WorldWideScience

Sample records for gma x3100 built-in

  1. GMA200 ATEGG Digital Controls Demonstration.

    Science.gov (United States)

    1979-10-01

    radial and axial loads into the air inlet housing and forward frame. c. Combustor/Diffuser The GMA200 combustor/diffuser section consists of an annular...transition flow path of a turbofan engine. 6 IT U’~ --sa b. Compressor A six-stage axial flow compressor assembly consists of subassemblies of the...savings in the highly loaded , high speed unit. The blade is cooled by the application of a variety of cooling techniques including a film-cooled leading

  2. Stabilitas emulsi kopolimer S-GMA (stirena – glisidil metakrilat

    Directory of Open Access Journals (Sweden)

    Isananto Winursito

    1992-08-01

    Full Text Available Epoxy groups in glycidyl methacrylate (GMA units have been available for the reaction with amine of proteins or other biological active substrates to prepare biomaterials and hybrid devices. Soap-soap copolymerization of GMA with styrene (S result the formation of stable latex. Hydrolysis of epoxy groups in copolymer particles increased emulsion stability. The effect of pH, temperature and reaction time in the hydrolysis of S-GMA copolymer have been investigated.

  3. Structure and properties of GMA surfaced armour plates

    OpenAIRE

    A. Klimpel; K. Luksa; M. Burda

    2010-01-01

    Purpose: In the combat vehicles many materials can be used for the armour. Application of the monolithic armour plates in light combat vehicles is limited by the high armour weigh. Introduction of the layered armour plates is a way to limit the vehicle weight. In the paper test results of graded and nanostructural GMA surfaced armour plates are presented.Design/methodology/approach: Metallographic structure, chemical composition and hardness of surfaced layers were investigated in order to ex...

  4. Smart built-in test

    Science.gov (United States)

    Richards, Dale W.

    1990-03-01

    The work which built-in test (BIT) is asked to perform in today's electronic systems increases with every insertion of new technology or introduction of tighter performance criteria. Yet the basic purpose remains unchanged -- to determine with high confidence the operational capability of that equipment. Achievement of this level of BIT performance requires the management and assimilation of a large amount of data, both realtime and historical. Smart BIT has taken advantage of advanced techniques from the field of artificial intelligence (AI) in order to meet these demands. The Smart BIT approach enhances traditional functional BIT by utilizing AI techniques to incorporate environmental stress data, temporal BIT information and maintenance data, and realtime BIT reports into an integrated test methodology for increased BIT effectiveness and confidence levels. Future research in this area will incorporate onboard fault-logging of BIT output, stress data and Smart BIT decision criteria in support of a singular, integrated and complete test and maintenance capability. The state of this research is described along with a discussion of directions for future development.

  5. Hydrogels based on chemically modified poly(vinyl alcohol (PVA-GMA and PVA-GMA/chondroitin sulfate: Preparation and characterization

    Directory of Open Access Journals (Sweden)

    E. C. Muniz

    2012-05-01

    Full Text Available This work reports the preparation of hydrogels based on PVA-GMA, PVA-GMA is poly(vinyl alcohol (PVA functionalized with vinyl groups from glycidyl methacrylate (GMA, and on PVA-GMA with different content of chondroitin sulfate (CS. The degrees of swelling of PVA-GMA and PVA-GMA/CS hydrogels were evaluated in distilled water and the swelling kinetics was performed in simulated gastric and intestinal fluids (SGF and SIF. PVA-GMA and PVAGMA/CS hydrogels demonstrated to be resistant on SGF and SIF fluids. The elastic modulus, E, of swollen-hydrogels were determined through compressive tests and, according to the obtained results, the hydrogels presented good mechanical properties. At last, the presence of CS enhances the hydrogel cell compatibility as gathered by cytotoxicity assays. It was concluded that the hydrogels prepared through this work presented characteristics that allow them to be used as biomaterial, as a carrier in drug delivery system or to act as scaffolds in tissue engineering as well.

  6. Temperature Histories of Structural Steel Laser and Hybrid Laser-GMA Welds Calculated Using Multiple Constraints

    Science.gov (United States)

    2015-12-10

    Laboratory (Ret.), private communication. 33. S. Kou, Welding Metallurgy , 2nd Ed., John Wiley & Sons, Inc., 2003. DOI: 10.1002/0471434027. 34. J. K...Naval Research Laboratory Washington, DC 20375-5320 NRL/MR/6390--15-9665 Temperature Histories of Structural Steel Laser and Hybrid Laser-GMA Welds ...NUMBER OF PAGES 17. LIMITATION OF ABSTRACT Temperature Histories of Structural Steel Laser and Hybrid Laser-GMA Welds Calculated Using Multiple

  7. Grafting of GMA and some comonomers onto chitosan for controlled release of diclofenac sodium.

    Science.gov (United States)

    Sharma, Rajeev Kr; Lalita; Singh, Anirudh P; Chauhan, Ghanshyam S

    2014-03-01

    In order to develop pH sensitive hydrogels for controlled drug release we have graft copolymerized glycidyl methacrylate (GMA) with comonomers acrylic acid, acrylamide and acrylonitrile, onto chitosan (Ch) by using potassium persulphate (KPS) as free radical initiator in aqueous solution. The optimum percent grafting for GMA was recorded for 1g chitosan at [KPS]=25.00 × 10(-3)mol/L, [GMA]=0.756 × 10(-3)mol/L, reaction temperature=60 °C and reaction time=1h in 20 mL H2O. Binary monomers were grafted for five different concentrations at optimum grafting conditions evaluated for GMA alone onto chitosan. The graft copolymers were characterized by FTIR, XRD, TGA and SEM. The swelling properties of chitosan and graft copolymers were investigated at different pH to define their end uses in sustained release of an anti-inflammatory drug, diclofenac sodium. Percent drug release w.r.t. drug loaded in polymeric sample was studied as function of time in buffer solutions of pH 2.0 and 7.4. In vitro release data was analyzed using Fick's Law. Chitosan grafted with binary monomers, GMA-co-AAm and GMA-co-AN showed very good results for sustained release of drug at 7.4 pH. Copyright © 2014 Elsevier B.V. All rights reserved.

  8. Building a robust distributed system: some lessons from R-GMA

    International Nuclear Information System (INIS)

    Bhatti, P; Duncan, A; Fisher, S M; Jiang, M; Kuseju, A O; Paventhan, A; Wilson, A J

    2008-01-01

    R-GMA, as deployed by LCG, is a large distributed system. We are currently addressing some design issues to make it highly reliable, and fault tolerant. In validating the new design, there were two classes of problems to consider: one related to the flow of data and the other to the loss of control messages. R-GMA streams data from one place to another; there is a need to consider the behaviour when data is being inserted more rapidly into the system than taken out and more generally how to deal with bottlenecks. In the original R-GMA design the system tried hard to deliver all control messages; those messages that were not delivered quickly were queued for retry later. Badly configured firewalls, network problems or very slow machines could all lead to long queues of messages; many of the messages on the queue should have been replaced by later ones. In the new design no individual control message is critical; the system just needs to know if each message was received successfully. The system should also avoid single points of failure. However this can require complex code resulting in a system that is actually less reliable. We describe how we have dealt with bottlenecks in the flow of data, loss of control messages and the elimination of single points of failure to produce a robust R-GMA design. The work presented, though in the context of R-GMA, is applicable to any large distributed system

  9. Effect of glycidyl methacrylate (GMA) incorporation on water uptake and conductivity of proton exchange membranes

    Science.gov (United States)

    Sproll, Véronique; Schmidt, Thomas J.; Gubler, Lorenz

    2018-03-01

    The aim of this work was to investigate how hygroscopic moieties like hydrolyzed glycidyl methacrylate (GMA) influence the properties of sulfonated polysytrene based proton exchange membranes (PEM). Therefore, several membranes were synthesized by electron beam treatment of the ETFE (ethylene-alt-tetrafluoroethylene) base film with a subsequent co-grafting of styrene and GMA at different ratios. The obtained membranes were sulfonated to introduce proton conducting groups and the epoxide moiety of the GMA unit was hydrolyzed for a better water absorption. The PEM was investigated regarding its structural composition, water uptake and through-plane conductivity. It could be shown that the density of sulfonic acid groups has a higher influence on the proton conductivity of the PEM than an increased water uptake.

  10. Test and intercomparisons of data fitting with general least squares code GMA versus Bayesian code GLUCS

    International Nuclear Information System (INIS)

    Pronyaev, V.G.

    2003-01-01

    Data fitting with GMA and GLUCS gives consistent results. Difference in the evaluated central values obtained with different formalisms can be related to the general accuracy with which fits could be done in different formalisms. It has stochastic nature and should be accounted in the final results of the data evaluation as small SERC uncertainty. Some shift in central values of data evaluated with GLUCS and GMA relative the central values evaluated with the R-matrix model code RAC is observed for cases of fitting strongly varying data and is related to the PPP. The procedure of evaluation, free from PPP, should be elaborated. (author)

  11. Tester-assisted built in test

    Science.gov (United States)

    Guntheroth, Kurt

    It is noted that board makers invest considerable time and money writing extensive self-tests and that this investment can be multiplied by selecting ATE (automatic test equipment) that complements and extends the power of the self-test. The tester can diagnose boards in situations where a fault prevents the self-test from running. If the tester monitors such resources as processor, memory, and I/O, confidence in test results is improved. The tester can be used during development of the self-test and to turn on prototypes before the self-test is complete. The author argues that emulative functional testers outperform other types of ATE on boards with BIST (built-in self-test) and lists features of emulative functional testers that are most important to users of BIST.

  12. Reversible adsorption of catalase onto Fe(3+) chelated poly(AAm-GMA)-IDA cryogels.

    Science.gov (United States)

    Aktaş Uygun, Deniz; Uygun, Murat; Akgöl, Sinan; Denizli, Adil

    2015-05-01

    In this presented study, poly(acrylamide-glycidyl methacrylate) [poly(AAm-GMA)] cryogels were synthesized by cryopolymerization technique at sub-zero temperature. Prepared cryogels were then functionalized with iminodiacetic acid (IDA) and chelated with Fe(3+) ions in order produce the metal chelate affinity matrix. Synthesized cryogels were characterized with FTIR, ESEM and EDX analysis, and it was found that the cryogel had sponge like structure with interconnected pores and their pore diameter was about 200 μm. Fe(3+) chelated poly(AAm-GMA)-IDA cryogels were used for the adsorption of catalase and optimum adsorption conditions were determined by varying the medium pH, initial catalase concentration, temperature and ionic strength. Maximum catalase adsorption onto Fe(3+) chelated poly(AAm-GMA)-IDA cryogel was found to be 12.99 mg/g cryogel at 25 °C, by using pH 5.0 acetate buffer. Adsorbed catalase was removed from the cryogel by using 1.0M of NaCl solution and desorption yield was found to be 96%. Additionally, reusability profile of the Fe(3+) chelated poly(AAm-GMA)-IDA cryogel was also investigated and it was found that, adsorption capacity of the cryogels didn't decrease significantly at the end of the 40 reuses. Catalase activity studies were also tested and it was demonstrated that desorbed catalase retained 70% of its initial activity. Copyright © 2015 Elsevier B.V. All rights reserved.

  13. Preparation of a Bis-GMA-Free Dental Resin System with Synthesized Fluorinated Dimethacrylate Monomers

    Directory of Open Access Journals (Sweden)

    Shuzhen Luo

    2016-12-01

    Full Text Available With the aim of reducing human exposure to Bisphenol A (BPA derivatives in dentistry, a fluorinated dimethacrylate monomer was synthesized to replace 2,2-bis[4-(2-hydroxy-3-methacryloy-loxypropyl-phenyl]propane (Bis-GMA as the base monomer of dental resin. After mixing with reactive diluent triethyleneglycol dimethacrylate (TEGDMA, fluorinated dimethacrylate (FDMA/TEGDMA was prepared and compared with Bis-GMA/TEGDMA in physicochemical properties, such as double bond conversion (DC, volumetric shrinkage (VS, water sorption (WS and solubility (WSL, flexural strength (FS and modulus (FM. The results showed that, when compared with Bis-GMA based resin, FDMA-based resin had several advantages, such as higher DC, lower VS, lower WS, and higher FS after water immersion. All of these revealed that FDMA had potential to be used as a substitute for Bis-GMA. Of course, many more studies, such as biocompatibility testing, should be undertaken to prove whether FDMA could be applied in clinic.

  14. MWCNTs/P(St-co-GMA) composite nanofibers of engineered interface chemistry for epoxy matrix nanocomposites.

    Science.gov (United States)

    Özden-Yenigün, Elif; Menceloğlu, Yusuf Z; Papila, Melih

    2012-02-01

    Strengthened nanofiber-reinforced epoxy matrix composites are demonstrated by engineering composite electrospun fibers of multi-walled carbon nanotubes (MWCNTs) and reactive P(St-co-GMA). MWCNTs are incorporated into surface-modified, reactive P(St-co-GMA) nanofibers by electrospinning; functionalization of these MWCNT/P(St-co-GMA) composite nanofibers with epoxide moieties facilitates bonding at the interface of the cross-linked fibers and the epoxy matrix, effectively reinforcing and toughening the epoxy resin. Rheological properties are determined and thermodynamic stabilization is demonstrated for MWCNTs in the P(St-co-GMA)-DMF polymer solution. Homogeneity and uniformity of the fiber formation within the electrospun mats are achieved at polymer concentration of 30 wt %. Results show that the MWCNT fraction decreases the polymer solution viscosity, yielding a narrower fiber diameter. The fiber diameter drops from an average of 630 nm to 460 nm, as the MWCNTs wt fraction (1, 1.5, and 2%) is increased. The electrospun nanofibers of the MWCNTs/P(St-co-GMA) composite are also embedded into an epoxy resin to investigate their reinforcing abilities. A significant increase in the mechanical response is observed, up to >20% in flexural modulus, when compared to neat epoxy, despite a very low composite fiber weight fraction (at about 0.2% by a single-layer fibrous mat). The increase is attributed to the combined effect of the two factors the inherent strength of the well-dispersed MWCNTs and the surface chemistry of the electrospun fibers that have been modified with epoxide to enable cross-linking between the polymer matrix and the nanofibers.

  15. Biofilms in churches built in grottoes

    International Nuclear Information System (INIS)

    Cennamo, Paola; Montuori, Naomi; Trojsi, Giorgio; Fatigati, Giancarlo; Moretti, Aldo

    2016-01-01

    We investigated microorganisms dwelling on rocks, walls and paintings in two votive chapels built in grottoes in the Region of Campania, Italy. One grotto was near the coast in an area with a Mediterranean climate, and the other grotto was inland on a mountain in an area with a cold continental climate. Color and distribution of biofilms in various areas of the grottoes were examined. Microbial components of biofilms were identified by light and electron microscopy and by molecular techniques (DNA analyses and Automatic rRNA Intergenic Spacer Analysis). Biofilms were also analyzed by X-ray diffraction to detect inorganic constituents deriving from rocks in the grottoes and walls of the churches and by X-ray fluorescence to detect the elements that made up the pigments of the mural paintings; optical cross sections were used to observe their relationships with substrata. Species of eubacteria, cyanobacteria and green algae were identified. Some of these species occurred in both grottoes, while others were exclusive to only one of the grottoes. The diversity of species, their common or exclusive occurrence in the grottoes, the relationships among microbial communities and the differences in color and distribution of biofilms were discussed on the basis of the different climatic factors affecting the two grottoes and the different inorganic components of substrata. - Highlights: • Biofilms concur to the degradation of cultural heritage. • Microorganisms cause esthetic and structural damage in votive churches. • Biofilm features vary on different substrata, as limestone, plaster and paintings. • Features of biofilms mainly depend on environmental conditions. • Molecular biology techniques are indispensable in the study of biodegradation.

  16. Biofilms in churches built in grottoes

    Energy Technology Data Exchange (ETDEWEB)

    Cennamo, Paola, E-mail: paola.cennamo@unisob.na.it [Facoltà di Lettere, Università degli Studi Suor Orsola Benincasa di Napoli, Via Santa Caterina da Siena 37, 80135 Naples (Italy); Montuori, Naomi [Dipartimento di Biologia, Università degli Studi di Napoli Federico II, Via Foria 223, 80139 Naples (Italy); Trojsi, Giorgio; Fatigati, Giancarlo [Facoltà di Lettere, Università degli Studi Suor Orsola Benincasa di Napoli, Via Santa Caterina da Siena 37, 80135 Naples (Italy); Moretti, Aldo [Dipartimento di Biologia, Università degli Studi di Napoli Federico II, Via Foria 223, 80139 Naples (Italy)

    2016-02-01

    We investigated microorganisms dwelling on rocks, walls and paintings in two votive chapels built in grottoes in the Region of Campania, Italy. One grotto was near the coast in an area with a Mediterranean climate, and the other grotto was inland on a mountain in an area with a cold continental climate. Color and distribution of biofilms in various areas of the grottoes were examined. Microbial components of biofilms were identified by light and electron microscopy and by molecular techniques (DNA analyses and Automatic rRNA Intergenic Spacer Analysis). Biofilms were also analyzed by X-ray diffraction to detect inorganic constituents deriving from rocks in the grottoes and walls of the churches and by X-ray fluorescence to detect the elements that made up the pigments of the mural paintings; optical cross sections were used to observe their relationships with substrata. Species of eubacteria, cyanobacteria and green algae were identified. Some of these species occurred in both grottoes, while others were exclusive to only one of the grottoes. The diversity of species, their common or exclusive occurrence in the grottoes, the relationships among microbial communities and the differences in color and distribution of biofilms were discussed on the basis of the different climatic factors affecting the two grottoes and the different inorganic components of substrata. - Highlights: • Biofilms concur to the degradation of cultural heritage. • Microorganisms cause esthetic and structural damage in votive churches. • Biofilm features vary on different substrata, as limestone, plaster and paintings. • Features of biofilms mainly depend on environmental conditions. • Molecular biology techniques are indispensable in the study of biodegradation.

