typically hosted in second- and third-order structures adjacent to largely barren, transcrustal fault zones. Gold-bearing hydrothermal fluids have been channelled within the transcrustal fault zones from mantle and deep crustal sources into the second- and third-order structures, where gold has been deposited. Transcrustal fault zones are long-lived structures with specific deformation events relating to gold deposition in the second- and third-order structures. For example the Archaean Perseverance Fault in the Yilgarn Craton of Western Australia evolved from a wide (5km) ductile shear zone during D2 to a narrow ( 2 -CH 4 -dominated compositions with minor H 2 O and H 2 S components, whereas there are H 2 O-dominated H 2 O-CO 2 +CH 4 fluids with a significant H 2 S component in the second- and third-order shear zones at the Sigma gold deposit, a major gold deposit 5km to the north of the CTZ. These differences can be explained by continuous phase separation, with CO 2 -vapour escape into the upper portions of the ductile uncapped CTZ, contrasting with in-situ phase separation of the gold-bearing fluids in crack-seal veins in the second-order shear zones at Sigma, with trapping of both the episodic vapour and liquid components in individual sealed veins. Gold mineralization in the second- and third-order structures appears to be controlled by the high H 2 S activity of the aqueous hydrothermal fluids. because gold was likely carried in a bisulphide complex and was deposited during sulfidation reactions in the wallrock and phase separation in the quartz vein. In contrast, the carbonic fluids in the CTZ lacked the ability to carry significant metal ligands due to their low H 2 S activity. Oxygen isotopes from hydrothermal quartz within the CTZ (13.3 to 15.6 per mil, av. 14.0 per mil; VSMOW) are heavier than those from mineralized quartz veins in second- and third-order shear zones (11.8 to 19.6 per mil, av. 12.2 per
Directory of Open Access Journals (Sweden)
Linhai Biao
2018-01-01
Full Text Available Green synthesis of gold nanoparticles using plant extracts is one of the more promising approaches for obtaining environmentally friendly nanomaterials for biological applications and environmental remediation. In this study, proanthocyanidins-functionalized gold nanoparticles were synthesized via a hydrothermal method. The obtained gold nanoparticles were characterized by ultraviolet and visible spectrophotometry (UV-Vis, Fourier transform infrared spectroscopy (FTIR, transmission electron microscopy (TEM and X-ray diffraction (XRD measurements. UV-Vis and FTIR results indicated that the obtained products were mainly spherical in shape, and that the phenolic hydroxyl of proanthocyanidins had strong interactions with the gold surface. TEM and XRD determination revealed that the synthesized gold nanoparticles had a highly crystalline structure and good monodispersity. The application of proanthocyanidins-functionalized gold nanoparticles for the removal of dyes and heavy metal ions Ni2+, Cu2+, Cd2+ and Pb2+ in an aqueous solution was investigated. The primary results indicate that proanthocyanidins-functionalized gold nanoparticles had high removal rates for the heavy metal ions and dye, which implies that they have potential applications as a new kind of adsorbent for the removal of contaminants in aqueous solution.
Directory of Open Access Journals (Sweden)
Jing Guo
Full Text Available BACKGROUND: MicroRNAs (miRNAs negatively regulate the gene expression and act as tumor suppressors or oncogenes in oncogenesis. The association between single nucleotide polymorphism (SNP in miR-196a2 rs11614913 and the susceptibility of digestive system cancers was inconsistent in previous studies. METHODOLOGY/PRINCIPAL FINDINGS: An updated meta-analysis based on 15 independent case-control studies consisting of 4999 cancer patients and 7606 controls was performed to address this association. It was found that miR-196a2 polymorphism significantly elevated the risks of digestive system cancers (CT vs. TT, OR = 1.25, 95% CI = 1.07-1.45; CC vs. TT, OR = 1.38, 95% CI = 1.13-1.67; CC/CT vs. TT, OR = 1.29, 95% CI = 1.10-1.50; CC vs. CT/TT, OR = 1.14, 95% CI = 1.01-1.30; C vs. T, OR = 1.15, 95% CI = 1.05-1.26. We also found that variant in miR-196a2 increased the susceptibility of colorectal cancer (CRC (CT vs. TT, OR = 1.23, 95% CI = 1.04-1.44; CC vs. TT, OR = 1.32, 95% CI = 1.08-1.61; CC/CT vs. TT, OR = 1.25, 95% CI = 1.07-1.46; C vs. T, OR = 1.15, 95% CI = 1.05-1.28, while the association in recessive model (CC vs. CT/TT, OR = 1.16, 95% CI = 0.98-1.38 showed a marginal significance. Additionally, significant association between miR-196a2 polymorphism and increased risk of hepatocellular cancer (HCC was detected. By stratifying tumors on the basis of site of origin, source of controls, ethnicity and allele frequency in controls, elevated cancer risks were observed. CONCLUSION/SIGNIFICANCE: Our findings suggest the significant association between miR-196a2 polymorphism and increased susceptibility of digestive system cancers, especially of CRC, HCC and Asians. Besides, C allele may contribute to increased digestive cancer risks.
Gold deposits in the western sector of the Central Spanish System
International Nuclear Information System (INIS)
Barrios, S.; Florido, P.; Reguilon, R.
2010-01-01
The gold deposits in the western sector of the Central Spanish System can be grouped in: (1) gold quartz veins type (El Chivote, La Pedrera), (2) paleoplacers: gold nuggets in tertiary alluvial deposits (Las Cavenes, Sierro de Coria), (3) quaternary placers (Rio Erjas), (4) gold nuggets in a regolith developed on the Schist and Graywacke Complex (CEG) (Casillas de Coria). The morphological study of gold nuggets will provide physical, chemical, bacteriological and climatic characteristics. Mining works are located on these deposits from roman time to the present day. (Author)
When gold can do what iodine cannot do: A critical comparison
Directory of Open Access Journals (Sweden)
Stefan F. Kirsch
2011-06-01
Full Text Available Gold catalysis has emerged as one of the most dynamic fields in organic synthesis. Only recently, more and more domino processes, for which gold pre-catalysts were found to be outstandingly effective, were paralleled by employing iodine electrophiles in place of gold compounds. This review highlights how, in certain cases, iodonium activation can match gold-catalyzed reactions to construct identical product scaffolds. Likewise, processes are discussed where mostly identical starting materials are transformed into diverse frameworks depending on whether gold or iodonium activation was used to trigger the reaction.
Bacterial leaching of pyritic gold ores
International Nuclear Information System (INIS)
Gagliardi, F.M.; Cashion, J.D.; Brown, J.; Jay, W.H.