  17. Poly(GMA/MA/MBAA) Copolymer Beads: a Highly Efficient Support Immobilizing Penicillin G Acylase

    Institute of Scientific and Technical Information of China (English)

    Ping XUE; Guan Zhong LU; Wan Yi LIU

    2006-01-01

    The hydrophilic, macroporous and beaded ternary copolymer of glycidyl methacrylate (GMA)/methacrylamide(MA)/N,N'-methylene-bis(acrylamide)(MBAA)was synthesized using the industrial agents by inverse suspension polymerization. The apparent activity of the immobilized penicillin G acylase reached 1096 IU/g for hydrolysis penicillin G on the beads with diameter of 0.11-0.13 mm, and it changed hardly after 50 cycles. It can be expected to be a good potential in industrial application.

  18. In vitro blood and fibroblast responses to BisGMA-TEGDMA/bioactive glass composite implants.

    Science.gov (United States)

    Abdulmajeed, Aous A; Kokkari, Anne K; Käpylä, Jarmo; Massera, Jonathan; Hupa, Leena; Vallittu, Pekka K; Närhi, Timo O

    2014-01-01

    This in vitro study was designed to evaluate both blood and human gingival fibroblast responses to bisphenol A-glycidyl methacrylate-triethyleneglycol dimethacrylate (BisGMA-TEGDMA)/bioactive glass (BAG) composite, aimed to be used as composite implant abutment surface modifier. Three different types of substrates were investigated: (a) plain polymer (BisGMA 50 wt%-TEGDMA 50 wt%), (b) BAG-composite (50 wt% polymer + 50 wt% fraction of BAG-particles, <50 μm), and (c) plain BAG plates (100 wt% BAG). The blood response, including the blood-clotting ability and platelet adhesion morphology were evaluated. Human gingival fibroblasts were plated and cultured on the experimental substrates for up to 10 days, then the cell proliferation rate was assessed using AlamarBlue assay™. The BAG-composite and plain BAG substrates had a shorter clotting time than plain polymer substrates. Platelet activation and aggregation were most extensive, qualitatively, on BAG-composite. Analysis of the normalized cell proliferation rate on the different surfaces showed some variations throughout the experiment, however, by day 10 the BAG-composite substrate showed the highest (P < 0.001) cell proliferation rate. In conclusion, the presence of exposed BAG-particles enhances fibroblast and blood responses on composite surfaces in vitro.

  19. Transparent dispersion compensator with built-in gain equalizer

    DEFF Research Database (Denmark)

    Rottwitt, Karsten; Doerr, C.

    2002-01-01

    In this work we describe a method to obtain a transparent or even an amplifying dispersion compensating module with built-in gain equalization functionality. The principle of operation and experimental results are illustrated.......In this work we describe a method to obtain a transparent or even an amplifying dispersion compensating module with built-in gain equalization functionality. The principle of operation and experimental results are illustrated....

  20. Visible light cure characteristics of a cycloaliphatic polyester dimethacrylate alternative oligomer to bisGMA.

    Science.gov (United States)

    Vaidyanathan, Tritala K; Vaidyanathan, Jayalakshmi

    2015-12-01

    Objective : The goal of this study was to characterize the light curing characteristics of a new oligomer PEM-665 designed to be used as an alternative monomer to BisGMA. Materials and methods : PEM-665 (P) and BisGMA (B) solutions were prepared with triethylene glycol dimethacrylate (T) diluent in different weight proportions (70/30 and 50/50). Solutions containing 70% P and 30% T were designated as 70PT, 70%B and 30%T as 70BT, 50%P and 50%T as 50PT and 50%B and 50%T as 50BT. The initiators were CQ (EDMAB was used as amine accelerator for CQ) and DPO in 1% concentration. Eight solutions were prepared in a factorial design: 70PT/DPO; 70PT/CQ; 50PT/DPO; 50PT/CQ; 70BT/DPO; 70BT/CQ; 50BT/DPO; 50BT/CQ. BISCO VIP visible light was used to cure the monomer solutions using 30 s exposure time and 400 W power setting. TA Instruments Differential Scanning Calorimeter (DSC 2910) was used to determine the heat of cure (J/g) during polymerization at 37 °C, from which molar heat of cure (kJ/mole) and %Conversion values were estimated. Results : Range of mean values as a function monomer selections were: heat of cure (J/g): 161.7 for 70PT/DPO system to 198.6 for 50BT/CQ system; molar heat of cure (kJ/mole): 67.3 for 70BT/DPO to 78.86 for 50PT/CQ; % conversion: 59.9 for 70BT/DPO to 70.3 for 50PT/CQ. Analysis of variance and Tukey HSD pairwise contrast showed statistically significant differences between % conversion means of PEM and BisGMA mixtures, with PEM mixtures showing significantly higher mean values. Conclusions : The results suggest that PEM-665 is a promising candidate material for dental polymer applications.

  1. Performance of R-GMA based grid job monitoring system for CMS data production

    CERN Document Server

    Byrom, Robert; Fisher, Steve M; Grandi, Claudio; Hobson, Peter R; Kyberd, Paul; MacEvoy, Barry; Nebrensky, Jindrich Josef; Tallini, Hugh; Traylen, Stephen

    2004-01-01

    High Energy Physics experiments, such as the Compact Muon Solenoid (CMS) at the CERN laboratory in Geneva, have large-scale data processing requirements, with stored data accumulating at a rate of 1 Gbyte/s. This load comfortably exceeds any previous processing requirements and we believe it may be most efficiently satisfied through Grid computing. Management of large Monte Carlo productions (~3000 jobs) or data analyses and the quality assurance of the results requires careful monitoring and bookkeeping, and an important requirement when using the Grid is the ability to monitor transparently the large number of jobs that are being executed simultaneously at multiple remote sites. R-GMA is a monitoring and information management service for distributed resources based on the Grid Monitoring Architecture of the Global Grid Forum. We have previously developed a system allowing us to test its performance under a heavy load while using few real Grid resources. We present the latest results on this system and comp...

  2. A Non-Intrusive GMA Welding Process Quality Monitoring System Using Acoustic Sensing.

    Science.gov (United States)

    Cayo, Eber Huanca; Alfaro, Sadek Crisostomo Absi

    2009-01-01

    Most of the inspection methods used for detection and localization of welding disturbances are based on the evaluation of some direct measurements of welding parameters. This direct measurement requires an insertion of sensors during the welding process which could somehow alter the behavior of the metallic transference. An inspection method that evaluates the GMA welding process evolution using a non-intrusive process sensing would allow not only the identification of disturbances during welding runs and thus reduce inspection time, but would also reduce the interference on the process caused by the direct sensing. In this paper a nonintrusive method for weld disturbance detection and localization for weld quality evaluation is demonstrated. The system is based on the acoustic sensing of the welding electrical arc. During repetitive tests in welds without disturbances, the stability acoustic parameters were calculated and used as comparison references for the detection and location of disturbances during the weld runs.

  3. Influence of ionizing radiation on the mechanical properties of BisGMA/TEGDMA based experimental resin

    International Nuclear Information System (INIS)

    LMP, Campos; Boaro, LC; LKG, Santos; Parra, DF; Lugão, AB

    2015-01-01

    Dental restorative composites are activated by visible light and the polymerization process, known as direct technique, is initiated by absorbing light in a specific wavelength range (450–500 nm). However this technique presented some disadvantages. If light is not inserted correctly, layers uncured can cause countless damage to restoration, especially with regard to mechanical properties. A clinical alternative used to reduce the shortcomings of direct application is the use of composite resins for indirect application. These composites are adaptations of resins prepared for direct use, with differences mainly in the healing process. Besides the traditional photoactivation, indirect application composites may be submitted to particular curing conditions, such as a slow curing rate, heating, vacuum, and inert-gas pressure leading to an oxygen-free environment. However few studies have been conducted on the process of post-curing by ionizing radiation at low doses. On this sense the purpose of this study was to evaluate possible interactions of ionizing radiation in the post-curing process of the experimental composites based on BisGMA/TEGDMA filled with silica Aerosil OX-50 silanized. Characterization of the experimental composites was performed by thermogravimetry analysis, infrared spectroscopy, elastic modulus and flexural strength. Statistical analysis of results was calculated by one-way ANOVA/Tukey's test. Cross-linking of the polymeric matrix caused by ionizing radiation, influenced the thermal stability of irradiated specimens. FTIR analysis showed that the ionizing radiation induced a post-cure reaction in the specimens. The irradiation dose influenced directly the mechanical properties that showed a strong positive correlation between flexural strength and irradiation and between modulus strength and irradiation. - Highlights: • Interactions of ionizing radiation in BisGMA/TEGDMA experimental dental composites filled with sylanized silica.

  4. BisGMA-polyvinylpyrrolidone blend based nanocomposites reinforced with chitosan grafted f-multiwalled carbon nanotubes

    Directory of Open Access Journals (Sweden)

    A. Praharaj

    2015-01-01

    Full Text Available In this work, initially a non-destroyable surface grafting of acid functionalized multiwalled carbon nanotubes (f-MWCNTs with biopolymer chitosan (CS was carried out using glutaraldehyde as a cross-linking agent via the controlled covalent deposition method which was characterized by Fourier transform infrared spectroscopy (FTIR and scanning electron microscopy (SEM. Then, BisGMA (bisphenol-A glycidyldimethacrylate-polyvinylpyrrolidone (PVP blend was prepared (50:50 wt% by a simple sonication method. The CS grafted f-MWCNTs (CS/f-MWCNTs were finally dispersed in BisGMA-PVP blend (BGP50 system in different compositions i.e. 0, 2, 5 and 7 wt% and pressed into molds for the fabrication of reinforced nanocomposites which were characterized by SEM. Nanocomposites reinforced with 2 wt% raw MWCNTs and acid f-MWCNTs were also fabricated and their properties were studied in detail. The results of comparative study report lower values of the investigated properties in nanocomposites with 2 wt% raw and f-MWCNTs than the one with 2 wt% CS/f-MWCNTs proving it to be a better reinforcing nanofiller. Further, the mechanical behavior of the nanocomposites with various CS/f-MWCNTs content showed a dramatic increase in Young’s Modulus, tensile strength, impact strength and hardness along with improved dynamic mechanical, thermal and electrical properties at 5 wt% content of CS/f-MWCNTs. The addition of CS/f-MWCNTs also resulted in reduced corrosion and swelling properties. Thus, the fabricated nanocomposites with optimum nanofiller content could serve as low cost and light weight structural, thermal and electrical materials compatible in various corrosive and solvent based environments.

  5. Studies on preparing and adsorption property of grafting terpolymer microbeads of PEI-GMA/AM/MBA for bilirubin.

    Science.gov (United States)

    Gao, Baojiao; Lei, Haibo; Jiang, Liding; Zhu, Yong

    2007-06-15

    Crosslinking copolymer microbeads with a diameter range of 100-150 microm were synthesized by suspension copolymerization of glycidyl methacrylate (GMA), acrylamide (AM) and N,N'-methylene bisacrylamide (MBA). Subsequently, polyethyleneimine (PEI) was grafted on the surfaces of the terpolymer microbeads GMA/AM/MBA via the ring-opening reaction of the epoxy groups, and the grafting microbeads PEI-GMA/AM/MBA were prepared. In this paper, the adsorption property of the grafting microbeads for bilirubin was mainly investigated, and the effects of various factors, such as pH value, ionic strength and grafting degree of PEI on the surface of grafting microbeads and the adsorption capacity of the grafting microbeads for bilirubin were examined. The batch adsorption experiment results show that by right of the action of grafted polyamine macromolecules PEI, the grafting microbeads PEI-GMA/AM/MBA have quite strong adsorption ability for bilirubin; the isotherm adsorption conforms to Freundlich equation. The pH value of the medium affects the adsorption capacity greatly, As in the nearly neutral solutions with pH 6, the grafting microbeads have the strongest adsorption ability for bilirubin, whereas in acidic and basic solutions their adsorption ability is weak. The ionic strength hardly affects the adsorption ability of the grafting microbeads. The grafting degree of PEI on the surfaces of the grafting microbeads also has a great effect on the adsorption capacity, and higher the grafting degree of PEI on the surface of the microbead PEI-GMA/AM/MBA, the stronger is the adsorption ability of the microbeads.

  6. 26 CFR 1.1374-2 - Net recognized built-in gain.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 11 2010-04-01 2010-04-01 true Net recognized built-in gain. 1.1374-2 Section 1...-in gain. (a) In general. An S corporation's net recognized built-in gain for any taxable year is the... considering only its recognized built-in gain, recognized built-in loss, and recognized built-in gain...

  7. Hydrophilic porous magnetic poly(GMA-MBAA-NVP) composite microspheres containing oxirane groups: An efficient carrier for immobilizing penicillin G acylase

    Energy Technology Data Exchange (ETDEWEB)

    Xue, Ping; Su, Weiguang, E-mail: weiguangsu@nxu.edu.cn; Gu, Yaohua; Liu, Haifeng; Wang, Julan

    2015-03-15

    Magnetic hydrophilic polymeric microspheres containing oxirane groups were prepared by inverse suspension polymerization of glycidyl methacrylate (GMA), N, N′-methylene bisacrylamide (MBAA) and N-vinyl pyrrolidone (NVP) in the existence of formamide, which were denoted as magnetic poly(GMA-MBAA-NVP) microspheres. The magnetic poly(GMA-MBAA-NVP) microspheres were characterized by scanning electron microscopy (SEM), FT-IR spectroscopy, X-ray diffraction (XRD), vibrating sample magnetometer (VSM) and so on. The results showed that poly(GMA-MBAA-NVP) microspheres possessed well spherical shape, narrow size distribution, abundant porous structure, reactive oxirane groups and superparamagnetic properties. Formamide used in the present work served as a modifier, a dispersant and a porogen to form final porous polymer microspheres. The penicillin G acylase (PGA) was covalently immobilized onto the magnetic microspheres through the reaction between the amino groups of enzyme and the oxirane groups on the microspheres for producing 6-aminopenicillanic acid (6-APA). The effects of GMA/NVP ratio and crosslink density on the activity of immobilized PGA were investigated. The highest apparent activity, enzyme loading and coupling yield of immobilized PGA were 821 IU/g, 65.3 mg/g and 42.3% respectively when the mass ratio of GMA/NVP was 1:1 and crosslink density was 60%. Compared with the free PGA, immobilized PGA showed a wider range of pH value and reaction temperature. The relative activity and reaction rate of immobilized PGA remained almost constant after 20 recycles. The magnetic poly(GMA-MBAA-NVP) microspheres would be very promising carriers for immobilizing enzymes in industrial application. - Highlights: • The magnetic poly(GMA-MBAA-NVP) microspheres were successfully synthesized. • Formamide served as a modifier, a dispersant and a porogen to form microspheres. • The magnetic microspheres were highly efficient carriers for immobilizing PGA. • Immobilized PGA

  8. EM Modeling of Far-Field Radiation Patterns for Antennas on the GMA-TT UAV

    Science.gov (United States)

    Mackenzie, Anne I.

    2015-01-01

    To optimize communication with the Generic Modular Aircraft T-Tail (GMA-TT) unmanned aerial vehicle (UAV), electromagnetic (EM) simulations have been performed to predict the performance of two antenna types on the aircraft. Simulated far-field radiation patterns tell the amount of power radiated by the antennas and the aircraft together, taking into account blockage by the aircraft as well as radiation by conducting and dielectric portions of the aircraft. With a knowledge of the polarization and distance of the two communicating antennas, e.g. one on the UAV and one on the ground, and the transmitted signal strength, a calculation may be performed to find the strength of the signal travelling from one antenna to the other and to check that the transmitted signal meets the receiver system requirements for the designated range. In order to do this, the antenna frequency and polarization must be known for each antenna, in addition to its design and location. The permittivity, permeability, and geometry of the UAV components must also be known. The full-wave method of moments solution produces the appropriate dBi radiation pattern in which the received signal strength is calculated relative to that of an isotropic radiator.

  9. The Adsorption of Calmoduline via Nicotinamide Immobilized Poly(HEMA-GMA Cryogels

    Directory of Open Access Journals (Sweden)

    Kadir Erol

    2016-12-01

    Full Text Available The separation and purification methods for the isolation of an important biomolecule calmoduline protein is extremely important. Among these methods, the adsorption technique is extremely popular, and the cryogels as adsorbents with the macro porous structure and interconnected flow channels cryogel they have are preferred in this field. In this study, the adsorption of calmoduline via Ca(II immobilized poly (2-hydroxyethyl methacrylate-glycidyl methacrylate, poly (HEMA-GMA, cryogels through changing interaction time, calmoduline initial concentration and temperature conditions. For the characterization of cryogels, the swelling test, Fourier Transform Infrared (FT-IR Spectroscopy, Scanning Electron Microscopy (SEM, surface area (BET, elemental analysis and ICP-OES methods were performed. Nicotinamide molecule was used as Ca (II chelating agent and the adsorption capacity of the cryogels was estimated as 1.812 mg calmoduline / g cryogel. The adsorption models of the adsorption reaction were examined by the Langmuir and Freundlich isotherm models and was determined to be more appropriate for Langmuir isotherm model.

  10. Smart built-in test for nuclear thermal propulsion

    International Nuclear Information System (INIS)

    Lombrozo, P.C.

    1992-03-01

    Smart built-in test (BIT) technologies are envisioned for nuclear thermal propulsion spacecraft components which undergo constant irradiation and are therefore unsafe for manual testing. Smart BIT systems of automated/remote type allow component and system tests to be conducted; failure detections are directly followed by reconfiguration of the components affected. The 'smartness' of the BIT system in question involves the reduction of sensor counts via the use of multifunction sensors, the use of components as integral sensors, and the use of system design techniques which allow the verification of system function beyond component connectivity

  11. Solar Biogas Digester with Built-In Reverse Absorber Heater

    Directory of Open Access Journals (Sweden)

    Khasan S. Karimov

    2013-01-01

    Full Text Available In this work the design, fabrication and investigation of a solar biogas digester with built-in RAH (Reverse Absorber Heater is presented. The maximum temperature (50 o C inside of the methane tank was taken as a main parameter at the design of the digester. Using energy balance equation for the case of a static mass of fluid being heated; the parameters of thermal insulation of the methane tank were counted. The biogas digester is consisting of methane tank with built-in solar RAH to utilize solar energy for the heating of the slurry prepared from the different organic wastes (dung, sewage, food wastes etc. The methane tank was filled up to 70% of volume by organic wastes of the GIK Institute sewage, firstly, and secondly, by sewage and cow dung as well. During three months (October-December, 2009 and two months (February-March, 2010 the digester was investigated. The solar irradiance incident to the absorber, slurry's temperature and ambient temperature were measured. It was found that using sewage only and sewage with cow dung the retention times was 4 weeks and two weeks respectively and biogas quantity produced was 0.4 and 8.0 m 3 respectively. In addition, biogas upgradation scheme for removal of carbon dioxide, hydrogen sulphide and water vapor from biogas and conversion of biogas energy conversion into electric power is also discussed.