1998-01-01
Full text: Pyritic ores (pyrite and arsenopyrite) containing gold concentrations in excess of 50g Au/t can be processed to recover the gold by the removal of the sulphur from the ore. This may be achieved by roasting (producing sulphur dioxide emissions), pressure oxidation (expensive and suitable for large high grade deposits), pressure leaching (still currently being developed) or bacterial oxidation. The bacterial oxidation process is a well known process in nature but has only recently come under investigation as a economically viable and relatively clean method of gold recovery from deep low grade sulphidic ores. Samples were obtained from the Wiluna Gold Mine in Western Australia consisting of the original ore, six successive bacterial reactors and the final products. Moessbauer experiments have been performed at room temperature, liquid nitrogen and liquid helium temperatures, and in applied magnetic fields. The main components of the iron phases which were present during the bacterial treatment were pyrite and arsenopyrite which were readily oxidised by the bacteria. Ferric sulfates and ferric arsenates were identified as by-products of the process with a small amount of the oxyhydroxide goethite. These results are in contrast to the similar study of the Fairview Mine in South Africa where principally Fe(II) species were observed
Absorption Spectra of Gold Nanoparticle Suspensions
Anan'eva, M. V.; Nurmukhametov, D. R.; Zverev, A. S.; Nelyubina, N. V.; Zvekov, A. A.; Russakov, D. M.; Kalenskii, A. V.; Eremenko, A. N.
2018-02-01
Three gold nanoparticle suspensions are obtained, and mean radii in distributions - (6.1 ± 0.2), (11.9 ± 0.3), and (17.3 ± 0.7) nm - are determined by the transmission electron microscopy method. The optical absorption spectra of suspensions are obtained and studied. Calculation of spectral dependences of the absorption index of suspensions at values of the gold complex refractive index taken from the literature showed a significant deviation of experimental and calculated data in the region of 450-800 nm. Spectral dependences of the absorption of suspensions are simulated within the framework of the Mie-Drude theory taking into account the interband absorption in the form of an additional term in the imaginary part of the dielectric permittivity of the Gaussian type. It is shown that to quantify the spectral dependences in the region of the plasmon absorption band of nanoparticles, correction of the parameters of the interband absorption is necessary in addition to the increase of the relaxation parameter of the Drude theory. Spectral dependences of the dielectric permittivity of gold in nanodimensional state are refined from the solution of the inverse problem. The results of the present work are important for predicting the special features of operation of photonic devices and optical detonators based on gold nanoparticles.
Determination of Commercial Karats on Gold Alloys for Jewellery
International Nuclear Information System (INIS)
Morales, S.E.A.
1986-12-01
An XRF method for the gold content determination in gold alloys was proposed and tested. Gold coins and ingot samples were analyzed. Monoelemental standards and two pint regression curves calculated with the NBSGSC program, Cd-109 annular source, Si-Li detector, 4096 channels analyzer and AXIL deconvolution software were employed. Good precision better than 1.5% and accuracy better than 2% were obtained. (author)
Synthesis of porous gold nanoshells by controlled transmetallation reaction
Energy Technology Data Exchange (ETDEWEB)
Pattabi, Manjunatha, E-mail: manjupattabi@yahoo.com; M, Krishnaprabha [Department of Materials Science, Mangalore University, Mangalagangothri-574199 (India)
2015-06-24
Aqueous synthesis of porous gold nanoshells in one step is carried out through controlled transmetallation (TM) reaction using a naturally available egg shell membrane (ESM) as a barrier between the sacrificial silver particles (AgNPs) and the gold precursor solution (HAuCl{sub 4}). The formation of porous gold nanoshells via TM reaction is inferred from UV-Vis spectroscopy and the scanning electron microscopic (SEM) studies.
Hydrothermal Gold Mineralization and Structural Controls near May ...
African Journals Online (AJOL)
Mickiale
controlled gold mineralized zones of gold near Workamba. .... consists of rounded to sub-rounded clasts of blue quartz eyes and varies in size from ... Based on the field observation, petrographic study and their cross cutting relationships; four.
Synthesis, characterization and self-assembly with gold nanoparticles
Indian Academy of Sciences (India)
Administrator
characterization and self-assembly with gold nanoparticles. JUN-BO LI. 1, ... gold surface lead to the enhancement of device prop- erties. 36,37 ... Reactions were monitored by thin-layer ..... plasmon (SP) absorption band (figure 5) of TOAB-.
Mercury adsorption to gold nanoparticle and thin film surfaces
Morris, Todd Ashley
Mercury adsorption to gold nanoparticle and thin film surfaces was monitored by spectroscopic techniques. Adsorption of elemental mercury to colloidal gold nanoparticles causes a color change from wine-red to orange that was quantified by UV-Vis absorption spectroscopy. The wavelength of the surface plasmon mode of 5, 12, and 31 nm gold particles blue-shifts 17, 14, and 7.5 nm, respectively, after a saturation exposure of mercury vapor. Colorimetric detection of inorganic mercury was demonstrated by employing 2.5 nm gold nanoparticles. The addition of low microgram quantities of Hg 2+ to these nanoparticles induces a color change from yellow to peach or blue. It is postulated that Hg2+ is reduced to elemental mercury by SCN- before and/or during adsorption to the nanoparticle surface. It has been demonstrated that surface plasmon resonance spectroscopy (SPRS) is sensitive to mercury adsorption to gold and silver surfaces. By monitoring the maximum change in reflectivity as a function of amount of mercury adsorbed to the surface, 50 nm Ag films were shown to be 2--3 times more sensitive than 50 nm Au films and bimetallic 15 nm Au/35 nm Ag films. In addition, a surface coverage of ˜40 ng Hg/cm2 on the gold surface results in a 0.03° decrease in the SPR angle of minimum reflectivity. SPRS was employed to follow Hg exposure to self-assembled monolayers (SAMs) on Au. The data indicate that the hydrophilic or hydrophobic character of the SAM has a significant effect on the efficiency of Hg penetration. Water adsorbed to carboxylic acid end group of the hydrophilic SAMs is believed to slow the penetration of Hg compared to methyl terminated SAMs. Finally, two protocols were followed to remove mercury from gold films: immersion in concentrated nitric acid and thermal annealing up to 200°C. The latter protocol is preferred because it removes all of the adsorbed mercury from the gold surface and does not affect the morphology of the gold surface.
Optical constant of thin gold films
DEFF Research Database (Denmark)
Yakubovsky, D. I.; Fedyanin, D. Yu; Arsenin, A. V.
2017-01-01
The performance of metal-based devices is limited by ohmic losses in the metal, which are determined by electron scattering. The structural properties of gold thin films also play an important role in the film quality, which may affect its' optical properties and the overall capability...... and spectroscopic ellipsometry, the structural morphology and optical properties of polycrystalline gold thin films (fabricated by e-beam deposition at a low sputtering rate smooth gold) in the thickness range of 20 - 200 nm. By extracting the real and imaginary dielectric function and the Drude parameter...... of the device. At the same time, metal films of different thicknesses are needed for different applications and, since these films are polycrystalline, their internal properties and surface roughness can greatly vary from one thickness to another. In this work, we study, using atomic force microscopy...