  12. Hydrophilic porous magnetic poly(GMA-MBAA-NVP) composite microspheres containing oxirane groups: An efficient carrier for immobilizing penicillin G acylase

    Science.gov (United States)

    Xue, Ping; Su, Weiguang; Gu, Yaohua; Liu, Haifeng; Wang, Julan

    2015-03-01

    Magnetic hydrophilic polymeric microspheres containing oxirane groups were prepared by inverse suspension polymerization of glycidyl methacrylate (GMA), N, N‧-methylene bisacrylamide (MBAA) and N-vinyl pyrrolidone (NVP) in the existence of formamide, which were denoted as magnetic poly(GMA-MBAA-NVP) microspheres. The magnetic poly(GMA-MBAA-NVP) microspheres were characterized by scanning electron microscopy (SEM), FT-IR spectroscopy, X-ray diffraction (XRD), vibrating sample magnetometer (VSM) and so on. The results showed that poly(GMA-MBAA-NVP) microspheres possessed well spherical shape, narrow size distribution, abundant porous structure, reactive oxirane groups and superparamagnetic properties. Formamide used in the present work served as a modifier, a dispersant and a porogen to form final porous polymer microspheres. The penicillin G acylase (PGA) was covalently immobilized onto the magnetic microspheres through the reaction between the amino groups of enzyme and the oxirane groups on the microspheres for producing 6-aminopenicillanic acid (6-APA). The effects of GMA/NVP ratio and crosslink density on the activity of immobilized PGA were investigated. The highest apparent activity, enzyme loading and coupling yield of immobilized PGA were 821 IU/g, 65.3 mg/g and 42.3% respectively when the mass ratio of GMA/NVP was 1:1 and crosslink density was 60%. Compared with the free PGA, immobilized PGA showed a wider range of pH value and reaction temperature. The relative activity and reaction rate of immobilized PGA remained almost constant after 20 recycles. The magnetic poly(GMA-MBAA-NVP) microspheres would be very promising carriers for immobilizing enzymes in industrial application.

  13. Guidelines on the prevention of built-in moisture

    DEFF Research Database (Denmark)

    Hansen, Ernst Jan de Place; Møller, Eva B.

    2014-01-01

    As a result of built-in-moisture, a number of buildings in Denmark were attacked by moulds even before the users moved in. Therefore, the Danish Building Regulations have since 2008 stipulated that building structures and materials must not, on moving in, have a moisture content that is liable...... the execution phase and the building’s capacity to withstand moisture. It also specifies how moisture should be dealt with in the general quality assurance system of the building industry. The Danish guideline is compared with similar guidelines and tools in other Nordic countries. The education of moisture...... specialists is emphasised and it is questioned whether a voluntary guideline will have the desired effect....

  14. A charge exchange chamber with built-in focusing

    International Nuclear Information System (INIS)

    Devienne, F.M.

    1975-01-01

    This invention concerns a charge exchange chamber with built-in focusing enabling a beam of low divergence neutrals to be obtained from a beam of ions of a given energy. The ion beam enters the charge exchange chamber filled with a neutral gas under pressure, the effect of which is an exchange of charges between the ions and the neutral molecules or atoms of the gas. The positive ions are substantially sent along the axis of the enclosure, characterised in that it includes electric facilities for concentrating the ions of the beam near this axis. These electric facilities are composed of a series of grids perpendicular to the direction of the ion jet, grids that are transparent and of negative potential and the potential of each of these grids increases in absolute value along the path of the ion jet in the enclosure [fr

  15. How could the topic patient safety be embedded in the curriculum? A recommendation by the Committee for Patient Safety and Error Management of the GMA.

    Science.gov (United States)

    Kiesewetter, Jan; Drossard, Sabine; Gaupp, Rainer; Baschnegger, Heiko; Kiesewetter, Isabel; Hoffmann, Susanne

    2018-01-01

    The topic of patient safety is of fundamental interest for the health care sector. In view of the realisation of the National Competence-Based Learning Objectives Catalogue for Undergraduate Medical Education (NKLM) this topic now has to be prepared for medical education. For a disciplinary and content-related orientation the GMA Committee developed the Learning Objectives Catalogue Patient Safety for Undergraduate Medical Education (GMA-LZK). To ensure an optimal implementation of the GMA-LZK we recommend a longitudinal embedding into the existing curriculum. This position paper supports the implementation of the GMA-LZK and is aimed at everyone who wants to establish teaching courses on the topic patient safety and embed them in the curriculum. In light of this, we will initially describe the key features for a structured analysis of the current situation. Based on three best-practice-examples, as seen in the faculties of Freiburg, Bonn and Munich, different approaches to the implementation of the GMA-LZK will be illustrated. Lastly, we will outline the methodical requirements regarding the curriculum development as well as the disciplinary and methodical competences that the lecturers will have to hold or develop to fulfil the requirements.

  16. Cryogenic storage tank with built-in pump

    International Nuclear Information System (INIS)

    Zwick, E.B.

    1984-01-01

    A cryogenic storage tank with a built-in pump for pumping cryogen directly from the primary storage container consistent with low boil-off losses of cryogen has an outer vessel, an inner vessel and an evacuated insulation space therebetween. A pump mounting tube assembly extends into the interior of the inner vessel and includes an inner pump mounting tube and an outer pump mounting tube joined at their lower rims to define an insulating jacket between the two tubes. The inner pump mounting tube is affixed at its upper end to the outer vessel while the outer pump mounting tube is affixed at its upper end to the inner vessel. The inner pump mounting tube defines a relatively long heat path into the cryogenic container and is itself insulated from the liquid cryogen by a pocket of trapped gas formed within the inner pump mounting tube by heated cryogen. A pump may be introduced through the inner pump mounting tube and is also insulated against contact with liquid cryogen by the trapped gas such that only the lowermost end of the pump is immersed in cryogen thereby minimizing heat leakage into the tank

  17. Injecting Errors for Testing Built-In Test Software

    Science.gov (United States)

    Gender, Thomas K.; Chow, James

    2010-01-01

    Two algorithms have been conceived to enable automated, thorough testing of Built-in test (BIT) software. The first algorithm applies to BIT routines that define pass/fail criteria based on values of data read from such hardware devices as memories, input ports, or registers. This algorithm simulates effects of errors in a device under test by (1) intercepting data from the device and (2) performing AND operations between the data and the data mask specific to the device. This operation yields values not expected by the BIT routine. This algorithm entails very small, permanent instrumentation of the software under test (SUT) for performing the AND operations. The second algorithm applies to BIT programs that provide services to users application programs via commands or callable interfaces and requires a capability for test-driver software to read and write the memory used in execution of the SUT. This algorithm identifies all SUT code execution addresses where errors are to be injected, then temporarily replaces the code at those addresses with small test code sequences to inject latent severe errors, then determines whether, as desired, the SUT detects the errors and recovers

  18. Scalability tests of R-GMA based Grid job monitoring system for CMS Monte Carlo data production

    CERN Document Server

    Bonacorsi, D; Field, L; Fisher, S; Grandi, C; Hobson, P R; Kyberd, P; MacEvoy, B; Nebrensky, J J; Tallini, H; Traylen, S

    2004-01-01

    High Energy Physics experiments such as CMS (Compact Muon Solenoid) at the Large Hadron Collider have unprecedented, large-scale data processing computing requirements, with data accumulating at around 1 Gbyte/s. The Grid distributed computing paradigm has been chosen as the solution to provide the requisite computing power. The demanding nature of CMS software and computing requirements, such as the production of large quantities of Monte Carlo simulated data, makes them an ideal test case for the Grid and a major driver for the development of Grid technologies. One important challenge when using the Grid for large-scale data analysis is the ability to monitor the large numbers of jobs that are being executed simultaneously at multiple remote sites. R-GMA is a monitoring and information management service for distributed resources based on the Grid Monitoring Architecture of the Global Grid Forum. In this paper we report on the first measurements of R-GMA as part of a monitoring architecture to be used for b...

  19. 76 FR 65634 - Redetermination of the Consolidated Net Unrealized Built-In Gain and Loss

    Science.gov (United States)

    2011-10-24

    ... Redetermination of the Consolidated Net Unrealized Built-In Gain and Loss AGENCY: Internal Revenue Service (IRS... consolidated net unrealized built-in gain and loss in certain circumstances. This document also invites... gain (NUBIG) at the time of its ownership change, recognized built-in gains will increase the section...

  20. 26 CFR 1.1374-3 - Net unrealized built-in gain.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 11 2010-04-01 2010-04-01 true Net unrealized built-in gain. 1.1374-3 Section 1...-in gain. (a) In general. An S corporation's net unrealized built-in gain is the total of the... unrealized built-in gain—(1) In general. If section 1374(d)(8) applies to an S corporation's acquisition of...

  1. The differences of saliva pH before and after application of Bis-GMA resin based-pit and fissure sealant

    Directory of Open Access Journals (Sweden)

    Ayub Irmadani Anwar

    2016-06-01

    Full Text Available Pit and fissure sealant applications is one way to prevent caries. One of the effective ingredient as a pit and fissure sealant is a Bis-GMA resin. One of the active components  of  Bis-GMA  resin  is  sodium  fluoride,  which is capable  of releasing fluoride ions to the tooth surface and able to improve the repair and remineralization process through the replacement  of  calcium and phosphate ions found in saliva to increase the pH of saliva. This study was to determine the effect of pit and fissure sealant applications made from Bis-GMA resin to pH of saliva in children aged 6-12 years. The study design is pre and post test with control group design. Saliva samples were derived from 15 pediatric patients has met the criteria. The pH of saliva were taken before and after the application of pit and fissure sealant made from Bis-GMA and measured with pH meter. This study used a non-parametric test, the Wilcoxon Signed Rank test. The results of this study are also supported by the results of statistical tests showed p-: 0.005 (p<0.05 value, which means that there are significant differences in pH of saliva before and after the application of pit and fissure sealant made from Bis-GMA resin.

  2. BisGMA/TEGDMA dental nanocomposites containing glyoxylic acid modified high-aspect ratio hydroxyapatite nanofibers with enhanced dispersion

    Science.gov (United States)

    Chen, Liang; Xu, Changqi; Wang, Yong; Shi, Jian; Yu, Qingsong

    2012-01-01

    The purpose of this research was to investigate the influence of the glyoxylic acid (GA) modification of hydroxyapatite (HAP) nanofibers on their dispersion in bisphenol A glycidyl methacrylate (BisGMA)/triethylene glycol dimethacrylate (TEGDMA) dental composites and also investigate the mechanical properties, water absorption, and water solubility of the resulting dental resins and composites. Scanning/Transmission electron microscopy (STEM) images showed that microsized HAP nanofiber bundles could be effectively broken down to individual HAP nanofibers with an average length of ~15 μm after the surface modification process. Fourier transform infrared spectroscopy (FT-IR), X-ray photoelectron spectroscopy (XPS) and thermal gravimetric analysis (TGA) characterization confirmed glyoxylic acid was chemically grafted on the HAP nanofiber surface, hypothetically by reacting with the amine group on HAP nanofiber surface. The enhanced dispersion of HAP nanofibers in dental matrix led to increased biaxial flexural strength (BFS) compared with the corresponding dental resins and composites filled with untreated HAP nanofibers. In addition, impregnation of small mass fractions of the glyoxylic acid modified HAP nanofibers into the BisGMA/TEGDMA dental resins (5wt%, 10wt%) or composites (2wt%, 3wt%) could also substantially improve the BFS in comparison with the controls(pure resins or dental composites filled with silica particles alone). Larger mass fractions could not further increase the mechanical property or even degrade the BFS values. Water behavior testing results indicated that the addition of glyoxylic acid modified HAP nanofibers resulted in higher water absorption and water solubility values which is not preferred for clinical application. In summary, well dispersed HAP nanofibers and their dental composites with enhanced mechanical property have been successfully fabricated but the water absorption and water solubility of such dental composites need to be

  3. BisGMA/TEGDMA dental nanocomposites containing glyoxylic acid-modified high-aspect ratio hydroxyapatite nanofibers with enhanced dispersion

    International Nuclear Information System (INIS)

    Chen Liang; Yu Qingsong; Li Hao; Xu Changqi; Wang Yong; Shi Jian

    2012-01-01

    The purpose of this research was to investigate the influence of the glyoxylic acid (GA) modification of hydroxyapatite (HAP) nanofibers on their dispersion in bisphenol A glycidyl methacrylate (BisGMA)/triethylene glycol dimethacrylate (TEGDMA) dental composites and also to investigate the mechanical properties, water absorption and water solubility of the resulting dental resins and composites. Scanning/transmission electron microscopy images showed that microsized HAP nanofiber bundles could be effectively broken down into individual HAP nanofibers with an average length of ∼15 µm after the surface modification process. Fourier transform infrared spectroscopy, x-ray photoelectron spectroscopy and thermal gravimetric analysis characterization confirmed that GA was chemically grafted on the HAP nanofiber surface, hypothetically by reacting with the amine group on the HAP nanofiber surface. The enhanced dispersion of HAP nanofibers in the dental matrix led to increased biaxial flexural strength (BFS) compared with the corresponding dental resins and composites filled with untreated HAP nanofibers. In addition, impregnation of small mass fractions of the GA-modified HAP nanofibers into the BisGMA/TEGDMA dental resins (5 wt%, 10 wt%) or composites (2 wt%, 3 wt%) could also substantially improve the BFS in comparison with the controls (pure resins or dental composites filled with silica particles alone). Larger mass fractions could not increase the mechanical property further or even degraded the BFS values. Water behavior testing results indicated that the addition of the GA-modified HAP nanofibers resulted in higher water absorption and water solubility values, which are not preferred for clinical application. In summary, well-dispersed HAP nanofibers and their dental composites with enhanced mechanical properties have been successfully fabricated, but the water absorption and water solubility of such dental composites need to be further improved. (paper)

  4. Outline of the wireless hut built in 1957 and the old living hut built in 1969 at Syowa Station, Antarctica and outside environment -Preface-

    Directory of Open Access Journals (Sweden)

    Zenkichi Hirayama

    2002-09-01

    Full Text Available It has been decided to dismantle the wireless hut built in 1957 and the old living hut built in 1969 at Syowa Station, Antarctica in accordance with a renewal project plan. A Commission of Construction Experts, the Architect Committee brought the above two buildings as test samples to Japan and in cooperation with several research institutes and researchers, investigated the effect of aging. We herein report the those results.

  5. 26 CFR 1.382-7T - Built-in gains and losses (temporary).

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Built-in gains and losses (temporary). 1.382-7T Section 1.382-7T Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Insolvency Reorganizations § 1.382-7T Built-in gains and losses...

  6. 26 CFR 1.382-7 - Built-in gains and losses. [Reserved

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Built-in gains and losses. [Reserved] 1.382-7 Section 1.382-7 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Insolvency Reorganizations § 1.382-7 Built-in gains and losses. [Reserved] ...

  7. Influence of shielding gas on the mechanical and metallurgical properties of DP-GMA-welded 5083-H321 aluminum alloy

    Science.gov (United States)

    Koushki, Amin Reza; Goodarzi, Massoud; Paidar, Moslem

    2016-12-01

    In the present research, 6-mm-thick 5083-H321 aluminum alloy was joined by the double-pulsed gas metal arc welding (DP-GMAW) process. The objective was to investigate the influence of the shielding gas composition on the microstructure and properties of GMA welds. A macrostructural study indicated that the addition of nitrogen and oxygen to the argon shielding gas resulted in better weld penetration. Furthermore, the tensile strength and bending strength of the welds were improved when oxygen and nitrogen (at concentrations as high as approximately 0.1vol%) were added to the shielding gas; however, these properties were adversely affected when the oxygen and nitrogen contents were increased further. This behavior was attributed to the formation of excessive brown and black oxide films on the bead surface, the formation of intermetallic compounds in the weld metal, and the formation of thicker oxide layers on the bead surface with increasing nitrogen and oxygen contents in the argon-based shielding gas. Analysis by energy-dispersive X-ray spectroscopy revealed that most of these compounds are nitrides or oxides.

  8. NaF-loaded core-shell PAN-PMMA nanofibers as reinforcements for Bis-GMA/TEGDMA restorative resins.

    Science.gov (United States)

    Cheng, Liyuan; Zhou, Xuegang; Zhong, Hong; Deng, Xuliang; Cai, Qing; Yang, Xiaoping

    2014-01-01

    A kind of core-shell nanofibers containing sodium fluoride (NaF) was produced and used as reinforcing materials for dimethacrylate-based dental restorative resins in this study. The core-shell nanofibers were prepared by coaxial-electrospinning with polyacrylonitrile (PAN) and poly(methyl methacrylate) (PMMA) solutions as core and shell fluids, respectively. The produced PAN-PMMA nanofibers varied in fiber diameter and the thickness of PMMA shell depending on electrospinning parameters. NaF-loaded nanofibers were obtained by incorporating NaF nanocrystals into the core fluid at two loadings (0.8 or 1.0wt.%). Embedment of NaF nanocrystals into the PAN core did not damage the core-shell structure. The addition of PAN-PMMA nanofibers into Bis-GMA/TEGDMA clearly showed the reinforcement due to the good interfacial adhesion between fibers and resin. The flexural strength (Fs) and flexural modulus (Ey) of the composites decreased slightly as the thickness of PMMA shell increasing. Sustained fluoride releases with minor initial burst release were achieved from NaF-loaded core-shell nanofibers and the corresponding composites, which was quite different from the case of embedding NaF nanocrystals into the dental resin directly. The study demonstrated that NaF-loaded PAN-PMMA core-shell nanofibers were not only able to improve the mechanical properties of restorative resin, but also able to provide sustained fluoride release to help in preventing secondary caries. © 2013.

  9. A high-throughput readout architecture based on PCI-Express Gen3 and DirectGMA technology

    International Nuclear Information System (INIS)

    Rota, L.; Vogelgesang, M.; Perez, L.E. Ardila; Caselle, M.; Chilingaryan, S.; Dritschler, T.; Zilio, N.; Kopmann, A.; Balzer, M.; Weber, M.

    2016-01-01

    Modern physics experiments produce multi-GB/s data rates. Fast data links and high performance computing stages are required for continuous data acquisition and processing. Because of their intrinsic parallelism and computational power, GPUs emerged as an ideal solution to process this data in high performance computing applications. In this paper we present a high-throughput platform based on direct FPGA-GPU communication. The architecture consists of a Direct Memory Access (DMA) engine compatible with the Xilinx PCI-Express core, a Linux driver for register access, and high- level software to manage direct memory transfers using AMD's DirectGMA technology. Measurements with a Gen3 x8 link show a throughput of 6.4 GB/s for transfers to GPU memory and 6.6 GB/s to system memory. We also assess the possibility of using the architecture in low latency systems: preliminary measurements show a round-trip latency as low as 1 μs for data transfers to system memory, while the additional latency introduced by OpenCL scheduling is the current limitation for GPU based systems. Our implementation is suitable for real-time DAQ system applications ranging from photon science and medical imaging to High Energy Physics (HEP) systems

  10. Comparative Study of Structure-Property Relationships in Polymer Networks Based on Bis-GMA, TEGDMA and Various Urethane-Dimethacrylates

    Directory of Open Access Journals (Sweden)

    Izabela Barszczewska-Rybarek

    2015-03-01

    Full Text Available The effect of various dimethacrylates on the structure and properties of homo- and copolymer networks was studied. The 2,2-bis-[4-(2-hydroxy-3- methacryloyloxypropoxyphenyl]-propane (Bis-GMA, triethylene glycol dimethacrylate (TEGDMA and 1,6-bis-(methacryloyloxy-2-ethoxycarbonylamino-2,4,4-trimethylhexane (HEMA/TMDI, all popular in dentistry, as well as five urethane-dimethacrylate (UDMA alternatives of HEMA/TMDI were used as monomers. UDMAs were obtained from mono-, di- and tri(ethylene glycol monomethacrylates and various commercial diisocyanates. The chemical structure, degree of conversion (DC and scanning electron microscopy (SEM fracture morphology were related to the mechanical properties of the polymers: flexural strength and modulus, hardness, as well as impact strength. Impact resistance was widely discussed, being lower than expected in the case of poly(UDMAs. It was caused by the heterogeneous morphology of these polymers and only moderate strength of hydrogen bonds between urethane groups, which was not high enough to withstand high impact energy. Bis-GMA, despite having the highest polymer morphological heterogeneity, ensured fair impact resistance, due to having the strongest hydrogen bonds between hydroxyl groups. The TEGDMA homopolymer, despite being heterogeneous, produced the smoothest morphology, which resulted in the lowest brittleness. The UDMA monomer, having diethylene glycol monomethacrylate wings and the isophorone core, could be the most suitable HEMA/TMDI alternative. Its copolymer with Bis-GMA and TEGDMA had improved DC as well as all the mechanical properties.

  11. The future of graduate medical education in Germany - position paper of the Committee on Graduate Medical Education of the Society for Medical Education (GMA).

    Science.gov (United States)

    David, Dagmar M; Euteneier, Alexander; Fischer, Martin R; Hahn, Eckhart G; Johannink, Jonas; Kulike, Katharina; Lauch, Robert; Lindhorst, Elmar; Noll-Hussong, Michael; Pinilla, Severin; Weih, Markus; Wennekes, Vanessa

    2013-01-01

    The German graduate medical education system is going through an important phase of changes. Besides the ongoing reform of the national guidelines for graduate medical education (Musterweiterbildungsordnung), other factors like societal and demographic changes, health and research policy reforms also play a central role for the future and competitiveness of graduate medical education. With this position paper, the committee on graduate medical education of the Society for Medical Education (GMA) would like to point out some central questions for this process and support the current discourse. As an interprofessional and interdisciplinary scientific society, the GMA has the resources to contribute in a meaningful way to an evidence-based and future-oriented graduate medical education strategy. In this position paper, we use four key questions with regards to educational goals, quality assurance, teaching competence and policy requirements to address the core issues for the future of graduate medical education in Germany. The GMA sees its task in contributing to the necessary reform processes as the only German speaking scientific society in the field of medical education.

  12. 25 CFR 170.138 - Can roads be built in roadless and wild areas?

    Science.gov (United States)

    2010-04-01

    ... RESERVATION ROADS PROGRAM Indian Reservation Roads Program Policy and Eligibility Recreation, Tourism and Trails § 170.138 Can roads be built in roadless and wild areas? Under 25 CFR part 265 no roads can be...

  13. The reciprocity law concerning light dose relationships applied to BisGMA/TEGDMA photopolymers: theoretical analysis and experimental characterization.

    Science.gov (United States)

    Wydra, James W; Cramer, Neil B; Stansbury, Jeffrey W; Bowman, Christopher N

    2014-06-01

    A model BisGMA/TEGDMA unfilled resin was utilized to investigate the effect of varied irradiation intensity on the photopolymerization kinetics and shrinkage stress evolution, as a means for evaluation of the reciprocity relationship. Functional group conversion was determined by FTIR spectroscopy and polymerization shrinkage stress was obtained by a tensometer. Samples were polymerized with UV light from an EXFO Acticure with 0.1wt% photoinitiator. A one-dimensional kinetic model was utilized to predict the conversion-dose relationship. As irradiation intensity increased, conversion decreased at a constant irradiation dose and the overall dose required to achieve full conversion increased. Methacrylate conversion ranged from 64±2% at 3mW/cm(2) to 78±1% at 24mW/cm(2) while the final shrinkage stress varied from 2.4±0.1MPa to 3.0±0.1MPa. The ultimate conversion and shrinkage stress levels achieved were dependent not only upon dose but also the irradiation intensity, in contrast to an idealized reciprocity relationship. A kinetic model was utilized to analyze this behavior and provide theoretical conversion profiles versus irradiation time and dose. Analysis of the experimental and modeling results demonstrated that the polymerization kinetics do not and should not be expected to follow the reciprocity law behavior. As irradiation intensity is increased, the overall dose required to achieve full conversion also increased. Further, the ultimate conversion and shrinkage stress that are achieved are not dependent only upon dose but rather upon the irradiation intensity and corresponding polymerization rate. Copyright © 2014 Academy of Dental Materials. Published by Elsevier Ltd. All rights reserved.

  14. Die Zukunft der ärztlichen Weiterbildung in Deutschland – Positionspapier des Ausschusses Weiterbildung der Gesellschaft für Medizinische Ausbildung (GMA [The future of graduate medical education in Germany – Position paper of the committee on graduate medical education of the Society for Medical Education (GMA

    Directory of Open Access Journals (Sweden)

    Weih, Markus

    2013-05-01

    Full Text Available [english] The German graduate medical education system is going through an important phase of changes. Besides the ongoing reform of the national guidelines for graduate medical education (Musterweiterbildungsordnung, other factors like societal and demographic changes, health and research policy reforms also play a central role for the future and competitiveness of graduate medical education.With this position paper, the committee on graduate medical education of the Society for Medical Education (GMA would like to point out some central questions for this process and support the current discourse.As an interprofessional and interdisciplinary scientific society, the GMA has the resources to contribute in a meaningful way to an evidence-based and future-oriented graduate medical education strategy.In this position paper, we use four key questions with regards to educational goals, quality assurance, teaching competence and policy requirements to address the core issues for the future of graduate medical education in Germany. The GMA sees its task in contributing to the necessary reform processes as the only German speaking scientific society in the field of medical education.[german] Die ärztliche Weiterbildung in Deutschland befindet sich im Umbruch. Neben der aktuellen Reform der Musterweiterbildungsordnung spielen gesellschaftliche, demographische, gesundheits- und forschungspolitische Faktoren eine wichtige Rolle für die Zukunft und Konkurrenzfähigkeit der ärztlichen Weiterbildung.Der Ausschuss für Weiterbildung der Gesellschaft für Medizinische Ausbildung (GMA möchte mit diesem Positionspapier auf zentrale Fragen in diesem Prozess aufmerksam machen und Impulse für den aktuellen Diskurs geben.Dabei kann die GMA als interdisziplinäre und interprofessionelle Fachgesellschaft wichtige Beiträge zu einer evidenzbasierten und zukunftsorientierten Weiterbildungsstrategie liefern.Im vorliegenden Papier werden anhand von vier Leitfragen zu

  15. The effect of the polymerization initiator and light source on the elution of residual Bis-GMA and TEGDMA monomers: A study using liquid chromatography with UV detection.

    Science.gov (United States)

    Denis, Aline B; Diagone, Cristina A; Plepis, Ana M G; Viana, Rommel B

    2015-12-05

    A method for the extraction and quantification of two residual monomers, bisphenol glycidyl dimethacrylate (Bis-GMA) and triethylene glycol dimethacrylate (TEGDMA), that were evaluated using high efficiency liquid chromatography with UV detection was developed and validated in this study. Three types of solvents were applied in the extraction of the monomers (methanol, ethanol and acetonitrile), where the highest extraction efficiency was obtained using acetonitrile. The different resins were prepared by photoactivation of Bis-GMA and TEGDMA monomers. Additionally, the effects of the addition of two photoinitiators (camphorquinone (CQ) and phenyl propanodione (PPD) and that of a co-initiator (N,N-dimethyl-p-toluidine) were also analyzed. When only the CQ photoinitiator was used, a smaller amount of residual monomers was obtained, whereas a larger amount was obtained with PPD. When the two photoinitiators were used in the same matrix, however, no significant changes were observed in relation to the amount of residual TEGDMA monomers. For the addition of the co-initiator, there were no large changes in the extraction of residual monomers. The effect of the two photoactivation sources (halogen lamp and LED) led to small differences in the elution of the two monomers, although all of the resins differed significantly when photoactivated with a LED. Quantum chemical calculations using Density Functional Theory were carried out to characterize several molecular properties of each monomer. Copyright © 2015 Elsevier B.V. All rights reserved.

  16. Kinetic Parameters during Bis-GMA and TEGDMA Monomer Polymerization by ATR-FTIR: The Influence of Photoinitiator and Light Curing Source

    Directory of Open Access Journals (Sweden)

    Aline B. Denis

    2016-01-01

    Full Text Available This study aimed to analyze the kinetic parameters of two monomers using attenuated total reflectance Fourier transform infrared (ATR-FTIR: 2,2-bis-[4-(2-hydroxy-3-methacryloxypropyl-1-oxy-phenyl] propane (Bis-GMA and triethylene glycol dimethacrylate (TEGDMA. The following were calculated to evaluate the kinetic parameters: maximum conversion rate (Rpmax, time at the maximum polymerization rate (tmax, conversion at Rpmax, and total conversion recorded at the maximum conversion point after 300 s. Camphorquinone (CQ and phenyl propanedione (PPD were used in this study as photoinitiators, whereas N,N-dimethyl-p-toluidine (DMPT amine was used as a coinitiator. LED apparatus and halogen lamp were used in turn to evaluate the effect that light source had on the monomer kinetics. The mass concentration ratio for the three resin preparations was 0.7 : 0.3 for Bis-GMA and TEGDMA: R1 (CQ + DMPT, R2 (PPD + DMPT, and R3 (PPD + CQ + DMPT. The PPD association with the CQ photoinitiator altered the polymerization kinetics compared to a resin containing only the CQ photoinitiator. The light sources exhibited no significant differences for tmax of R1 and R3. Resins containing only the PPD initiator exhibited a higher tmax than those containing only CQ. However, the Rpmax decreased for resins containing the PPD photoinitiator.

  17. Konsensusstatement "Praktische Fertigkeiten im Medizinstudium" – ein Positionspapier des GMA-Ausschusses für praktische Fertigkeiten [A Consensus Statement on Practical Skills in Medical School – a position paper by the GMA Committee on Practical Skills

    Directory of Open Access Journals (Sweden)

    Schnabel, Kai P.

    2011-11-01

    standardisieren. Auf Initiative der deutschsprachigen Skills Labs wurde der GMA-Ausschuss für praktische Fertigkeiten gegründet, der einen kompetenzbasierten Lernzielkatalog entwickelte, dessen Entstehung und Struktur hier beschrieben wird.Ziel des Kataloges ist es, die praktischen Fertigkeiten im Medizinstudium zu definieren und damit den Fakultäten eine rationale Planungsgrundlage für die zur Vermittlung praktischer Fertigkeiten notwendigen Ressourcen zu geben.Methodik: Aufbauend auf schon vorhandenen deutschsprachigen Lernzielkatalogen wurde mittels einem mehrfach iterativem Kondensationsprozesses, der der Erarbeitung von S1-Leitlinien entspricht, vorgegangen, um eine breite fachliche und politische Abstützung zu erhalten. Ergebnisse: Es wurden 289 verschiedene praktische Lernziele identifiziert, die zwölf verschiedenen Organsystemen, drei Grenzbereichen zu anderen Kompetenzbereichen und einem Bereich mit organsystemübergreifenden Fertigkeiten zugeordnet. Sie wurden drei verschiedenen zeitlichen und drei verschiedenen Tiefendimensionen zugeordnet und mit dem Schweizer und dem Österreichischem Pendant abgeglichen. Diskussion: Das vorliegende Konsensusstatement kann den deutschen Fakultäten eine Grundlage zur Planung der Vermittlung praktischer Fertigkeiten bieten und bildet einen wichtigen Schritt zu einem nationalen Standard medizinischer Lernziele.Blick in die Zukunft: Das Konsensusstatement soll einen formativen Effekt auf die medizinischen Fakultäten haben, ihre praktischen Unterrichtsinhalte entsprechend zu vermitteln und die Ressourcen danach zu planen.

  18. 75 FR 33990 - Built-in Gains and Losses Under Section 382(h)

    Science.gov (United States)

    2010-06-16

    ... Gains and Losses Under Section 382(h) AGENCY: Internal Revenue Service (IRS), Treasury. ACTION: Final... section 382(h). DATES: Effective Date: These regulations are effective on June 11, 2010. Applicability...) regarding the treatment of prepaid income under the built-in gain provisions of section 382(h) were...

  19. Built-in unit with short-circuit insulation for hermetic cable ducts

    International Nuclear Information System (INIS)

    Tschacher, B.; Gurr, W.; Kusserow, J.; Katzmarek, W.

    1984-01-01

    The invention concerns a built-in unit with short-circuit insulation for hermetic cable ducts, especially for containments of nuclear power reactors. The short-circuit insulation is achieved by an insulation plate made from radiation-resistant insulating materials of high mechanical strength

  20. Temperature-dependent built-in potential in organic semiconductor devices

    NARCIS (Netherlands)

    Kemerink, M.; Kramer, J.M.; Gommans, H.H.P.; Janssen, R.A.J.

    2006-01-01

    The temperature dependence of the built-in voltage of organic semiconductor devices is studied. The results are interpreted using a simple analytical model for the band bending at the electrodes. It is based on the notion that, even at zero current, diffusion may cause a significant charge density

  1. 78 FR 54156 - Limitations on Duplication of Net Built-in Losses

    Science.gov (United States)

    2013-09-03

    ... it is not a transfer of net built-in loss property under section 362(e)(1); that gain recognized by... transferor distributes the stock received in the transaction and, in the distribution, no gain or loss was... the transaction. 3. Securities Received Without the Recognition of Gain or Loss Section 362(e)(2) is...

  2. Built-in current sensor for ΔIDDQ testing of deep submicron digital CMOS ICs

    NARCIS (Netherlands)

    Vazquez, J.R.; Pineda de Gyvez, J.

    2004-01-01

    This paper presents the implementation of a built-in current sensor that includes two recently reported new techniques for IDDQ testing to take into account the increased background current of defect-free circuits and its increased variance due to process variations. These techniques are the

  3. Architecture of built-in microcontrollers in the U-70 complex control system

    International Nuclear Information System (INIS)

    Balakin, S.I.; Voevodin, V.P.; Inchagov, A.A.; Komarov, V.V.

    2000-01-01

    The distributed system of built-in microcontrollers (BMS) for functional control of supply sources of magnetooptical elements is created within the frames of works on modernization of the U-70 control complex. The BMS architecture and functional diagram of one of them are presented. The microcontrollers operation algorithm is based on the eventuation principle. The BMS basic parameters are presented [ru

  4. Reliability of Dubbed Technical Systems with Built-In Control Device

    Directory of Open Access Journals (Sweden)

    V. A. Аnischenko

    2013-01-01

    Full Text Available The paper substantiates a selection of passive or active system for dubbing technical systems in accordance with characteristics pertaining to probability of no-failure operation and mean–time-between failures with due account of non-reliability of a built-in control device and systems complexity. 

  5. Simplification of integrity constraints with aggregates and arithmetic built-ins

    DEFF Research Database (Denmark)

    Martinenghi, Davide

    2004-01-01

    Both aggregates and arithmetic built-ins are widely used in current database query languages: Aggregates are second-order constructs such as CNT and SUM of SQL; arithmetic built-ins include relational and other mathematical operators that apply to numbers, such as < and +. These features are also...... time, simplified versions of such integrity constraints that can be tested before the execution of any update. In this way, virtually no time is spent for optimization or rollbacks at run time. Both set and bag semantics are considered....... of interest in the context of database integrity constraints: correct and efficient integrity checking is crucial, as, without any guarantee of data consistency, the answers to queries cannot be trusted. In this paper we propose a method of practical relevance that can be used to derive, at database design...