Synthesis of hexagonal gold nanoparticles using a microfluidic reaction system
International Nuclear Information System (INIS)
Weng, Chen-Hsun; Lee, Gwo-Bin; Huang, Chih-Chia; Yeh, Chen-Sheng; Lei, Huan-Yao
2008-01-01
A new microfluidic reaction system capable of mixing, transporting and reacting is developed for the synthesis of gold nanoparticles. It allows for a rapid and a cost-effective approach to accelerate the synthesis of gold nanoparticles. The microfluidic reaction chip is made from micro-electro-mechanical-system technologies which integrate a micro-mixer, micro-pumps, a micro-valve, micro-heaters and a micro temperature sensor on a single chip. Successful synthesis of dispersed gold nanoparticles has been demonstrated within a shorter period of time, as compared to traditional methods. It is experimentally found that precise control of the mixing/heating time for gold salts and reducing agents plays an essential role in the synthesis of gold nanoparticles. The growth process of hexagonal gold nanoparticles by a thermal aqueous approach is also systematically studied by using the same microfluidic reaction system. The development of the microfluidic reaction system could be promising for the synthesis of functional nanoparticles for future biomedical applications
Direct search for Dirac magnetic monopoles in pp collisions at square root s = 1.96 TeV.
Abulencia, A; Acosta, D; Adelman, J; Affolder, T; Akimoto, T; Albrow, M G; Ambrose, D; Amerio, S; Amidei, D; Anastassov, A; Anikeev, K; Annovi, A; Antos, J; Aoki, M; Apollinari, G; Arguin, J-F; Arisawa, T; Artikov, A; Ashmanskas, W; Attal, A; Azfar, F; Azzi-Bacchetta, P; Azzurri, P; Bacchetta, N; Bachacou, H; Badgett, W; Barbaro-Galtieri, A; Barnes, V E; Barnett, B A; Baroiant, S; Bartsch, V; Bauer, G; Bedeschi, F; Behari, S; Belforte, S; Bellettini, G; Bellinger, J; Belloni, A; Ben-Haim, E; Benjamin, D; Beretvas, A; Beringer, J; Berry, T; Bhatti, A; Binkley, M; Bisello, D; Bishai, M; Blair, R E; Blocker, C; Bloom, K; Blumenfeld, B; Bocci, A; Bodek, A; Boisvert, V; Bolla, G; Bolshov, A; Bortoletto, D; Boudreau, J; Bourov, S; Boveia, A; Brau, B; Bromberg, C; Brubaker, E; Budagov, J; Budd, H S; Budd, S; Burkett, K; Busetto, G; Bussey, P; Byrum, K L; Cabrera, S; Campanelli, M; Campbell, M; Canelli, F; Canepa, A; Carlsmith, D; Carosi, R; Carron, S; Carter, A; Casarsa, M; Castro, A; Catastini, P; Cauz, D; Cavalli-Sforza, M; Cerri, A; Cerrito, L; Chang, S H; Chapman, J; Chen, Y C; Chertok, M; Chiarelli, G; Chlachidze, G; Chlebana, F; Cho, I; Cho, K; Chokheli, D; Chou, J P; Chu, P H; Chuang, S H; Chung, K; Chung, W H; Chung, Y S; Ciljak, M; Ciobanu, C I; Ciocci, M A; Clark, A; Clark, D; Coca, M; Connolly, A; Convery, M E; Conway, J; Cooper, B; Copic, K; Cordelli, M; Cortiana, G; Cruz, A; Cuevas, J; Culbertson, R; Cyr, D; DaRonco, S; D'Auria, S; D'Onofrio, M; Dagenhart, D; de Barbaro, P; De Cecco, S; Deisher, A; De Lentdecker, G; Dell'Orso, M; Demers, S; Demortier, L; Deng, J; Deninno, M; De Pedis, D; Derwent, P F; Dionisi, C; Dittmann, J; DiTuro, P; Dörr, C; Dominguez, A; Donati, S; Donega, M; Dong, P; Donini, J; Dorigo, T; Dube, S; Ebina, K; Efron, J; Ehlers, J; Erbacher, R; Errede, D; Errede, S; Eusebi, R; Fang, H C; Farrington, S; Fedorko, I; Fedorko, W T; Feild, R G; Feindt, M; Fernandez, J P; Field, R; Flanagan, G; Flores-Castillo, L R; Foland, A; Forrester, S; Foster, G W; Franklin, M; Freeman, J C; Fujii, Y; Furic, I; Gajjar, A; Gallinaro, M; Galyardt, J; Garcia, J E; Garcia Sciverez, M; Garfinkel, A F; Gay, C; Gerberich, H; Gerchtein, E; Gerdes, D; Giagu, S; Giannetti, P; Gibson, A; Gibson, K; Ginsburg, C; Giolo, K; Giordani, M; Giunta, M; Giurgiu, G; Glagolev, V; Glenzinski, D; Gold, M; Goldschmidt, N; Goldstein, J; Gomez, G; Gomez-Ceballos, G; Goncharov, M; González, O; Gorelov, I; Goshaw, A T; Gotra, Y; Goulianos, K; Gresele, A; Griffiths, M; Grinstein, S; Grosso-Pilcher, C; Grundler, U; da Costa, J Guimaraes; Haber, C; Hahn, S R; Hahn, K; Halkiadakis, E; Hamilton, A; Han, B-Y; Handler, R; Happacher, F; Hara, K; Hare, M; Harper, S; Harr, R F; Harris, R M; Hatakeyama, K; Hauser, J; Hays, C; Hayward, H; Heijboer, A; Heinemann, B; Heinrich, J; Hennecke, M; Herndon, M; Heuser, J; Hidas, D; Hill, C S; Hirschbuehl, D; Hocker, A; Holloway, A; Hou, S; Houlden, M; Hsu, S-C; Huffman, B T; Hughes, R E; Huston, J; Ikado, K; Incandela, J; Introzzi, G; Iori, M; Ishizawa, Y; Ivanov, A; Iyutin, B; James, E; Jang, D; Jayatilaka, B; Jeans, D; Jensen, H; Jeon, E J; Jones, M; Joo, K K; Jun, S Y; Junk, T R; Kamon, T; Kang, J; Karagoz-Unel, M; Karchin, P E; Kato, Y; Kemp, Y; Kephart, R; Kerzel, U; Khotilovich, V; Kilminster, B; Kim, D H; Kim, H S; Kim, J E; Kim, M J; Kim, M S; Kim, S B; Kim, S H; Kim, Y K; Kirby, M; Kirsch, L; Klimenko, S; Klute, M; Knuteson, B; Ko, B R; Kobayashi, H; Kondo, K; Kong, D J; Konigsberg, J; Kordas, K; Korytov, A; Kotwal, A V; Kovalev, A; Kraus, J; Kravchenko, I; Kreps, M; Kreymer, A; Kroll, J; Krumnack, N; Kruse, M; Krutelyov, V; Kuhlmann, S E; Kusakabe, Y; Kwang, S; Laasanen, A T; Lai, S; Lami, S; Lammel, S; Lancaster, M; Lander, R L; Lannon, K; Lath, A; Latino, G; Lazzizzera, I; Lecci, C; LeCompte, T; Lee, J; Lee, J; Lee, S W; Lefèvre, R; Leonardo, N; Leone, S; Levy, S; Lewis, J D; Li, K; Lin, C; Lin, C S; Lindgren, M; Lipeles, E; Liss, T M; Lister, A; Litvintsev, D O; Liu, T; Liu, Y; Lockyer, N S; Loginov, A; Loreti, M; Loverre, P; Lu, R-S; Lucchesi, D; Lujan, P; Lukens, P; Lungu, G; Lyons, L; Lys, J; Lysak, R; Lytken, E; Mack, P; MacQueen, D; Madrak, R; Maeshima, K; Maksimovic, P; Manca, G; Margaroli, F; Marginean, R; Marino, C; Martin, A; Martin, M; Martin, V; Martínez, M; Maruyama, T; Matsunaga, H; Mattson, M E; Mazini, R; Mazzanti, P; McFarland, K S; McGivern, D; McIntyre, P; McNamara, P; McNulty, R; Mehta, A; Menzemer, S; Menzione, A; Merkel, P; Mesropian, C; Messina, A; von der Mey, M; Miao, T; Miladinovic, N; Miles, J; Miller, R; Miller, J S; Mills, C; Milnik, M; Miquel, R; Miscetti, S; Mitselmakher, G; Miyamoto, A; Moggi, N; Mohr, B; Moore, R; Morello, M; Fernandez, P Movilla; Mülmenstädt, J; Mukherjee, A; Mulhearn, M; Muller, Th; Mumford, R; Murat, P; Nachtman, J; Nahn, S; Nakano, I; Napier, A; Naumov, D; Necula, V; Neu, C; Neubauer, M S; Nielsen, J; Nigmanov, T; Nodulman, L; Norniella, O; Ogawa, T; Oh, S H; Oh, Y D; Okusawa, T; Oldeman, R; Orava, R; Osterberg, K; Pagliarone, C; Palencia, E; Paoletti, R; Papadimitriou, V; Papikonomou, A; Paramonov, A A; Parks, B; Pashapour, S; Patrick, J; Pauletta, G; Paulini, M; Paus, C; Pellett, D E; Penzo, A; Phillips, T J; Piacentino, G; Piedra, J; Pitts, K; Plager, C; Pondrom, L; Pope, G; Portell, X; Poukhov, O; Pounder, N; Prakoshyn, F; Pronko, A; Proudfoot, J; Ptohos, F; Punzi, G; Pursley, J; Rademacker, J; Rahaman, A; Rakitin, A; Rappoccio, S; Ratnikov, F; Reisert, B; Rekovic, V; van Remortel, N; Renton, P; Rescigno, M; Richter, S; Rimondi, F; Rinnert, K; Ristori, L; Robertson, W J; Robson, A; Rodrigo, T; Rogers, E; Rolli, S; Roser, R; Rossi, M; Rossin, R; Rott, C; Ruiz, A; Russ, J; Rusu, V; Ryan, D; Saarikko, H; Sabik, S; Safonov, A; Sakumoto, W K; Salamanna, G; Salto, O; Saltzberg, D; Sanchez, C; Santi, L; Sarkar, S; Sato, K; Savard, P; Savoy-Navarro, A; Scheidle, T; Schieferdecker, P; Schlabach, P; Schmidt, E E; Schmidt, M P; Schmitt, M; Schwarz, T; Scodellaro, L; Scott, A L; Scribano, A; Scuri, F; Sedov, A; Seidel, S; Seiya, Y; Semenov, A; Semeria, F; Sexton-Kennedy, L; Sfiligoi, I; Shapiro, M D; Shears, T; Shepard, P F; Sherman, D; Shimojima, M; Shochet, M; Shon, Y; Shreyber, I; Sidoti, A; Sill, A; Sinervo, P; Sisakyan, A; Sjolin, J; Skiba, A; Slaughter, A J; Sliwa, K; Smirnov, D; Smith, J R; Snider, F D; Snihur, R; Soderberg, M; Soha, A; Somalwar, S; Sorin, V; Spalding, J; Spinella, F; Squillacioti, P; Stanitzki, M; Staveris-Polykalas, A; St Dennis, R; Stelzer, B; Stelzer-Chilton, O; Stentz, D; Strologas, J; Stuart, D; Suh, J S; Sukhanov, A; Sumorok, K; Sun, H; Suzuki, T; Taffard, A; Tafirout, R; Takashima, R; Takeuchi, Y; Takikawa, K; Tanaka, M; Tanaka, R; Tecchio, M; Teng, P K; Terashi, K; Tether, S; Thom, J; Thompson, A S; Thomson, E; Tipton, P; Tiwari, V; Tkaczyk, S; Toback, D; Tollefson, K; Tomura, T; Tonelli, D; Tönnesmann, M; Torre, S; Torretta, D; Tourneur, S; Trischuk, W; Tsuchiya, R; Tsuno, S; Turini, N; Ukegawa, F; Unverhau, T; Uozumi, S; Usynin, D; Vacavant, L; Vaiciulis, A; Vallecorsa, S; Varganov, A; Vataga, E; Velev, G; Veramendi, G; Veszpremi, V; Vickey, T; Vidal, R; Vila, I; Vilar, R; Vollrath, I; Volobouev, I; Würthwein, F; Wagner, P; Wagner, R G; Wagner, R L; Wagner, W; Wallny, R; Walter, T; Wan, Z; Wang, M J; Wang, S M; Warburton, A; Ward, B; Waschke, S; Waters, D; Watts, T; Weber, M; Wester, W C; Whitehouse, B; Whiteson, D; Wicklund, A B; Wicklund, E; Williams, H H; Wilson, P; Winer, B L; Wittich, P; Wolbers, S; Wolfe, C; Worm, S; Wright, T; Wu, X; Wynne, S M; Yagil, A; Yamamoto, K; Yamaoka, J; Yamashita, Y; Yang, C; Yang, U K; Yao, W M; Yeh, G P; Yoh, J; Yorita, K; Yoshida, T; Yu, I; Yu, S S; Yun, J C; Zanello, L; Zanetti, A; Zaw, I; Zetti, F; Zhang, X; Zhou, J; Zucchelli, S
2006-05-26
We search for pair-produced Dirac magnetic monopoles in 35.7 pb(-1) of proton-antiproton collisions at square root s = 1.96 TeV with the Collider Detector at Fermilab (CDF). We find no monopole candidates corresponding to a 95% confidence-level cross-section limit sigma 360 GeV/c2.
International Nuclear Information System (INIS)
Nyarku, M.