  6. Coaxial nozzle-assisted 3D bioprinting with built-in microchannels for nutrients delivery.

    Science.gov (United States)

    Gao, Qing; He, Yong; Fu, Jian-zhong; Liu, An; Ma, Liang

    2015-08-01

    This study offers a novel 3D bioprinting method based on hollow calcium alginate filaments by using a coaxial nozzle, in which high strength cell-laden hydrogel 3D structures with built-in microchannels can be fabricated by controlling the crosslinking time to realize fusion of adjacent hollow filaments. A 3D bioprinting system with a Z-shape platform was used to realize layer-by-layer fabrication of cell-laden hydrogel structures. Curving, straight, stretched or fractured filaments can be formed by changes to the filament extrusion speed or the platform movement speed. To print a 3D structure, we first adjusted the concentration and flow rate of the sodium alginate and calcium chloride solution in the crosslinking process to get partially crosslinked filaments. Next, a motorized XY stages with the coaxial nozzle attached was used to control adjacent hollow filament deposition in the precise location for fusion. Then the Z stage attached with a Z-shape platform moved down sequentially to print layers of structure. And the printing process always kept the top two layers fusing and the below layers solidifying. Finally, the Z stage moved down to keep the printed structure immersed in the CaCl2 solution for complete crosslinking. The mechanical properties of the resulting fused structures were investigated. High-strength structures can be formed using higher concentrations of sodium alginate solution with smaller distance between adjacent hollow filaments. In addition, cell viability of this method was investigated, and the findings show that the viability of L929 mouse fibroblasts in the hollow constructs was higher than that in alginate structures without built-in microchannels. Compared with other bioprinting methods, this study is an important technique to allow easy fabrication of lager-scale organs with built-in microchannels. Copyright © 2015 Elsevier Ltd. All rights reserved.

  7. Identification of Mobile Phones Using the Built-In Magnetometers Stimulated by Motion Patterns

    Directory of Open Access Journals (Sweden)

    Gianmarco Baldini

    2017-04-01

    Full Text Available We investigate the identification of mobile phones through their built-in magnetometers. These electronic components have started to be widely deployed in mass market phones in recent years, and they can be exploited to uniquely identify mobile phones due their physical differences, which appear in the digital output generated by them. This is similar to approaches reported in the literature for other components of the mobile phone, including the digital camera, the microphones or their RF transmission components. In this paper, the identification is performed through an inexpensive device made up of a platform that rotates the mobile phone under test and a fixed magnet positioned on the edge of the rotating platform. When the mobile phone passes in front of the fixed magnet, the built-in magnetometer is stimulated, and its digital output is recorded and analyzed. For each mobile phone, the experiment is repeated over six different days to ensure consistency in the results. A total of 10 phones of different brands and models or of the same model were used in our experiment. The digital output from the magnetometers is synchronized and correlated, and statistical features are extracted to generate a fingerprint of the built-in magnetometer and, consequently, of the mobile phone. A SVM machine learning algorithm is used to classify the mobile phones on the basis of the extracted statistical features. Our results show that inter-model classification (i.e., different models and brands classification is possible with great accuracy, but intra-model (i.e., phones with different serial numbers and same model classification is more challenging, the resulting accuracy being just slightly above random choice.

  8. Variational Integration for Ideal MHD with Built-in Advection Equations

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, Yao [Princeton Plasma Physics Lab. (PPPL), Princeton, NJ (United States); Qin, Hong [Princeton Plasma Physics Lab. (PPPL), Princeton, NJ (United States); Burby, J. W. [Princeton Plasma Physics Lab. (PPPL), Princeton, NJ (United States); Bhattacharjee, A. [Princeton Plasma Physics Lab. (PPPL), Princeton, NJ (United States)

    2014-08-05

    Newcomb's Lagrangian for ideal MHD in Lagrangian labeling is discretized using discrete exterior calculus. Variational integrators for ideal MHD are derived thereafter. Besides being symplectic and momentum preserving, the schemes inherit built-in advection equations from Newcomb's formulation, and therefore avoid solving them and the accompanying error and dissipation. We implement the method in 2D and show that numerical reconnection does not take place when singular current sheets are present. We then apply it to studying the dynamics of the ideal coalescence instability with multiple islands. The relaxed equilibrium state with embedded current sheets is obtained numerically.

  9. Variational integration for ideal magnetohydrodynamics with built-in advection equations

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, Yao; Burby, J. W.; Bhattacharjee, A. [Plasma Physics Laboratory, Princeton University, Princeton, New Jersey 08543 (United States); Qin, Hong [Plasma Physics Laboratory, Princeton University, Princeton, New Jersey 08543 (United States); Department of Modern Physics, University of Science and Technology of China, Hefei, Anhui 230026 (China)

    2014-10-15

    Newcomb's Lagrangian for ideal magnetohydrodynamics (MHD) in Lagrangian labeling is discretized using discrete exterior calculus. Variational integrators for ideal MHD are derived thereafter. Besides being symplectic and momentum-preserving, the schemes inherit built-in advection equations from Newcomb's formulation, and therefore avoid solving them and the accompanying error and dissipation. We implement the method in 2D and show that numerical reconnection does not take place when singular current sheets are present. We then apply it to studying the dynamics of the ideal coalescence instability with multiple islands. The relaxed equilibrium state with embedded current sheets is obtained numerically.

  10. A built-in current sensor using thin-film transistors

    Energy Technology Data Exchange (ETDEWEB)

    Hatzopoulos, A A [Department of Electrical and Computer Eng., Electronics Lab., Aristotle University of Thessaloniki, 54124 Thessaloniki (Greece); Siskos, S [Department of Physics, Electronics Lab., Aristotle University of Thessaloniki, 54124 Thessaloniki (Greece); Dimitriadis, C A [Department of Physics, Microelectronic device characterization and design Lab., Aristotle University of Thessaloniki, 54124 Thessaloniki (Greece); Papadopoulos, N [Department of Electrical and Computer Eng., Electronics Lab., Aristotle University of Thessaloniki, 54124 Thessaloniki (Greece); Pappas, I [Department of Physics, Electronics Lab., Aristotle University of Thessaloniki, 54124 Thessaloniki (Greece); Nalpantidis, L [Department of Physics, Electronics Lab., Aristotle University of Thessaloniki, 54124 Thessaloniki (Greece)

    2005-01-01

    A simple current mirror using TFTs with input terminals which are capacitively coupled to the TFT gate, is used in this work, to design a built-in current sensor (BICS). The important feature in this application is that the voltage drop across the sensing TFT device can be reduced to almost zero value, while preserving transistor operation in the saturation region. This makes the proposed BICS appropriate for TFT applications without affecting the circuit operation. It also results in adequate linearity for the current monitoring, making the structure applicable to digital as well as to analog and mixed-signal circuit testing.

  11. Nationaler Kompetenzbasierter Lernzielkatalog Medizin (NKLM für Deutschland: Zusammenarbeit der Gesellschaft für Medizinische Ausbildung (GMA und des Medizinischen Fakultätentages (MFT [National Competence-Based Learning Objectives for Undergraduate Medical Education (NKLM in Germany: Cooperation of the Association for Medical Education (GMA and the Association of Medical Faculties in Germany (MFT

    Directory of Open Access Journals (Sweden)

    Hahn, Eckhart G.

    2009-08-01

    Full Text Available [english] The Framework for Qualifications of the European Higher Education Area (FQ-EHEA; Bologna Process and the European Qualifications Framework for Lifelong Learning (EQF-LLL; Lisbon Process are competence-driven frameworks for vocational and higher education programmes in need for defined learning objectives. In the field of medical education, The Netherlands and Switzerland have developed national catalogues for undergraduate medical training, which are competence-based and compatible with a two-cycle curriculum comprised of a Bachelor in Medicine and a Master in Medicine. In Germany, virtually all medical organizations, last not least the Association of Medical Faculties (MFT, have voted against the application of the two-cycle (and the three-cycle curriculum to medical undergraduate education. A standstill of the European processes will not be accepted in the political arena, and a proposition was made by the Conference of German Ministers of Higher Education to develop a medical qualification framework for Germany, asking the Association for Medical Education (GMA and the MFT to join forces. This is not possible without consented national learning objectives derived from the professional context of physicians. The GMA has teamed up with the MFT to develop National Competence-Based Learning Objectives for Undergraduate Medical Education (NKLM in Germany (see Figure 1 to fulfill these needs.

  12. Physical Layer Built-In Security Analysis and Enhancement Algorithms for CDMA Systems

    Directory of Open Access Journals (Sweden)

    Li Tongtong

    2007-01-01

    Full Text Available Historically developed for secure communication and military use, CDMA has been identified as a major modulation and multiple-access technique for 3G systems and beyond. In addition to the wide bandwidth and low power-spectrum density which make CDMA signals robust to narrowband jamming and easy to be concealed within the noise floor, the physical layer built-in information privacy of CDMA system is provided by pseudorandom scrambling. In this paper, first, security weakness of the operational and proposed CDMA airlink interfaces is analyzed. Second, based on the advanced encryption standard (AES, we propose to enhance the physical layer built-in security of CDMA systems through secure scrambling. Performance analysis demonstrates that while providing significantly improved information privacy, CDMA systems with secure scrambling have comparable computational complexity and overall system performance with that of conventionally scrambled systems. Moreover, it is shown that by scrambling the training sequence and the message sequence separately with two independent scrambling sequences, both information privacy and system performance can be further improved. The proposed scheme can readily be applied to 3G systems and beyond.

  13. Development of built-in debris-filter bottom nozzle for PWR fuel assemblies

    International Nuclear Information System (INIS)

    Juntaro Shimizu; Kazuki Monaka; Masaji Mori; Kazuo Ikeda

    2005-01-01

    Mitsubishi Heavy Industries, Ltd. (MHI) has worked to improve the capability of anti debris bottom nozzle for a PWR fuel assembly. The Current debris filter bottom nozzle (DFBN) having 4mm diameter flow holes can capture the larger size of debris than the flow hole inner diameter. MHI has completed the development of the built-in debris filter bottom nozzle, which is the new idea of the debris-filter for high burnup (55GWd/t assembly average burnup). Built-in debris filter bottom nozzle consists of the blades and nozzle body. The blades made from inconel strip are embedded and welded on the grooved top surface of the bottom nozzle adapter plate. A flow hole is divided by the blade and the trap size of the debris is reduced. Because the blades block the coolant flow, it was anticipated to increase the pressure loss of the nozzle, however, adjusting the relation between blade and taper shape of the flow hole, the pressure loss has been successfully maintained the satisfactory level. Grooves are cut on the nozzle plate; nevertheless, the additional skirts on the four sides of the nozzle compensate the structural strength. (authors)

  14. Built-in self-repair of VLSI memories employing neural nets

    Science.gov (United States)

    Mazumder, Pinaki

    1998-10-01

    The decades of the Eighties and the Nineties have witnessed the spectacular growth of VLSI technology, when the chip size has increased from a few hundred devices to a staggering multi-millon transistors. This trend is expected to continue as the CMOS feature size progresses towards the nanometric dimension of 100 nm and less. SIA roadmap projects that, where as the DRAM chips will integrate over 20 billion devices in the next millennium, the future microprocessors may incorporate over 100 million transistors on a single chip. As the VLSI chip size increase, the limited accessibility of circuit components poses great difficulty for external diagnosis and replacement in the presence of faulty components. For this reason, extensive work has been done in built-in self-test techniques, but little research is known concerning built-in self-repair. Moreover, the extra hardware introduced by conventional fault-tolerance techniques is also likely to become faulty, therefore causing the circuit to be useless. This research demonstrates the feasibility of implementing electronic neural networks as intelligent hardware for memory array repair. Most importantly, we show that the neural network control possesses a robust and degradable computing capability under various fault conditions. Overall, a yield analysis performed on 64K DRAM's shows that the yield can be improved from as low as 20 percent to near 99 percent due to the self-repair design, with overhead no more than 7 percent.

  15. Memory-built-in quantum cloning in a hybrid solid-state spin register

    Science.gov (United States)

    Wang, W.-B.; Zu, C.; He, L.; Zhang, W.-G.; Duan, L.-M.

    2015-07-01

    As a way to circumvent the quantum no-cloning theorem, approximate quantum cloning protocols have received wide attention with remarkable applications. Copying of quantum states to memory qubits provides an important strategy for eavesdropping in quantum cryptography. We report an experiment that realizes cloning of quantum states from an electron spin to a nuclear spin in a hybrid solid-state spin register with near-optimal fidelity. The nuclear spin provides an ideal memory qubit at room temperature, which stores the cloned quantum states for a millisecond under ambient conditions, exceeding the lifetime of the original quantum state carried by the electron spin by orders of magnitude. The realization of a cloning machine with built-in quantum memory provides a key step for application of quantum cloning in quantum information science.

  16. Progress of independent feasibility study for modular HTGR demonstration plant to be built in China

    International Nuclear Information System (INIS)

    He Jiachen

    1989-01-01

    Many regions in China are suffering from shortage of energy as a result of the rapid growth of the national economy, for example, the growth rate of national production in 1988 reached 11.2%. A great number of coal fired plants have been built in many industrial areas. However, the difficulties relating to the transportation of coal and environmental pollution have become more and more serious. The construction of hydropower plants is limited due to uneven geographic conditions and seasons. For these reasons China needs to develop nuclear power plants. Nowadays, it has been decided, that PWR will be the main reactor type in our country, but in some districts or under some conditions modular HTGR may have distinct advantages and become an attractive option. The possible plant site description and preliminary result of economic analysis of modular HTGR type reactor are briefly discussed in this presentation

  17. Mesh three-dimensional arm orthosis with built-in ultrasound physiotherapy system

    Science.gov (United States)

    Kashapova, R. M.; Kashapov, R. N.; Kashapova, R. S.

    2017-09-01

    The possibility of using the built-in ultrasound physiotherapy system of the hand orthosis is explored in the work. The individual mesh orthosis from nylon 12 was manufactured by the 3D prototyping method on the installation of selective laser sintering SLS SPro 60HD. The applied technology of three-dimensional scanning made it possible to obtain a model of the patient’s hand and on the basis of it to build a virtual model of the mesh frame. In the course of the research, the developed system of ultrasound exposure was installed on the orthosis and its tests were carried out. As a result, the acceleration of the healing process and the reduction in the time of wearing orthosis were found.

  18. Hydrodynamic Behavior of Overtopping Wave Energy Converters Built in Sea Defense Structures

    DEFF Research Database (Denmark)

    Victor, Lander; Kofoed, Jens Peter; Troch, Peter

    2010-01-01

    Many sea defense structures need to be adapted to the rising sea water level and changing wave climate due to global warming. The accordingly required investment opens perspectives for wave energy converters (WECs) – that are built as part of the sea defense structures – to become economically...... viable. In this paper the average overtopping discharges q of overtopping wave energy devices built in sea defense structures are studied. Physical model tests with this type of devices have been carried out in a wave flume leading to experimental q - values. The experimental q -values are compared...... with predicted average overtopping discharges by existing empirical formulae from literature. Overtopping converters have low relative crest freeboards and smooth slope characteristics to maximize overtopping, which is contradictive to the basic role of sea defense structures. As a consequence, the achieved...

  19. Emotion recognition based on customized smart bracelet with built-in accelerometer

    Directory of Open Access Journals (Sweden)

    Zhan Zhang

    2016-07-01

    Full Text Available Background: Recently, emotion recognition has become a hot topic in human-computer interaction. If computers could understand human emotions, they could interact better with their users. This paper proposes a novel method to recognize human emotions (neutral, happy, and angry using a smart bracelet with built-in accelerometer. Methods: In this study, a total of 123 participants were instructed to wear a customized smart bracelet with built-in accelerometer that can track and record their movements. Firstly, participants walked two minutes as normal, which served as walking behaviors in a neutral emotion condition. Participants then watched emotional film clips to elicit emotions (happy and angry. The time interval between watching two clips was more than four hours. After watching film clips, they walked for one minute, which served as walking behaviors in a happy or angry emotion condition. We collected raw data from the bracelet and extracted a few features from raw data. Based on these features, we built classification models for classifying three types of emotions (neutral, happy, and angry. Results and Discussion: For two-category classification, the classification accuracy can reach 91.3% (neutral vs. angry, 88.5% (neutral vs. happy, and 88.5% (happy vs. angry, respectively; while, for the differentiation among three types of emotions (neutral, happy, and angry, the accuracy can reach 81.2%. Conclusions: Using wearable devices, we found it is possible to recognize human emotions (neutral, happy, and angry with fair accuracy. Results of this study may be useful to improve the performance of human-computer interaction.

  20. Indigenous Past Climate Knowledge as Cultural Built-in Object and Its Accuracy

    Directory of Open Access Journals (Sweden)

    Christian Leclerc

    2013-12-01

    Full Text Available In studying indigenous climate knowledge, two approaches can be envisioned. In the first, traditional knowledge is a cultural built-in object; conceived as a whole, its relevance can be assessed by referring to other cultural, economic, or technical components at work within an indigenous society. In the second, the accuracy of indigenous climate knowledge is assessed with western science knowledge used as an external reference. However, assessing the accuracy of indigenous climate knowledge remains a largely untapped area. We aim to show how accurate the culturally built indigenous climate knowledge of extreme climatic events is, and how amenable it is to fuzzy logic. A retrospective survey was carried out individually and randomly among 195 Eastern African farmers on climatic reasons for loss of on-farm crop diversity from 1961 to 2006. More than 3000 crop loss events were recorded, and reasons given by farmers were mainly related to droughts or heavy rainfall. Chi-square statistics computed by Monte Carlo simulations based on 999 replicates clearly rejected independence between indigenous knowledge of drought and heavy rainfall that occurred in the past and rainfall records. The fuzzy logic nature of indigenous climatic knowledge appears in the clear association of drought or heavy rainfall events, as perceived by farmers, with corresponding extreme rainfall values, contrasting with a fuzzy picture in the intermediate climatic situations. We discuss how the cultural built-in knowledge helps farmers in perceiving and remembering past climate variations, considering the specificity of the contexts where extreme climatic events were experienced. The integration of indigenous and scientific climate knowledge could allow development of drought monitoring that considers both climatic and contextual data.