2009-02-01
Instrumental Neutron Activation Analysis (INAA) has been used to quantify the concentrations of arsenic, gold and antimony in particle-size fractions of a gold ore. The ore, which was taken from the Ahafo project site of Newmont Ghana Gold Ltd, was first fractionated into fourteen (14) particle-size fractions using state-of-the-art analytical sieve machine. The minimum sieve mesh size used was 36 microns and grains >2000 microns were not considered for analysis. Results of the sieving were analysed with easysieve software. The < 36 microns sub fraction was found to be the optimum, hosting bulk of all three elements. For arsenic, the element was found to be highly concentrated in < 36 to +100 microns size fractions and erratically distributed from +150 microns fraction and above. For gold, in exception of the sub fraction <36 which had exceptionally high concentration, the element is distributed in all the size fractions but slightly 'plays out' in the +150 to +400 microns fractions. Antimony occurrence in the sample was relatively high in <36 microns size fraction followed by 600 - 800, 800 - 1000, 400 - 600 and 36 - 40 microns size fractions in that order. Gold content in the sample was far higher than that of arsenic and antimony. Gold concentration in the composite sample was in the range 564 - 8420 ppm. Arsenic levels were higher as compared to antimony. The range of arsenic concentration in the composite sample was 14.33 - 186.92 ppm. Antimony concentration was in the range 1.09 - 9.48 ppm. (au)
Formation of different gold nanostructures by silk nanofibrils
International Nuclear Information System (INIS)
Fang, Guangqiang; Yang, Yuhong; Yao, Jinrong; Shao, Zhengzhong; Chen, Xin
2016-01-01
Metal nanostructures that have unique size- and shape-dependent electronic, optical and chemical properties gain more and more attention in modern science and technology. In this article, we show the possibility that we are able to obtain different gold nanostructures simply with the help of silk nanofibrils. We demonstrate that only by varying the pH of the reaction solution, we get gold nanoparticles, nano-icosahedrons, nanocubes, and even microplates. Particularly, we develop a practical method for the preparation of gold microplates in acid condition in the presence of silk nanofibrils, which is impossible by using other forms of silk protein. We attribute the role of silk nanofibrils in the formation of gold nanostructure to their reduction ability from several specific amino acid residues, and the suitable structural anisotropic features to sustain the crystal growth after the reduction process. Although the main purpose of this article is to demonstrate that silk nanofibrils are able to mediate the formation of different gold nanostructure, we show the potential applications of these resulting gold nanostructures, such as surface-enhanced Raman scattering (SERS) and photothermal transformation effect, as same as those produced by other methods. In conclusion, we present in this communication a facile and green synthesis route to prepare various gold nanostructures with silk nanofibrils by simply varying pH in the reaction system, which has remarkable advantages in future biomedical applications. - Highlights: • Different Au nanostructures can be obtained by a facile and green protein reduction method. • Silk nanofibrils serve as both reductant and template in the formation of Au nanostructures. • Different Au nanostructures can be obtained simply by regulating the pH in the medium. • Large Au microplates can be obtained with a cheap, abundant, sustainable silk protein. • Silk/Au hybrid nanocomposites show potential application in SERS and
Formation of different gold nanostructures by silk nanofibrils
Energy Technology Data Exchange (ETDEWEB)
Fang, Guangqiang [State Key Laboratory of Molecular Engineering of Polymers, Collaborative Innovation Center of Polymers and Polymer Composite Materials, Department of Macromolecular Science, Laboratory of Advanced Materials, Fudan University, Shanghai, 200433 (China); Yang, Yuhong [Research Centre for Analysis and Measurement, Fudan University, Shanghai 200433 (China); Yao, Jinrong; Shao, Zhengzhong [State Key Laboratory of Molecular Engineering of Polymers, Collaborative Innovation Center of Polymers and Polymer Composite Materials, Department of Macromolecular Science, Laboratory of Advanced Materials, Fudan University, Shanghai, 200433 (China); Chen, Xin, E-mail: chenx@fudan.edu.cn [State Key Laboratory of Molecular Engineering of Polymers, Collaborative Innovation Center of Polymers and Polymer Composite Materials, Department of Macromolecular Science, Laboratory of Advanced Materials, Fudan University, Shanghai, 200433 (China)
2016-07-01
Metal nanostructures that have unique size- and shape-dependent electronic, optical and chemical properties gain more and more attention in modern science and technology. In this article, we show the possibility that we are able to obtain different gold nanostructures simply with the help of silk nanofibrils. We demonstrate that only by varying the pH of the reaction solution, we get gold nanoparticles, nano-icosahedrons, nanocubes, and even microplates. Particularly, we develop a practical method for the preparation of gold microplates in acid condition in the presence of silk nanofibrils, which is impossible by using other forms of silk protein. We attribute the role of silk nanofibrils in the formation of gold nanostructure to their reduction ability from several specific amino acid residues, and the suitable structural anisotropic features to sustain the crystal growth after the reduction process. Although the main purpose of this article is to demonstrate that silk nanofibrils are able to mediate the formation of different gold nanostructure, we show the potential applications of these resulting gold nanostructures, such as surface-enhanced Raman scattering (SERS) and photothermal transformation effect, as same as those produced by other methods. In conclusion, we present in this communication a facile and green synthesis route to prepare various gold nanostructures with silk nanofibrils by simply varying pH in the reaction system, which has remarkable advantages in future biomedical applications. - Highlights: • Different Au nanostructures can be obtained by a facile and green protein reduction method. • Silk nanofibrils serve as both reductant and template in the formation of Au nanostructures. • Different Au nanostructures can be obtained simply by regulating the pH in the medium. • Large Au microplates can be obtained with a cheap, abundant, sustainable silk protein. • Silk/Au hybrid nanocomposites show potential application in SERS and
Mixed carboranethiol self-assembled monolayers on gold surfaces
Energy Technology Data Exchange (ETDEWEB)
Yavuz, Adem [Micro and Nanotechnology Department, Graduate School of Natural and Applied Science, Middle East Technical University, Ankara 06800 (Turkey); Sohrabnia, Nima [Department of Chemistry, Middle East Technical University, Ankara 06800 (Turkey); Yilmaz, Ayşen [Micro and Nanotechnology Department, Graduate School of Natural and Applied Science, Middle East Technical University, Ankara 06800 (Turkey); Department of Chemistry, Middle East Technical University, Ankara 06800 (Turkey); Danışman, M. Fatih, E-mail: danisman@metu.edu.tr [Micro and Nanotechnology Department, Graduate School of Natural and Applied Science, Middle East Technical University, Ankara 06800 (Turkey); Department of Chemistry, Middle East Technical University, Ankara 06800 (Turkey)
2017-08-15
Highlights: • M1 binds to the gold surface preferentially when co-deposited with M9 or O1. • Contact angles show similar trends regardless of the gold substrate roughness. • Contact angles were lower, with higher hysteresis, on template stripped gold. • Mixed carboranethiol SAMs have similar morphological properties regardless of mixing ratio. - Abstract: Carboranethiol self-assembled monolayers on metal surfaces have been shown to be very convenient systems for surface engineering. Here we have studied pure and mixed self-assembled monolayers (SAMs) of three different carboranethiol (CT) isomers on gold surfaces. The isomers were chosen with dipole moments pointing parallel to (m-1-carboranethiol, M1), out of (m-9-carboranethiol, M9) and into (o-1-carboranethiol, O1) the surface plane, in order to investigate the effect of dipole moment orientation on the film properties. In addition, influence of the substrate surface morphology on the film properties was also studied by using flame annealed (FA) and template stripped (TS) gold surfaces. Contact angle measurements indicate that in M1/M9 and M1/O1 mixed SAMs, M1 is the dominant species on the surface even for low M1 ratio in the growth solution. Whereas for O1/M9 mixed SAMs no clear evidence could be observed indicating dominance of one of the species over the other one. Though contact angle values were lower and hysteresis values were higher for SAMs grown on TS gold surfaces, the trends in the behavior of the contact angles with changing mixing ratio were identical for SAMs grown on both substrates. Atomic force microscopy images of the SAMs on TS gold surfaces indicate that the films have similar morphological properties regardless of mixing ratio.
Major Brazilian gold deposits - 1982 to 1999
Thorman, Charles H.; DeWitt, Ed; Maron, Marcos A.; Ladeira, Eduardo A.
2001-07-01
Brazil has been a major but intermittent producer of gold since its discovery in 1500. Brazil led the world in gold production during the 18th and early 19th centuries. From the late 19th century to the late 20th century, total mining company and garimpeiro production was small and relatively constant at about 5 to 8 t/year. The discovery of alluvial deposits in the Amazon by garimpeiros in the 1970s and the opening of eight mines by mining companies from 1983 to 1990 fueled a major boom in Brazil's gold production, exceeding 100 t/year in 1988 and 1989. However, garimpeiro alluvial production decreased rapidly in the 1990s, to about 10 t/year by 1999. Company production increased about tenfold from about 4 t/year in 1982 to 40 t in 1992. Production from 1992 to the present remained relatively stable, even though several mines were closed or were in the process of closing and no new major mines were put into production during that period. Based on their production history from 1982-1999, 17 gold mines are ranked as major (>20 t) and minor (3-8 t) mines. From 1982-1999, deposits hosted in Archean rocks produced 66% of the gold in Brazil, whereas deposits in Paleoproterozoic and Neoproterozoic rocks accounted for 19% and 15%, respectively. Deposits in metamorphosed sedimentary rocks, especially carbonate-rich rocks and carbonate iron-formation, yielded the great bulk of the gold. Deposits in igneous rocks were of much less importance. The Archean and Paleoproterozoic terranes of Brazil largely lack base-metal-rich volcanogenic massive sulfide deposits, porphyry deposits, and polymetallic veins and sedimentary exhalative deposits. An exception to this is in the Carajás Mineral Province.
Major brazilian gold deposits - 1982 to 1999
Thorman, C.H.; Dewitt, E.; Maron, M.A.; Ladeira, E.A.
2001-01-01
Brazil has been a major but intermittent producer of gold since its discovery in 1500. Brazil led the world in gold production during the 18th and early 19th centuries. From the late 19th century to the late 20th century, total mining company and garimpeiro production was small and relatively constant at about 5 to 8 t/year. The discovery of alluvial deposits in the Amazon by garimpeiros in the 1970s and the opening of eight mines by mining companies from 1983 to 1990 fueled a major boom in Brazil's gold production, exceeding 100 t/year in 1988 and 1989. However, garimpeiro alluvial production decreased 'rapidly in the 1990s, to about 10 t/year by 1999. Company production increased about tenfold from about 4 t/year in 1982 to 40 t in 1992. Production from 1992 to the present remained relatively stable, even though several mines were closed or were in the process of closing and no new major mines were put into production during that period. Based on their production history from 1982-1999, 17 gold mines are ranked as major (> 20 t) and minor (3-8 t) mines. From 1982-1999, deposits hosted in Archean rocks produced 66% of the gold in Brazil, whereas deposits in Paleoproterozoic and Neoproterozoic rocks accounted for 19% and 15%, respectively. Deposits in metamorphosed sedimentary rocks, especially carbonate-rich rocks and carbonate iron-formation, yielded the great bulk of the gold. Deposits in igneous rocks were of much less importance. The Archean and Paleoproterozoic terranes of Brazil largely lack base-metal-rich volcanogenic massive sulfide deposits, porphyry deposits, and polymetallic veins and sedimentary exhalative deposits. An exception to this is in the Caraja??s Mineral Province.
Cancer nanomedicine: gold nanoparticle mediated combined cancer therapy
Yang, C.; Bromma, Kyle; Chithrani, B. D.
2018-02-01
Recent developments in nanotechnology has provided new tools for cancer therapy and diagnosis. Among other nanomaterial systems, gold nanoparticles are being used as radiation dose enhancers and anticancer drug carriers in cancer therapy. Fate of gold nanoparticles within biological tissues can be probed using techniques such as TEM (transmission electron microscopy) and SEM (Scanning Electron Microscopy) due to their high electron density. We have shown for the first time that cancer drug loaded gold nanoparticles can reach the nucleus (or the brain) of cancer cells enhancing the therapeutic effect dramatically. Nucleus of the cancer cells are the most desirable target in cancer therapy. In chemotherapy, smart delivery of highly toxic anticancer drugs through packaging using nanoparticles will reduce the side effects and improve the quality and care of cancer patients. In radiation therapy, use of gold nanoparticles as radiation dose enhancer is very promising due to enhanced localized dose within the cancer tissue. Recent advancement in nanomaterial characterization techniques will facilitate mapping of nanomaterial distribution within biological specimens to correlate the radiobiological effects due to treatment. Hence, gold nanoparticle mediated combined chemoradiation would provide promising tools to achieve personalized and tailored cancer treatments in the near future.
Pulse-voltammetric glucose detection at gold junction electrodes.
Rassaei, Liza; Marken, Frank
2010-09-01
A novel glucose sensing concept based on the localized change or "modulation" in pH within a symmetric gold-gold junction electrode is proposed. A paired gold-gold junction electrode (average gap size ca. 500 nm) is prepared by simultaneous bipotentiostatic electrodeposition of gold onto two closely spaced platinum disk electrodes. For glucose detection in neutral aqueous solution, the potential of the "pH-modulator" electrode is set to -1.5 V vs saturated calomel reference electrode (SCE) to locally increase the pH, and simultaneously, either cyclic voltammetry or square wave voltammetry experiments are conducted at the sensor electrode. A considerable improvement in the sensor electrode response is observed when a normal pulse voltammetry sequence is applied to the modulator electrode (to generate "hydroxide pulses") and the glucose sensor electrode is operated with fixed bias at +0.5 V vs SCE (to eliminate capacitive charging currents). Preliminary data suggest good linearity for the glucose response in the medically relevant 1-10 mM concentration range (corresponding to 0.18-1.8 g L(-1)). Future electroanalytical applications of multidimensional pulse voltammetry in junction electrodes are discussed.