  1. Core Competencies for Medical Teachers (KLM) – A Position Paper of the GMA Committee on Personal and Organizational Development in Teaching

    Science.gov (United States)

    Görlitz, Anja; Ebert, Thomas; Bauer, Daniel; Grasl, Matthäus; Hofer, Matthias; Lammerding-Köppel, Maria; Fabry, Götz

    2015-01-01

    Recent developments in medical education have created increasing challenges for medical teachers which is why the majority of German medical schools already offer educational and instructional skills trainings for their teaching staff. However, to date no framework for educational core competencies for medical teachers exists that might serve as guidance for the qualification of the teaching faculty. Against the background of the discussion about competency based medical education and based upon the international literature, the GMA Committee for Faculty and Organizational Development in Teaching developed a model of core teaching competencies for medical teachers. This framework is designed not only to provide guidance with regard to individual qualification profiles but also to support further advancement of the content, training formats and evaluation of faculty development initiatives and thus, to establish uniform quality criteria for such initiatives in German-speaking medical schools. The model comprises a framework of six competency fields, subdivided into competency components and learning objectives. Additional examples of their use in medical teaching scenarios illustrate and clarify each specific teaching competency. The model has been designed for routine application in medical schools and is thought to be complemented consecutively by additional competencies for teachers with special duties and responsibilities in a future step. PMID:26038688

  2. Railway Station Built In The Interwar Period In Telšiai

    Directory of Open Access Journals (Sweden)

    Iveta Dabašinskienė

    2014-05-01

    Full Text Available Abstract The most important and biggest railway station in Telšiai as a part of one of the first railroads Kretinga – Telšiai – Kužiai built in the interwar period is examined in this article. A variety of elements of the station’s infrastructure with special attention to passenger stations, houses for railway workers and warehouses (pakhauze are revealed in the article. The significance of Lietūkis warehouses founded in the territory of the station and their connections with the railroad are discussed. Moreover, the arrangement of Telšiai Station buildings in the territory are analyzed and compared to the preserved site plan of the station and photo of the situation dated back to the Second World War taken by Germans from the air. While comparing the available sources, urban developments of the station area are discussed. The analysis material is based on archival sources, the interwar documentary publications and research of the location.

  3. Towards an Intelligent Acoustic Front End for Automatic Speech Recognition: Built-in Speaker Normalization

    Directory of Open Access Journals (Sweden)

    Umit H. Yapanel

    2008-08-01

    Full Text Available A proven method for achieving effective automatic speech recognition (ASR due to speaker differences is to perform acoustic feature speaker normalization. More effective speaker normalization methods are needed which require limited computing resources for real-time performance. The most popular speaker normalization technique is vocal-tract length normalization (VTLN, despite the fact that it is computationally expensive. In this study, we propose a novel online VTLN algorithm entitled built-in speaker normalization (BISN, where normalization is performed on-the-fly within a newly proposed PMVDR acoustic front end. The novel algorithm aspect is that in conventional frontend processing with PMVDR and VTLN, two separating warping phases are needed; while in the proposed BISN method only one single speaker dependent warp is used to achieve both the PMVDR perceptual warp and VTLN warp simultaneously. This improved integration unifies the nonlinear warping performed in the front end and reduces simultaneously. This improved integration unifies the nonlinear warping performed in the front end and reduces computational requirements, thereby offering advantages for real-time ASR systems. Evaluations are performed for (i an in-car extended digit recognition task, where an on-the-fly BISN implementation reduces the relative word error rate (WER by 24%, and (ii for a diverse noisy speech task (SPINE 2, where the relative WER improvement was 9%, both relative to the baseline speaker normalization method.

  4. Design of a Realistic Test Simulator For a Built-In Self Test Environment

    Directory of Open Access Journals (Sweden)

    A. Ahmad

    2010-12-01

    Full Text Available This paper presents a realistic test approach suitable to Design For Testability (DFT and Built- In Self Test (BIST environments. The approach is culminated in the form of a test simulator which is capable of providing a required goal of test for the System Under Test (SUT. The simulator uses the approach of fault diagnostics with fault grading procedure to provide the tests. The tool is developed on a common PC platform and hence no special software is required. Thereby, it is a low cost tool and hence economical. The tool is very much suitable for determining realistic test sequences for a targeted goal of testing for any SUT. The developed tool incorporates a flexible Graphical User Interface (GUI procedure and can be operated without any special programming skill. The tool is debugged and tested with the results of many bench mark circuits. Further, this developed tool can be utilized for educational purposes for many courses such as fault-tolerant computing, fault diagnosis, digital electronics, and safe - reliable - testable digital logic designs.

  5. Structure-dependent SERS activity of plasmonic nanorattles with built-in electromagnetic hotspots.

    Science.gov (United States)

    Liu, Keng-Ku; Tadepalli, Sirimuvva; Wang, Zheyu; Jiang, Qisheng; Singamaneni, Srikanth

    2017-11-20

    Hollow plasmonic nanostructures with built-in and accessible electromagnetic hotspots such as nanorattles, obtained through a galvanic replacement reaction, have received wide attention in chemical and biological sensing and targeted drug delivery. In this study, we investigate the surface enhanced Raman scattering (SERS) activity of plasmonic nanorattles obtained through different degrees of galvanic replacement of Au@Ag nanocubes. We found that the SERS efficacy of the nanorattles is governed by the plasmon extinction intensity, localized surface plasmon resonance (LSPR) wavelength of the nanostructures with respect to the excitation source and intensity of the electromagnetic field at the hotspot, with the latter playing a determining role. Finite-difference time-domain (FDTD) simulations showed excellent agreement with the experimental findings that an optimal degree of galvanic replacement is critical for maximum SERS enhancement. The rational design and synthesis of the plasmonic nanorattles based on these findings can make these nanostructures highly attractive for SERS-based chemical and biological sensing and bioimaging.

  6. Experimental Identification of Smartphones Using Fingerprints of Built-In Micro-Electro Mechanical Systems (MEMS

    Directory of Open Access Journals (Sweden)

    Gianmarco Baldini

    2016-06-01

    Full Text Available The correct identification of smartphones has various applications in the field of security or the fight against counterfeiting. As the level of sophistication in counterfeit electronics increases, detection procedures must become more accurate but also not destructive for the smartphone under testing. Some components of the smartphone are more likely to reveal their authenticity even without a physical inspection, since they are characterized by hardware fingerprints detectable by simply examining the data they provide. This is the case of MEMS (Micro Electro-Mechanical Systems components like accelerometers and gyroscopes, where tiny differences and imprecisions in the manufacturing process determine unique patterns in the data output. In this paper, we present the experimental evaluation of the identification of smartphones through their built-in MEMS components. In our study, three different phones of the same model are subject to repeatable movements (composing a repeatable scenario using an high precision robotic arm. The measurements from MEMS for each repeatable scenario are collected and analyzed. The identification algorithm is based on the extraction of the statistical features of the collected data for each scenario. The features are used in a support vector machine (SVM classifier to identify the smartphone. The results of the evaluation are presented for different combinations of features and Inertial Measurement Unit (IMU outputs, which show that detection accuracy of higher than 90% is achievable.

  7. Ionized calcium analyzer with a built-in pH correction.

    Science.gov (United States)

    Fogh-Andersen, N

    1981-07-01

    We describe a new semi-automated apparatus for simultaneously measuring the concentration of free calcium ion and of hydrogen ion (pH) at 37 degrees C. The sample volume is 110 microL. In addition to the actual values for these concentrations in the sample, the apparatus calculates the concentration of free calcium ion at pH 7.40. Mean values for serum from 51 fasting bedridden patients without calcium metabolic disorders and 64 fasting hospital employees were 1.192 and 1.232 mmol/L, respectively, with SD of 0.042 and 0.040 mmol/L, respectively. The within-series analytical SD was 12 mumol/L and the day-to-day SD of the pH-corrected concentration of free calcium ion was 21 mumol/L, as calculated from measurements made on a serum pool after equilibration with a CO2--air mixture. The mean dependency on pH as determined in 120 consecutive patients' sera equalled the built-in pH correction. The accuracy was evaluated by comparison with other calcium ion-selective electrodes.

  8. A Cache System Design for CMPs with Built-In Coherence Verification

    Directory of Open Access Journals (Sweden)

    Mamata Dalui

    2016-01-01

    Full Text Available This work reports an effective design of cache system for Chip Multiprocessors (CMPs. It introduces built-in logic for verification of cache coherence in CMPs realizing directory based protocol. It is developed around the cellular automata (CA machine, invented by John von Neumann in the 1950s. A special class of CA referred to as single length cycle 2-attractor cellular automata (TACA has been planted to detect the inconsistencies in cache line states of processors’ private caches. The TACA module captures coherence status of the CMPs’ cache system and memorizes any inconsistent recording of the cache line states during the processors’ reference to a memory block. Theory has been developed to empower a TACA to analyse the cache state updates and then to settle to an attractor state indicating quick decision on a faulty recording of cache line status. The introduction of segmentation of the CMPs’ processor pool ensures a better efficiency, in determining the inconsistencies, by reducing the number of computation steps in the verification logic. The hardware requirement for the verification logic points to the fact that the overhead of proposed coherence verification module is much lesser than that of the conventional verification units and is insignificant with respect to the cost involved in CMPs’ cache system.

  9. Development of Flexible Pneumatic Cylinder with Built-in Flexible Linear Encoder and Flexible Bending Sensor

    Science.gov (United States)

    Akagi, Tetsuya; Dohta, Shujiro; Matsushita, Hisashi; Fukuhara, Akimasa

    The purpose of this study is to develop a lightweight and intelligent soft actuator which can be safely attached to the human body. A novel flexible pneumatic cylinder that can be used even if it is deformed by external force had been proposed. The cylinder can realize both pushing and pulling motions even if the cylinder bends. In this paper, a flexible pneumatic cylinder with a built-in flexible linear encoder is proposed and tested. The encoder can detect the cylinder displacement even if the cylinder bends. In the next step, to realize an intelligent flexible cylinder, it is essential to recognize the angle of deflection of the cylinder to estimate the direction of the external force. Therefore, a flexible bending sensor that can measure the directional angle by attaching it to the end of the cylinder is also proposed and tested. The tested bending sensor also consists of four inexpensive photo-reflectors set on the circumferential surface to the cylinder tube every 90 degrees from the center of the tube. By measuring the distance between the photo reflector and the surface of the tube at each point, the bending directional angle of the cylinder can be obtained. A low cost measuring system using a micro-computer incorporating a programmed Up/Down counter to measure the displacement of the cylinder is also developed. As a result, it was confirmed that the measuring accuracy of the bending directional angle was good, less than 0.7 degrees as a standard deviation.

  10. Towards an Intelligent Acoustic Front End for Automatic Speech Recognition: Built-in Speaker Normalization

    Directory of Open Access Journals (Sweden)

    Yapanel UmitH

    2008-01-01

    Full Text Available A proven method for achieving effective automatic speech recognition (ASR due to speaker differences is to perform acoustic feature speaker normalization. More effective speaker normalization methods are needed which require limited computing resources for real-time performance. The most popular speaker normalization technique is vocal-tract length normalization (VTLN, despite the fact that it is computationally expensive. In this study, we propose a novel online VTLN algorithm entitled built-in speaker normalization (BISN, where normalization is performed on-the-fly within a newly proposed PMVDR acoustic front end. The novel algorithm aspect is that in conventional frontend processing with PMVDR and VTLN, two separating warping phases are needed; while in the proposed BISN method only one single speaker dependent warp is used to achieve both the PMVDR perceptual warp and VTLN warp simultaneously. This improved integration unifies the nonlinear warping performed in the front end and reduces simultaneously. This improved integration unifies the nonlinear warping performed in the front end and reduces computational requirements, thereby offering advantages for real-time ASR systems. Evaluations are performed for (i an in-car extended digit recognition task, where an on-the-fly BISN implementation reduces the relative word error rate (WER by 24%, and (ii for a diverse noisy speech task (SPINE 2, where the relative WER improvement was 9%, both relative to the baseline speaker normalization method.

  11. Built-In Data-Flow Integration Testing in Large-Scale Component-Based Systems

    Science.gov (United States)

    Piel, Éric; Gonzalez-Sanchez, Alberto; Gross, Hans-Gerhard

    Modern large-scale component-based applications and service ecosystems are built following a number of different component models and architectural styles, such as the data-flow architectural style. In this style, each building block receives data from a previous one in the flow and sends output data to other components. This organisation expresses information flows adequately, and also favours decoupling between the components, leading to easier maintenance and quicker evolution of the system. Integration testing is a major means to ensure the quality of large systems. Their size and complexity, together with the fact that they are developed and maintained by several stake holders, make Built-In Testing (BIT) an attractive approach to manage their integration testing. However, so far no technique has been proposed that combines BIT and data-flow integration testing. We have introduced the notion of a virtual component in order to realize such a combination. It permits to define the behaviour of several components assembled to process a flow of data, using BIT. Test-cases are defined in a way that they are simple to write and flexible to adapt. We present two implementations of our proposed virtual component integration testing technique, and we extend our previous proposal to detect and handle errors in the definition by the user. The evaluation of the virtual component testing approach suggests that more issues can be detected in systems with data-flows than through other integration testing approaches.

  12. A Cloud Based Mobile Dispatching System with Built-in Social CRM Component: Design and Implementation

    Directory of Open Access Journals (Sweden)

    Cosmina Ivan

    2015-07-01

    Full Text Available Mobile dispatching applications have become popular for at least two major reasons. The first reason is a more mobile-centric usage pattern, where users relate to apps for fulfilling different needs that they have. In this respect, a vehicle dispatching application for mobile phones is perceived as a modern way of booking a vehicle. The second reason has to do with the advantages that this method has over traditional dispatching systems, such as being able to see the vehicle approaching on a map, being able to rate a driver and the most importantly spurring customer retention. The taxi dispatching business, one of the classes of dispatching businesses, tends to be a medium to lower class fidelity service, where users mostly consider the closest taxi as opposed to quality, which is regarded as being at a relatively consistent level. We propose a new approach for the taxi ordering application , a mobile dispatching system, which allows for a more engaged user base and offers fidelity rewards that are used to enhance the customer retention level based on a built in social customer relationship management (CRM component. With this approach, we argue that in a business world which is shifting from a consumer-centric marketing to a human-centric model, this apps will allows taxi businesses to better interact with their clients in a more direct and responsible manner. Also this distributed system helps taxi drivers, which can receive orders directly from their clients and will be able to benefit from offering quality services as they can get higher ratings.

  13. Can the analysis of built-in software of CPAP devices replace polygraphy in children?

    Science.gov (United States)

    Khirani, Sonia; Delord, Vincent; Olmo Arroyo, Jorge; De Sanctis, Livio; Frapin, Annick; Amaddeo, Alessandro; Fauroux, Brigitte

    2017-09-01

    Polysomnography (PSG) is the gold standard for the scoring of residual respiratory events during continuous positive airway pressure (CPAP). Studies comparing PSG scoring with automatic scoring by the built-in software of CPAP devices have reported acceptable agreements except for the hypopnea index (HI) in adult patients, but no study has yet been conducted in children. The aim of the present study was to compare the automatic scoring by CPAP device and manual scoring using the software tracings of the CPAP device integrating pulse oximetry (SpO 2 ) with in-lab polygraphy (PG). Consecutive clinically stable children treated with constant CPAP (ResMed) for at least one month and scheduled for a nocturnal PG were recruited. A pulse oximeter was connected to the CPAP device. The PG apnea-hypopnea index (AHI PG ), scored according to modified AASM guidelines, was compared with the automatic AHI reported by the CPAP device (AHI A CPAP ) and the manual scoring of the AHI on the CPAP software (AHI M CPAP ). Fifteen children (1.5-18.6 years) were included. Mean residual AHI PG was 0.9 ± 1.2/hour (0.0-4.6/hour) vs. AHI A CPAP of 3.6 ± 3.6/hour (0.5-14.7/hour) (p software tracings of CPAP devices integrating SpO 2 signal may be helpful. These results have to be confirmed in patients with higher AHI. Copyright © 2017 Elsevier B.V. All rights reserved.

  14. [Level of microwave radiation from mobile phone base stations built in residential districts].

    Science.gov (United States)

    Hu, Ji; Lu, Yiyang; Zhang, Huacheng; Xie, Hebing; Yang, Xinwen

    2009-11-01

    To investigate the condition of microwave radiation pollution from mobile phone base station built in populated area. Random selected 18 residential districts where had base station and 10 residential districts where had no base stations. A TES-92 electromagnetic radiation monitor were used to measure the intensity of microwave radiation in external and internal living environment. The intensities of microwave radiation in the exposure residential districts were more higher than those of the control residential districts (p station, it would gradually weaken with the increase of the distance. The level of microwave radiation in antenna main lobe region is not certainly more higher than the side lobe direction, and the side lobe direction also is not more lower. At the same district, where there were two base stations, the electromagnetic field nestification would take place in someplace. The intensities of microwave radiation outside the exposure windows in the resident room not only changed with distance but also with the height of the floor. The intensities of microwave radiation inside the aluminum alloys security net were more lower than those of outside the aluminum alloys security net (p 0.05). Although all the measure dates on the ground around the base station could be below the primary standard in "environment electromagnetic wave hygienic standard" (GB9175-88), there were still a minorities of windows which exposed to the base station were higher, and the outside or inside of a few window was even higher beyond the primary safe level defined standard. The aluminum alloys security net can partly shield the microwave radiation from the mobile phone base station.

  15. Modular, Autonomous Command and Data Handling Software with Built-In Simulation and Test

    Science.gov (United States)

    Cuseo, John

    2012-01-01

    The spacecraft system that plays the greatest role throughout the program lifecycle is the Command and Data Handling System (C&DH), along with the associated algorithms and software. The C&DH takes on this role as cost driver because it is the brains of the spacecraft and is the element of the system that is primarily responsible for the integration and interoperability of all spacecraft subsystems. During design and development, many activities associated with mission design, system engineering, and subsystem development result in products that are directly supported by the C&DH, such as interfaces, algorithms, flight software (FSW), and parameter sets. A modular system architecture has been developed that provides a means for rapid spacecraft assembly, test, and integration. This modular C&DH software architecture, which can be targeted and adapted to a wide variety of spacecraft architectures, payloads, and mission requirements, eliminates the current practice of rewriting the spacecraft software and test environment for every mission. This software allows missionspecific software and algorithms to be rapidly integrated and tested, significantly decreasing time involved in the software development cycle. Additionally, the FSW includes an Onboard Dynamic Simulation System (ODySSy) that allows the C&DH software to support rapid integration and test. With this solution, the C&DH software capabilities will encompass all phases of the spacecraft lifecycle. ODySSy is an on-board simulation capability built directly into the FSW that provides dynamic built-in test capabilities as soon as the FSW image is loaded onto the processor. It includes a six-degrees- of-freedom, high-fidelity simulation that allows complete closed-loop and hardware-in-the-loop testing of a spacecraft in a ground processing environment without any additional external stimuli. ODySSy can intercept and modify sensor inputs using mathematical sensor models, and can intercept and respond to actuator

  16. Research of built-in self test technology on cable-free self-positioning seismograph

    Science.gov (United States)

    Huaizhu, Z.; Lin, J.; Chen, Z.; Zhang, L.; Yang, H.; Zheng, F.