76 FR 60355 - Gold Star Mother's and Family's Day, 2011
2011-09-28
... Gold Star Mother's and Family's Day, 2011 By the President of the United States of America A... grief their families carry we can never fully know. Gold Star mothers and families know the immeasurable... inspired by their strength and determination. Through heartbreaking loss, our Gold Star families continue...
Dendritic functionalization of monolayer-protected gold nanoparticles
International Nuclear Information System (INIS)
Cutler, Erin C.; Lundin, Erik; Garabato, B. Davis; Choi, Daeock; Shon, Young-Seok
2007-01-01
This paper describes the facile synthesis of nanoparticle-cored dendrimers (NCDs) and nanoparticle megamers from monolayer-protected gold clusters using either single or multi-step reactions. First, 11-mercaptoundecanoic acid/hexanethiolate-protected gold clusters were synthesized using the Schiffrin reaction followed by the ligand place-exchange reaction. A convergent approach for the synthesis of nanoparticle-cored dendrimers uses a single step reaction that is an ester coupling reaction of hydroxy-functionalized dendrons with carboxylic acid-functionalized gold clusters. A divergent approach, which is based on multi-step reactions, employs the repetition of an amide coupling reaction and a Michael addition reaction to build polyamidoamine dendritic architectures around a nanoparticle core. Nanoparticle megamers, which are large dendrimer-induced nanoparticle aggregates with an average diameter of more than 300 nm, were prepared by the amide coupling reaction between polyamiodoamine [G-2] dendrimers and carboxylic acid-functionalized gold clusters. 1 H NMR spectroscopy, FT-IR spectroscopy, thermogravimetric analysis (TGA), and transmission electron microscopy (TEM) were used for the characterization of these hybrid nanoparticles
Hardness and Elastic Modulus on Six-Fold Symmetry Gold Nanoparticles
Ramos, Manuel; Ortiz-Jordan, Luis; Hurtado-Macias, Abel; Flores, Sergio; Elizalde-Galindo, José T.; Rocha, Carmen; Torres, Brenda; Zarei-Chaleshtori, Maryam; Chianelli, Russell R.
2013-01-01
The chemical synthesis of gold nanoparticles (NP) by using gold (III) chloride trihydrate (HAuCl∙3H2O) and sodium citrate as a reducing agent in aqueous conditions at 100 °C is presented here. Gold nanoparticles areformed by a galvanic replacement mechanism as described by Lee and Messiel. Morphology of gold-NP was analyzed by way of high-resolution transmission electron microscopy; results indicate a six-fold icosahedral symmetry with an average size distribution of 22 nm. In order to understand the mechanical behaviors, like hardness and elastic moduli, gold-NP were subjected to nanoindentation measurements—obtaining a hardness value of 1.72 GPa and elastic modulus of 100 GPa in a 3–5 nm of displacement at the nanoparticle’s surface. PMID:28809302
Reducing wall plasma expansion with gold foam irradiated by laser
International Nuclear Information System (INIS)
Zhang, Lu; Ding, Yongkun; Jiang, Shaoen; Yang, Jiamin; Li, Hang; Kuang, Longyu; Lin, Zhiwei; Jing, Longfei; Li, Liling; Deng, Bo; Yuan, Zheng; Chen, Tao; Yuan, Guanghui; Tan, Xiulan; Li, Ping
2015-01-01
The experimental study on the expanding plasma movement of low-density gold foam (∼1% solid density) irradiated by a high power laser is reported in this paper. Experiments were conducted using the SG-III prototype laser. Compared to solid gold with 19.3 g/cc density, the velocities of X-ray emission fronts moving off the wall are much smaller for gold foam with 0.3 g/cc density. Theoretical analysis and MULTI 1D simulation results also show less plasma blow-off, and that the density contour movement velocities of gold foam are smaller than those of solid gold, agreeing with experimental results. These results indicate that foam walls have advantages in symmetry control and lowering plasma fill when used in ignition hohlraum
Reducing wall plasma expansion with gold foam irradiated by laser
Energy Technology Data Exchange (ETDEWEB)
Zhang, Lu; Ding, Yongkun, E-mail: ding-yk@vip.sina.com; Jiang, Shaoen, E-mail: jiangshn@vip.sina.com; Yang, Jiamin; Li, Hang; Kuang, Longyu; Lin, Zhiwei; Jing, Longfei; Li, Liling; Deng, Bo; Yuan, Zheng; Chen, Tao; Yuan, Guanghui; Tan, Xiulan; Li, Ping [Research Center of Laser Fusion, China Academy of Engineering Physics, P.O. Box 919-986, Mianyang 621900 (China)
2015-11-15
The experimental study on the expanding plasma movement of low-density gold foam (∼1% solid density) irradiated by a high power laser is reported in this paper. Experiments were conducted using the SG-III prototype laser. Compared to solid gold with 19.3 g/cc density, the velocities of X-ray emission fronts moving off the wall are much smaller for gold foam with 0.3 g/cc density. Theoretical analysis and MULTI 1D simulation results also show less plasma blow-off, and that the density contour movement velocities of gold foam are smaller than those of solid gold, agreeing with experimental results. These results indicate that foam walls have advantages in symmetry control and lowering plasma fill when used in ignition hohlraum.
Gold(III) biosorption and bioreduction with the brown alga Fucus vesiculosus.
Mata, Y N; Torres, E; Blázquez, M L; Ballester, A; González, F; Muñoz, J A
2009-07-30
In this paper, the bioreduction of Au(III) to Au(0) using biomass of the brown alga Fucus vesiculosus was investigated. The recovery and reduction process took place in two stages with an optimum pH range of 4-9 with a maximum uptake obtained at pH 7. In the first stage, an induction period previous to gold reduction, the variation of pH, redox potential and gold concentration in solution was practically negligible and no color change was observed. In the second stage, the gold reduction was followed by a sharp decrease of gold concentration, pH and redox potential of solution and a color change from yellow to reddish purple. Hydroxyl groups present in the algal polysaccharides were involved in the gold bioreduction. Metallic gold was detected as microprecipitates on the biomass surface and in colloidal form as nanoparticles in the solution. Bioreduction with F. vesiculosus could be an alternative and environmentally friendly process that can be used for recovering gold from dilute hydrometallurgical solutions and leachates of electronic scraps, and for the synthesis of gold nanoparticles of different size and shape.
Gold(III) biosorption and bioreduction with the brown alga Fucus vesiculosus
International Nuclear Information System (INIS)
Mata, Y.N.; Torres, E.; Blazquez, M.L.; Ballester, A.; Gonzalez, F.; Munoz, J.A.
2009-01-01
In this paper, the bioreduction of Au(III) to Au(0) using biomass of the brown alga Fucus vesiculosus was investigated. The recovery and reduction process took place in two stages with an optimum pH range of 4-9 with a maximum uptake obtained at pH 7. In the first stage, an induction period previous to gold reduction, the variation of pH, redox potential and gold concentration in solution was practically negligible and no color change was observed. In the second stage, the gold reduction was followed by a sharp decrease of gold concentration, pH and redox potential of solution and a color change from yellow to reddish purple. Hydroxyl groups present in the algal polysaccharides were involved in the gold bioreduction. Metallic gold was detected as microprecipitates on the biomass surface and in colloidal form as nanoparticles in the solution. Bioreduction with F. vesiculosus could be an alternative and environmentally friendly process that can be used for recovering gold from dilute hydrometallurgical solutions and leachates of electronic scraps, and for the synthesis of gold nanoparticles of different size and shape.
Directory of Open Access Journals (Sweden)
Sabo Wada Dutse
2015-08-01
Full Text Available The conductivity of a designed electrochemical DNA biosensor was improved using gold and or silver nanoparticles. A gold electrode modified with a conductive nanocomposite of poly(3,4-ethylene dioxythiophen–poly (styrenesulfonate (Pedot-Pss and gold or silver nano particles enhanced the conductivity of the electrode surface area. Bare and modified gold electrode surfaces were characterized using cyclic voltammetry (CV technique in ethylenediaminetetraacetic acid (TE supporting electrolyte. Immobilization of a 20-mer DNA probe was achieved by covalent attachment of the amine group of the capture probe to a carboxylic group of an activated 3,3’-dithiodipropionic acid layer using EDC/NHSS for Hybridization. The effect of hybridization temperature and time was optimized and the sensor demonstrated specific detection for the target concentration ranged between 1.0´10-15 M to 1.0´10-9 M with a detection limit of 9.70´10-19 M. Control experiments verified the specificity of the biosensor in the presence of mismatched DNA sequence. The DNA hybridization was monitored using a new ruthenium complex [Ru(dppz2(qtpyCl2; dppz = dipyrido [3,2–a:2’,3’-c] phenazine; qtpy=2,2’,-4,4”.4’4”’-quarterpyridyl redox indicator.
Unexpected interactions between gold and N-morpholino-sulfonates
DEFF Research Database (Denmark)
Nielsen, Frederick Stappen; Engelbrekt, Christian; Elliot, Samuel Gilbert
Nanoporous gold (NPG) has a high surface area and excellent conductivity. It is an ideal supporting material for the electrocatalysis, e.g. in fuel cell applications. NPG is traditionally produced by etching a gold/silver alloy. This method has significant drawbacks, such as the introduction...... of silver into your NPG, and its multi-step fabrication. A method has been discovered for producing NPG as a thin film chemically. This bottom-up approach entails reduction of Au3+ precursor using morpholinoethanesulfonic acid (MES). This produces a thin and highly porous gold film at the air...
Microbially Induced Precipitation of Gold(0) Nanoparticles.
Roh, Yu; Kang, Serku; Park, Bitna; Kim, Yumi
2015-01-01
The objectives of this study were to synthesize gold nanoparticles by biomineralization using metal-reducing bacteria and to characterize their mineralogical properties. The metal-reducing bacteria were able to reduce Au(III) to Au(0) with organic fatty acids as electron donors, as indicated by the color change of the culture solution from colorless gold ions to black precipitates at 25 degrees C. XRD, SEM- and TEM-EDS analyses of the precipitates showed that Au(0) was precipitated and formed at either the cell membrane or extracellularly. The Au(0) nanoparticles were about 200 nm in size and ball-shaped. Biomineralization for elemental Au(0) nanoparticle synthesis may be useful for the recovery of natural gold in natural environments.
Determination of gold and arsenic in Indian tobacco leaves
International Nuclear Information System (INIS)
Purkayastha, B.C.; Bhattacharyya, D.K.
1975-01-01
Two varieties of Indian Tobacco leaves have been analysed for gold and arsenic by neutron activation ( 76 As, 198 Au). Nicotiana rustica variety from North Bengal was found to contain 3.7x10 -1 ppm of gold and 4.0x10 -3 ppm of arsenic and the nicotiana tabaccum variety from Andhra Pradesh contains 1.26x10 -1 ppm of gold and 5.1x10 -3 ppm of arsenic, respectively. Unlike those in other countries Indian tobacco leaves seem to be enriched in the gold content and depleted in the arsenic content. The soil of North Bengal is richer in gold than the soil of Andhra Pradesh which requires further investigation, and the amount of arsenic in both soils is physiologically insignificant. Irradiation of leaf samples was done in a CIRUS reactor at a neutron flux of 10 13 n cm -2 s -1 for seven days. (F.G.)
Origin of the transition voltage in gold–vacuum–gold atomic junctions
Wu, Kunlin
2012-12-13
The origin and the distance dependence of the transition voltage of gold-vacuum-gold junctions are investigated by employing first-principles quantum transport simulations. Our calculations show that atomic protrusions always exist on the electrode surface of gold-vacuum-gold junctions fabricated using the mechanically controllable break junction (MCBJ) method. The transition voltage of these gold-vacuum-gold junctions with atomically sharp electrodes is determined by the local density of states (LDOS) of the apex gold atom on the electrode surface rather than by the vacuum barrier shape. More specifically, the absolute value of the transition voltage roughly equals the rising edge of the LDOS peak contributed by the 6p atomic orbitals of the gold atoms protruding from the electrode surface, whose local Fermi level is shifted downwards when a bias voltage is applied. Since the LDOS of the apex gold atom depends strongly on the exact shape of the electrode, the transition voltage is sensitive to the variation of the atomic configuration of the junction. For asymmetric junctions, the transition voltage may also change significantly depending on the bias polarity. Considering that the occurrence of the transition voltage requires the electrode distance to be larger than a critical value, the interaction between the two electrodes is actually rather weak. Consequently, the LDOS of the apex gold atom is mainly determined by its local atomic configuration and the transition voltage only depends weakly on the electrode distance as observed in the MCBJ experiments. © 2013 IOP Publishing Ltd.
Synthesis of highly faceted multiply twinned gold nanocrystals stabilized by polyoxometalates
International Nuclear Information System (INIS)
Yuan Junhua; Chen Yuanxian; Han Dongxue; Zhang Yuanjian; Shen Yanfei; Wang Zhijuan; Niu Li
2006-01-01
A novel and facile chemical synthesis of highly faceted multiply twinned gold nanocrystals is reported. The gold nanocrystals are hexagonal in transmission electron microscopy and icosahedral in scanning electron microscopy. Phosphotungstic acid (PTA), which was previously reduced, serves as a reductant and stabilizer for the synthesis of gold nanocrystals. The PTA-gold nanocomposites are quite stable in aqueous solutions, and electrochemically active towards the hydrogen evolution reaction