    2011-12-01

    Cable-free self-positioning seismograph is the key instrument and equipment required for deep seismic exploration in China. In order to measure the performance of seismic data acquisition systems whether meet exploration requirements , to ensure the accuracy of seismic data, and to ensure equipment reliability and stability, a built-in self test solution of the cable-free self-positioning seismic recorder is provided. Within a 24-bits Σ-Δ DAC, the seismograph can produce sine, step, pulse and other high-precision analog test signal, with dynamic range of 120dB or more, through the FPGA to control the analog multiplexer switching the input signal acquisition channels, and start the 24-bit Σ-Δ ADC in the instrument internal simultaneously to acquisition the test signal data, carries on the fast Fournier transformation by instrument internal CPU, to achieve the instrument of analysis and calculation of performance indicators, including: the equivalent noise and drift, common mode rejection ratio (CMRR), crosstalk, harmonic distortion, dynamic range, channel response consistency, detector impulse response , etc. A lot of testing experiments about the various parameters were performed and studied currently. By setting different sampling rate (1Hz, 5Hz, ..., 4kHz), each of the measurement system noise level was measured, and the maximum noise is about 0.5μV; the crosstalk between channels was tested using the 31.25Hz sine wave, the result is more than-120dB with sampling rate of 1kHz; the harmonic distortion was measured by adding the high-precision sine wave signals of different frequencies, such as 500Hz, 250 Hz, 125 Hz, 62.5 Hz, 31.25 Hz, 15.625 Hz, 7.812 Hz, 3.90625Hz, etc. the calculated results is in-118dB or more. The experimental results show that, the parameters of the cable-free self-positioning of the seismic recorder meet the technical requirements for the deep exploration, compared to the corresponding parameters with the 428XL seismograph of the French

  17. Temperature distributions in trapezoidal built in storage solar water heaters with/without phase change materials

    International Nuclear Information System (INIS)

    Tarhan, Sefa; Sari, Ahmet; Yardim, M. Hakan

    2006-01-01

    Built in storage solar water heaters (BSSWHs) have been recognized for their more compact constructions and faster solar gain than conventional solar water heaters, however, their water temperatures quickly go down during the cooling period. A trapezoidal BSSWH without PCM storage unit was used as the control heater (reference) to investigate the effect of two differently configured PCM storage units on the temperature distributions in water tanks. In the first design, myristic acid was filled into the PCM storage tank, which also served as an absorbing plate. In the second design, lauric acid was filled into the PCM storage tank, which also served as a baffle plate. The water temperature changes were followed by five thermocouples placed evenly and longitudinally into each of the three BSSWHs. The effects of the PCMs on the water temperature distributions depended on the configuration of the PCM storage unit and the longitudinal position in the water tanks. The use of lauric acid lowered the values of the peak temperatures by 15% compared to the control heater at the upper portion of the water tanks because of the low melting temperature of lauric acid, but it did not have any consistent effect on the retention of the water temperatures during the cooling period. The ability of the myristic acid storage unit to retain the water temperatures got more remarkable, especially at the middle portion of the water tank. The myristic acid storage increased the dip temperatures by approximately 8.8% compared to the control heater. In conclusion, lauric acid storage can be used to stabilize the water temperature during the day time, while the myristic acid storage unit can be used as a thermal barrier against heat loss during the night time because of its relatively high melting temperature and low heat conduction coefficient in its solid phase. The experimental results have also indicated that the thermal characteristics of the PCM and the configuration of the PCM storage

  18. Built-in and Induced Polarization Across LaAlO3/SrTiO3 Heterojunctions

    Energy Technology Data Exchange (ETDEWEB)

    Guneeta, Singh-Bhalla

    2011-08-15

    Ionic crystals terminated at oppositely charged polar surfaces are inherently unstable and expected to undergo surface reconstructions to maintain electrostatic stability. Essentially, an electric field that arises between oppositely charged atomic planes gives rise to a built-in potential that diverges with thickness. Here we present evidence of such a built-in potential across polar LaAlO{sub 3} thin films grown on SrTiO{sub 3} substrates, a system well known for the electron gas that forms at the interface. By performing tunneling measurements between the electron gas and metallic electrodes on LaAlO{sub 3} we measure a built-in electric field across LaAlO{sub 3} of 80.1 meV/{angstrom}. Additionally, capacitance measurements reveal the presence of an induced dipole moment across the heterostructure. We forsee use of the ionic built-in potential as an additional tuning parameter in both existing and novel device architectures, especially as atomic control of oxide interfaces gains widespread momentum.

  19. Gaussian processes with built-in dimensionality reduction: Applications to high-dimensional uncertainty propagation

    International Nuclear Information System (INIS)

    Tripathy, Rohit; Bilionis, Ilias; Gonzalez, Marcial

    2016-01-01

    Uncertainty quantification (UQ) tasks, such as model calibration, uncertainty propagation, and optimization under uncertainty, typically require several thousand evaluations of the underlying computer codes. To cope with the cost of simulations, one replaces the real response surface with a cheap surrogate based, e.g., on polynomial chaos expansions, neural networks, support vector machines, or Gaussian processes (GP). However, the number of simulations required to learn a generic multivariate response grows exponentially as the input dimension increases. This curse of dimensionality can only be addressed, if the response exhibits some special structure that can be discovered and exploited. A wide range of physical responses exhibit a special structure known as an active subspace (AS). An AS is a linear manifold of the stochastic space characterized by maximal response variation. The idea is that one should first identify this low dimensional manifold, project the high-dimensional input onto it, and then link the projection to the output. If the dimensionality of the AS is low enough, then learning the link function is a much easier problem than the original problem of learning a high-dimensional function. The classic approach to discovering the AS requires gradient information, a fact that severely limits its applicability. Furthermore, and partly because of its reliance to gradients, it is not able to handle noisy observations. The latter is an essential trait if one wants to be able to propagate uncertainty through stochastic simulators, e.g., through molecular dynamics codes. In this work, we develop a probabilistic version of AS which is gradient-free and robust to observational noise. Our approach relies on a novel Gaussian process regression with built-in dimensionality reduction. In particular, the AS is represented as an orthogonal projection matrix that serves as yet another covariance function hyper-parameter to be estimated from the data. To train the

  20. Gaussian processes with built-in dimensionality reduction: Applications to high-dimensional uncertainty propagation

    Science.gov (United States)

    Tripathy, Rohit; Bilionis, Ilias; Gonzalez, Marcial

    2016-09-01

    Uncertainty quantification (UQ) tasks, such as model calibration, uncertainty propagation, and optimization under uncertainty, typically require several thousand evaluations of the underlying computer codes. To cope with the cost of simulations, one replaces the real response surface with a cheap surrogate based, e.g., on polynomial chaos expansions, neural networks, support vector machines, or Gaussian processes (GP). However, the number of simulations required to learn a generic multivariate response grows exponentially as the input dimension increases. This curse of dimensionality can only be addressed, if the response exhibits some special structure that can be discovered and exploited. A wide range of physical responses exhibit a special structure known as an active subspace (AS). An AS is a linear manifold of the stochastic space characterized by maximal response variation. The idea is that one should first identify this low dimensional manifold, project the high-dimensional input onto it, and then link the projection to the output. If the dimensionality of the AS is low enough, then learning the link function is a much easier problem than the original problem of learning a high-dimensional function. The classic approach to discovering the AS requires gradient information, a fact that severely limits its applicability. Furthermore, and partly because of its reliance to gradients, it is not able to handle noisy observations. The latter is an essential trait if one wants to be able to propagate uncertainty through stochastic simulators, e.g., through molecular dynamics codes. In this work, we develop a probabilistic version of AS which is gradient-free and robust to observational noise. Our approach relies on a novel Gaussian process regression with built-in dimensionality reduction. In particular, the AS is represented as an orthogonal projection matrix that serves as yet another covariance function hyper-parameter to be estimated from the data. To train the

  1. Gaussian processes with built-in dimensionality reduction: Applications to high-dimensional uncertainty propagation

    Energy Technology Data Exchange (ETDEWEB)

    Tripathy, Rohit, E-mail: rtripath@purdue.edu; Bilionis, Ilias, E-mail: ibilion@purdue.edu; Gonzalez, Marcial, E-mail: marcial-gonzalez@purdue.edu

    2016-09-15

    Uncertainty quantification (UQ) tasks, such as model calibration, uncertainty propagation, and optimization under uncertainty, typically require several thousand evaluations of the underlying computer codes. To cope with the cost of simulations, one replaces the real response surface with a cheap surrogate based, e.g., on polynomial chaos expansions, neural networks, support vector machines, or Gaussian processes (GP). However, the number of simulations required to learn a generic multivariate response grows exponentially as the input dimension increases. This curse of dimensionality can only be addressed, if the response exhibits some special structure that can be discovered and exploited. A wide range of physical responses exhibit a special structure known as an active subspace (AS). An AS is a linear manifold of the stochastic space characterized by maximal response variation. The idea is that one should first identify this low dimensional manifold, project the high-dimensional input onto it, and then link the projection to the output. If the dimensionality of the AS is low enough, then learning the link function is a much easier problem than the original problem of learning a high-dimensional function. The classic approach to discovering the AS requires gradient information, a fact that severely limits its applicability. Furthermore, and partly because of its reliance to gradients, it is not able to handle noisy observations. The latter is an essential trait if one wants to be able to propagate uncertainty through stochastic simulators, e.g., through molecular dynamics codes. In this work, we develop a probabilistic version of AS which is gradient-free and robust to observational noise. Our approach relies on a novel Gaussian process regression with built-in dimensionality reduction. In particular, the AS is represented as an orthogonal projection matrix that serves as yet another covariance function hyper-parameter to be estimated from the data. To train the

  2. Modelagem matemática do processo de soldagem GMAW: transferência por vôo livre Mathematical modeling of GMA welding: free fligth transfer

    Directory of Open Access Journals (Sweden)

    Ivan José de Santana

    2011-09-01

    Full Text Available Este artigo descreve a concepção e validação de um modelo matemático direcionado à soldagem GMAW. O modelo permite a predição de alguns parâmetros de soldagem, assim como o comportamento do processo em condições operacionais de transferência metálica por vôo livre. Este modelo foi baseado em um conjunto de equações, que descrevem as características operacionais da fonte de energia, as quedas de tensão que ocorrem no arco elétrico e nos componentes do circuito de soldagem, e em um balanço de energia na ponta do arame. A validação do modelo envolveu testes de soldagem mecanizada em corpos-de-prova de aço baixo carbono, com monitoração da corrente, tensão, comprimento de arco e velocidade de alimentação de arame. O modelo mostrou-se capaz de prever,em diferentes situações, com erros inferiores a 10%, os valores médios de alguns parâmetros fundamentais no processo de soldagem GMAW (valores médios de corrente, tensão e comprimento de arco elétrico, assim como, o comportamento destes na ocorrência de mudanças operacionais.This paper describes the conception and validation of a mathematical model applied to GMA welding. This model allows predicting some welding parameters as well as process behavior for operation with free flight transfer mode. This model was based on a set of equations that describes the power source characteristics, the voltage drop along the electric arc, the welding circuit and the energy balance on the wire tip. The model validation was performed by comparing its results to experimental welding trials. In this test specimen steel of low carbon was used and the parameters welding current and voltage, speed of wire feeding and arc length were monitored. The results have shown that the model is able to correctly predict how different parameters change with alterations in wire feed, in different situations. Furthermore, welding current and voltage e arc length value were predicted with a least

  3. SU-F-I-61: Assessment and Characterization of the Built-in Internal Photometer of Primary Diagnostic Monitors

    Energy Technology Data Exchange (ETDEWEB)

    Ruuge, A; Erdi, Y; Mahmood, U [Memorial Sloan Kettering Cancer Center, New York, NY (United States)

    2016-06-15

    Purpose: The conformance of Primary Diagnostic Monitors (PDMs) to the DICOM GSDF is increasingly required by several state and city regulators. Our purpose was to quantitatively characterize the luminance performance of the internal, built in photometer of BARCO monitors against an externally calibrated luminance meter. Methods: Thirty one PDMs (BARCO) were included in our analysis. An externally calibrated photometer (RaySafe Solo Light) was used to measure the luminance and illuminance values. Measured monitors were located at various hospital sites, radiology physicians’ offices and radiology reading rooms. All measured PDMs were equipped with the manufacturer’s built-in photometers and connected to Barco MediCal QA web service for manual and automatic quality control measurements. PDM combinations included 1, 2 and 4 monitors depending on the location. TG-18 and SMPTE test patterns were used to evaluate monitor performance. Results: All the PDMs exceeded the luminance ratio of 250:1, as required by NYC PDM guidelines. One PDM failed the NYC requirement for the minimal luminance level of 350 cd/m2. As compared to the external photometer, the difference in measurement of the maximum luminance with the built-in photometer was found to exceed 5% on 6 of the PDM measured, with a maximum deviation of 10%. The age of the monitors that failed was on average 5 years. All monitors passed the luminance uniformity test, which was 30% from the center of the monitor to the 4 corner locations. Four PDMs failed the Gray Scale Display Function (GSDF) calibration. Conclusion: For the consistent display of medical images and continued conformance with the DICOM GSDF standard, it is essential to compare the performance of the built-in photometer with an externally calibrated photometer for monitors that are older than 5 years.

  4. Built-in surface electric field, piezoelectricity and photoelastic effect in GaN nanorods for nanophotonic devices.

    Science.gov (United States)

    Su, W S; Chen, T T; Cheng, C L; Fu, S P; Chen, Y F; Hsiao, C L; Tu, L W

    2008-06-11

    Novel behaviors arising from the coupling between the built-in surface electric field, piezoelectricity, electron-hole pairs and external light beam were observed in GaN nanorods. An increase in the optical excitation density resulted in a blueshift in the photoluminescence spectra and a redshift in the frequency of the GaN A(1)(LO) phonon. The underlying mechanism was attributed to the screening of the built-in surface electric field by photoexcited carriers and, through the converse piezoelectric effect, a reduction in the internal strain. The existence of the built-in surface electric field in GaN nanorods was confirmed by scanning Kelvin probe microscopy. Our results firmly establish the existence of the photoelastic effect in GaN nanorods. In addition to underpinning the principle for applications in nanophotonic devices, this discovery also draws attention to the novel effects arising from the inherent large surface-to-volume ratio of nanostructures, which is possibly applicable to many other nanomaterials.

  5. Silicon-on-Insulator Lateral-Insulated-Gate-Bipolar-Transistor with Built-in Self-anti-ESD Diode

    Directory of Open Access Journals (Sweden)

    Xiaojun Cheng

    2014-05-01

    Full Text Available Power SOI (Silicon-On-Insulator devices have an inherent sandwich structure of MOS (Metal-Oxide-Semiconductor gate which is very easy to suffer ESD (Electro-Static Discharge overstress. To solve this reliability problem, studies on design and modification of a built-in self-anti-ESD diode for a preliminarily optimized high voltage SOI LIGBT (Lateral-Insulated-Gate-Bipolar-Transistor were carried out on the Silvaco TCAD (Technology-Computer-Aided-Design platform. According to the constrains of the technological process, the new introduction of the N+ doped region into P-well region that form the built-in self-anti-ESD diode should be done together with the doping of source under the same mask. The modifications were done by adjusting the vertical impurity profile in P-well into retrograde distribution and designing a cathode plate with a proper length to cover the forward depletion terminal and make sure that the thickness of the cathode plate is the same as that of the gate plate. The simulation results indicate that the modified device structure is compatible with the original one in process and design, the breakdown voltage margin of the former was expanded properly, and both the transient cathode voltages are clamped low enough very quickly. Therefore, the design and optimization results of the modified device structure of the built-in self-anti-ESD diode for the given SOI LIGBT meet the given requirements.

  6. [Discrimination perceived by people with a diagnosis of schizophrenic disorders. INternational study of DIscrimination and stiGma Outcomes (INDIGO): French results].

    Science.gov (United States)

    Daumerie, N; Vasseur Bacle, S; Giordana, J-Y; Bourdais Mannone, C; Caria, A; Roelandt, J-L

    2012-06-01

    The INDIGO study (INternational study of DIscrimination and stiGma Outcomes) aims at assessing the impact of schizophrenic disorders diagnosis on privacy, social and professional life, in terms of discrimination. In the general population, and even among health and social professionals, erroneous negative stereotypes (double personality, dangerosity) lead to high social distance. And this has an impact on various parts of daily life: employment, housing, compliance, self-esteem… About a tenth of the adult population suffers from mental disorders at any one time. These disorders now account for about 12% of the global impact of disability, and this will rise to 15% by the year 2020. People living with schizophrenia, for example, experience reduced social participation, whilst public images of mental illness and social reactions add a dimension of suffering, which has been described as a "second illness". Stigmatizing attitudes and discriminatory behavior among the general population against people with severe mental illness are common in all countries. Globally, little is known of effective interventions against stigma. It is clear that the negative effects of stigma can act as formidable barriers to active recovery. The INDIGO study intends to establish detailed international data on how stigma and discrimination affect the lives of people with a diagnosis of schizophrenia. The first aim of the INDIGO study is to conduct qualitative and quantitative interviews with 25 people with a diagnosis of schizophrenia in each participating site, to elicit information on how the condition affects their everyday lives, with a focus upon sites in Europe. The second is to gather data for all participating countries on the laws, policies and regulations which set a clear distinction between people with a diagnosis of mental illness and others, to establish an international profile of such discrimination. A new scale (Discrimination and Stigma Scale [DISC]), used in a face

  7. Durchführung der universitären Prüfungen im klinischen Abschnitt des Medizinstudiums nach den Leitlinien des GMA-Ausschusses Prüfungen: Eine Bestandsaufnahme der medizinischen Fakultäten in Baden-Württemberg [Implementation of assessments according to the guidelines of the GMA: A survey of the medical faculties in Baden-Württemberg

    Directory of Open Access Journals (Sweden)

    Jünger, Jana

    2010-08-01

    Full Text Available [english] With the introduction of the new medical licensing regulation [1] in 2002, a reform process was initiated nationwide that aimed to redesign medical degree programs at universities to make them more practice-oriented and to establish quality assurance in teaching. Five centers of excellence were set up at the medical schools in Baden-Württemberg that merged to form the Network for Excellence in Medical Education.The Network for Excellence in Medical Education carried out a survey among the five medical schools in Baden-Württemberg on the implementation of the requirements set down in the GMA guidelines for university-specific, high-quality assessments during the clinical phase of medical studies. The network’s next steps for improving the quality of assessments at medical schools were prioritized in order to determine the urgency of support to be given to Baden-Württemberg’s faculties of medicine in implementing the GMA requirements.It became apparent that essential parts of the requirements formulated in the guidelines had already been fulfilled or at least could be fulfilled in the near future. It was observed that establishing structured review processes during assessment preparation and in particular the follow-up presented considerable difficulties. A focus group analysis identified the following objectives for the network: supporting medical schools in their review processes; compiling a comprehensive assessment program and assessment reports with statistical analysis. Training the people responsible for assessment is another priority.The results largely correspond to those from a similar survey carried out among medical schools in Bavaria and show that organizational structures, such as those that have been established in the centers of excellence in education and assessment in Baden-Württemberg and Bavaria, can offer essential support in the quality assurance of assessment.[german] Mit der Einführung der novellierten

  8. Development of a built-in type Control Rod Drive Mechanism (CRDM) for Advanced Marine Reactor X (MRX)

    International Nuclear Information System (INIS)

    Ishizaka, Y.; Iida, H.; Yamaji, A.

    1992-01-01

    For realization of the next generation Advanced Marine Reactor X(MRX) with higher safety, design studies and basic experiments have been done on the built-in type Control Rod Drive Mechanism (CRDM). The concept has been made clear of the CRDM that can be placed inside the reactor vessel and fits best to the MRX - an integrated-type PWR. In particular, the design has almost been completed for the driving motor and the latch magnet, which are the core of this CRDM. It is expected that the required performance can be assured even if there are losses due to the high temperature effect. (author)

  9. A New Built-in Self Test Scheme for Phase-Locked Loops Using Internal Digital Signals

    Science.gov (United States)

    Kim, Youbean; Kim, Kicheol; Kim, Incheol; Kang, Sungho

    Testing PLLs (phase-locked loops) is becoming an important issue that affects both time-to-market and production cost of electronic systems. Though a PLL is the most common mixed-signal building block, it is very difficult to test due to internal analog blocks and signals. In this paper, we propose a new PLL BIST (built-in self test) using the distorted frequency detector that uses only internal digital signals. The proposed BIST does not need to load any analog nodes of the PLL. Therefore, it provides an efficient defect-oriented structural test scheme, reduced area overhead, and improved test quality compared with previous approaches.

  10. Double-Windows-Based Motion Recognition in Multi-Floor Buildings Assisted by a Built-In Barometer.

    Science.gov (United States)

    Liu, Maolin; Li, Huaiyu; Wang, Yuan; Li, Fei; Chen, Xiuwan

    2018-04-01

    Accelerometers, gyroscopes and magnetometers in smartphones are often used to recognize human motions. Since it is difficult to distinguish between vertical motions and horizontal motions in the data provided by these built-in sensors, the vertical motion recognition accuracy is relatively low. The emergence of a built-in barometer in smartphones improves the accuracy of motion recognition in the vertical direction. However, there is a lack of quantitative analysis and modelling of the barometer signals, which is the basis of barometer's application to motion recognition, and a problem of imbalanced data also exists. This work focuses on using the barometers inside smartphones for vertical motion recognition in multi-floor buildings through modelling and feature extraction of pressure signals. A novel double-windows pressure feature extraction method, which adopts two sliding time windows of different length, is proposed to balance recognition accuracy and response time. Then, a random forest classifier correlation rule is further designed to weaken the impact of imbalanced data on recognition accuracy. The results demonstrate that the recognition accuracy can reach 95.05% when pressure features and the improved random forest classifier are adopted. Specifically, the recognition accuracy of the stair and elevator motions is significantly improved with enhanced response time. The proposed approach proves effective and accurate, providing a robust strategy for increasing accuracy of vertical motions.

  11. Internal filament modulation in low-dielectric gap design for built-in selector-less resistive switching memory application

    Science.gov (United States)

    Chen, Ying-Chen; Lin, Chih-Yang; Huang, Hui-Chun; Kim, Sungjun; Fowler, Burt; Chang, Yao-Feng; Wu, Xiaohan; Xu, Gaobo; Chang, Ting-Chang; Lee, Jack C.

    2018-02-01

    Sneak path current is a severe hindrance for the application of high-density resistive random-access memory (RRAM) array designs. In this work, we demonstrate nonlinear (NL) resistive switching characteristics of a HfO x /SiO x -based stacking structure as a realization for selector-less RRAM devices. The NL characteristic was obtained and designed by optimizing the internal filament location with a low effective dielectric constant in the HfO x /SiO x structure. The stacking HfO x /SiO x -based RRAM device as the one-resistor-only memory cell is applicable without needing an additional selector device to solve the sneak path issue with a switching voltage of ~1 V, which is desirable for low-power operating in built-in nonlinearity crossbar array configurations.

  12. A Built-In Self-Test Structure (BIST) for Resistive RAMs characterization: Application to bipolar OxRRAM

    Science.gov (United States)

    Aziza, H.; Bocquet, M.; Moreau, M.; Portal, J.-M.

    2015-01-01

    Resistive Random Access Memory (RRAM) is a form of nonvolatile storage that operates by changing the resistance of a specially formulated solid dielectric material [1]. Among RRAMs, oxide-based Resistive RAMs (so-called OxRRAMs) are promising candidates due their compatibility with CMOS processes and high ON/OFF resistance ratio. Common problems with OxRRAM are related to high variability in operating conditions and low yield. OxRRAM variability mainly impact ON/OFF resistance ratio. This ratio is a key parameter to determine the overall performance of an OxRRAM memory. In this context, the presented built-in structure allows collecting statistical data related to the OxRRAM memory array (ON/OFF resistance distributions) for reliability assessment of the technology.

  13. Enhancement of oscillation characteristics of a gyrotron by a built-in quasi-optical mode converter

    International Nuclear Information System (INIS)

    Hayashi, Kenichi; Mitsunaka, Yoshika; Komuro, Mitsuo

    1994-01-01

    Oscillation characteristics are analyzed experimentally and numerically by using two gyrotrons with a power level of 500 kW, a conventional tube and a tube with a built-in quasi-optical mode converter. Both tubes have a 120 GHz, TE 12,2 cavity of the same geometry and a single disk alumina window. The quasi-optical mode converter consists of an α-cut launcher and five mirrors. In the conventional tube, reflection of the competing mode at the output window prevents the main mode from oscillating stably in the operation region predicted by the design. Mode selectivity of the quasi-optical mode converter removes the influence of the reflection on the oscillation. Consequently, the experimental results in the tube with the quasi-optical mode converter are in good agreement with the design values. (author)

  14. Built-in electric field effect on optical absorption spectra of strained (In,Ga)N–GaN nanostructures

    Energy Technology Data Exchange (ETDEWEB)

    El Ghazi, Haddou, E-mail: hadghazi@gmail.com [LPS, Faculty of Science, Dhar EL Mehrez, BP 1796 Fes-Atlas (Morocco); Special Mathematics, CPGE Rabat, Rabat (Morocco); John Peter, A. [Department of Physics, Govt. Arts and Science College, Melur, 625106 Madurai (India)

    2015-08-15

    Based on the effective-mass and the one band parabolic approximations, first order linear, third-order nonlinear and total optical properties related to 1s–1p intra-conduction band transition in wurtzite strained (In,Ga)N–GaN spherical QDs are calculated. The built-in electric field effect, due to the spontaneous and piezoelectric components, is investigated variationally under finite confinement potential. The results reveal that size and internal composition of the dot have a great influence on in-built electric field which affects strongly the optical absorption spectra. It is also found that the modulation of the absorption coefficient, which is suitable for the better performance of optical device applications, can be easily obtained by adjusting geometrical size and internal composition.

  15. PC Mobile Warrior with a built-in cellular phone; Keitai denwa naizogata PC 'Mobile warrior

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2000-03-01

    A PC Mobile Warrior with a built-in cellular phone has been developed from PC Libretto through cooperation with the NTT DoCoMo. The new personal computer incorporates into itself some distinguished mobile PC features such as Wake On Radio and Wake On Ring which are defined by MCPC (Mobile Computing Promotion Consortium). Wake On Radio is a function that activates the PC upon entry into the zone from outside, and Wake On Ring is another function that does the same upon arrival of a phone call. Installed on these lower order functions are an application program for automatic transmission of stored e-mails making use of the former function and another for automatic reception of FAX messages making use of the latter function. (translated by NEDO)

  16. 110GHz-500kW long-pulse gyrotron with built-in quasi-optical mode converter

    International Nuclear Information System (INIS)

    Sakamoto, Keishi; Kariya, Tsuyoshi; Hayashi, Ken-ichi.

    1994-01-01

    We have designed, fabricated, and tested a 110 GHz-500 kW long-pulse gyrotron. The gyrotron incorporates a quasi-optical mode converter which transforms the oscillation mode, TE 22,2 , into a Gaussian radiation beam. The adoption of a built-in mode converter enabled us to design the electron beam collector so as to be capable of tolerating a 2 MW heat load. Attention was also paid to designing the gyrotron cavity and output window so as to permit long-pulse operations. In an experiment, we observed a maximum output power of 550 kW and achieved 1.3 s operation at a power level of 410 kW. (author)

  17. Research Electronic Data Capture (REDCap®) used as an audit tool with a built-in database.

    Science.gov (United States)

    Kragelund, Signe H; Kjærsgaard, Mona; Jensen-Fangel, Søren; Leth, Rita A; Ank, Nina

    2018-05-01

    The aim of this study was to develop an audit tool with a built-in database using Research Electronic Data Capture (REDCap®) as part of an antimicrobial stewardship program at a regional hospital in the Central Denmark Region, and to analyse the need, if any, to involve more than one expert in the evaluation of cases of antimicrobial treatment, and the level of agreement among the experts. Patients treated with systemic antimicrobials in the period from 1 September 2015 to 31 August 2016 were included, in total 722 cases. Data were collected retrospectively and entered manually. The audit was based on seven flow charts regarding: (1) initiation of antimicrobial treatment (2) infection (3) prescription and administration of antimicrobials (4) discontinuation of antimicrobials (5) reassessment within 48 h after the first prescription of antimicrobials (6) microbiological sampling in the period between suspicion of infection and the first administration of antimicrobials (7) microbiological results. The audit was based on automatic calculations drawing on the entered data and on expert assessments. Initially, two experts completed the audit, and in the cases in which they disagreed, a third expert was consulted. In 31.9% of the cases, the two experts agreed on all elements of the audit. In 66.2%, the two experts reached agreement by discussing the cases. Finally, 1.9% of the cases were completed in cooperation with a third expert. The experts assessed 3406 flow charts of which they agreed on 75.8%. We succeeded in creating an audit tool with a built-in database that facilitates independent expert evaluation using REDCap. We found a large inter-observer difference that needs to be considered when constructing a project based on expert judgements. Our two experts agreed on most of the flow charts after discussion, whereas the third expert's intervention did not have any influence on the overall assessment. Copyright © 2018 Elsevier Inc. All rights reserved.

  18. What does built-in software of home ventilators tell us? An observational study of 150 patients on home ventilation.

    Science.gov (United States)

    Pasquina, Patrick; Adler, Dan; Farr, Pamela; Bourqui, Pascale; Bridevaux, Pierre Olivier; Janssens, Jean-Paul

    2012-01-01

    Recent home ventilators are equipped with built-in software which provides data such as compliance, estimations of leaks, tidal volume, minute ventilation, respiratory rate, apnea and apnea-hypopnea indexes, and percentage of inspirations triggered by the patient (or ventilator). However, for many of these variables, there is neither consensus nor documentation as to what is to be expected in a population of stable patients under noninvasive ventilation (NIV). To document the values and distribution of specific items downloaded from ventilator monitoring software, by diagnostic category. Analysis of data downloaded from home ventilators in clinically stable patients under long-term NIV, during elective home visits by specialized nurses. Data were collected from home ventilators of 150 patients with chronic obstructive pulmonary disease (n = 32), overlap syndrome (n = 29), obesity-hypoventilation (n = 38), neuromuscular disorders (n = 19), restrictive disorders (n = 21), and central sleep apnea syndrome (n = 11). On average, leaks were low, being lowest in patients with facial masks (vs. nasal masks), and increased with older age. Compliance was excellent in all groups. Patients with neuromuscular diseases triggered their ventilators less and tended to be 'captured', while other groups triggered at least half of inspiratory cycles. Most patients had a respiratory rate just slightly above the back-up rate. Residual apneas and hypopneas were highest in patients with central apneas. Built-in software of home ventilators provides the clinician with new parameters, some of which are a useful adjunct to recommended tools for monitoring NIV and may contribute to a better understanding of residual hypoventilation and/or desaturations. However, an independent validation of the accuracy of this information is mandatory. Copyright © 2011 S. Karger AG, Basel.

  19. The breakthrough of common rail system. Closed-loop control strategy using injector with built-in pressure sensor

    Energy Technology Data Exchange (ETDEWEB)

    Miyaki, Masahiko; Takeuchi, Katsuhiko; Ishizuka, Koji; Sasaki, Satoru [DENSO Corporation, Aichi-ken (Japan)

    2009-07-01

    DENSO has developed the world's first common rail system injector with built-in pressure sensor. This technology makes it possible to execute closed loop injection control in the cylinders, which has been one of the most challenging issues for diesel engine systems. Attaining both further fuel economy and emission reduction requires further technological innovation in the air system and fuel injection system. With the combustion technology that has been developed, stable combustion with high exhaust gas recirculation (EGR) is required in order to reduce nitrogen oxide's (NOx), however robustness is also required in order to handle bio-diesel and low-cetane value fuels and the range for attaining this is extremely narrow. Therefore, for the fuel injection system, in addition to conventional high pressure and high response, lifetime accuracy compensation is key. With this newly developed technology, the fuel injection rate, which determines the combustion within the engine cylinders, is directly detected and controlled in a closed loop to allow precise compensation of the injection system for its entire service life. Highly advanced injection control allows for extremely close multiple injections and variable injection rate control to be possible on the mass production level for the first time. Furthermore, the use of this technology can provide three major advantages for the overall engine system. Firstly succeeds in an expansion of the possible calibration range, which improves fuel economy and emissions, secondly it provides an improvement in the overall engine robustness and reliability. Thirdly, the use of closed loop control makes it possible to greatly reduce the man-hours required for calibration. Given this, the new DENSO common rail system using injectors with built-in pressure sensors is the first step to opening up a new era of diesel engine control. (orig.)

  20. Non-intrusive investigation of flow and heat transfer characteristics of a channel with a built-in circular cylinder

    Science.gov (United States)

    Vyas, Apoorv; Mishra, Biswajit; Agrawal, Atul; Srivastava, Atul

    2018-03-01

    Interferometry-based experimental investigation of heat transfer phenomena associated with a channel fitted with a circular cylinder has been reported. Experiments have been performed with water as the working fluid, and the range of Reynolds number considered is 75 ≤ Re ≤ 165. The circular cylinder, placed at the inlet section of the channel, provides a blockage ratio of 0.5. The experimental methodology has been benchmarked against the results of transient numerical simulations. In order to assess the performance of the channel fitted with a circular cylinder for possible heat transfer enhancement from the channel wall(s), experiments have also been performed on a plane channel (without a cylinder). The interferometry-based experiments clearly highlighted the influence of the built-in cylinder in generating the flow instabilities and alterations in the thermal boundary layer profile along the heated wall of the channel. The phenomenon of vortex shedding behind the cylinder was successfully captured. A gradual increase in the vortex shedding frequency was observed with increasing Reynolds number. Quantitative data in the form of two-dimensional temperature distributions revealed an increase in the strength of wall thermal gradients in the wake region of the cylinder due to the periodic shedding of the vortices. In turn, a clear enhancement in the wall heat transfer rates was observed for the case of the channel fitted with a cylinder vis-à-vis the plane channel. To the best of the knowledge of the authors, the work reported is one of the first attempts to provide the planar field experimental data for a channel configuration with a built-in circular cylinder using non-intrusive imaging techniques and has the potential to serve as one of the benchmark studies for validating the existing as well as future numerical studies in the related area.

  1. Leitlinie für Fakultäts-interne Leistungsnachweise während des Medizinstudiums: Ein Positionspapier des GMA-Ausschusses Prüfungen und des Kompetenzzentrums Prüfungen Baden-Württemberg [

    Directory of Open Access Journals (Sweden)

    ,

    2008-02-01

    Full Text Available [english] With the implementation of a new licensing regulation for doctors in 2002 the responsibility for assessment was assigned from the German national examination board to the individual faculties, especially so for clinical subjects.39 graded reports have to be issued between the first national board examination (after 2 years of preclinical studies and the start of the internship (6th year. This new task provides special demands for assessment organization at faculty level. A number of prerequisites have to be met to guarantee adequate quality in assessment. To support faculties in meeting these requirements, guidelines were issued in cooperation with GMA assessment committee and the Baden-Württemberg competence centre for assessment in medical education. Developed on broad consensus these guidelines define quality requirements based on international standards. Their effect on quality improvement in German medical faculty’s examinations in clinical subjects is to be researched concomitantly.[german] Die neue ärztliche Approbationsordnung (ÄAppO aus dem Jahre 2002 verlagert die Prüfungsverantwortung insbesondere für den klinischen Studienabschnitt auf die Fakultäten:39 benotete Leistungsnachweise sind zwischen der ersten Staatsprüfung und praktischem Jahr zu erstellen. Diese neue Aufgabe stellt besondere Anforderungen an das fakultäre Prüfungswesen. Um eine angemessene Qualität der fakultären Prüfungen sicher zu stellen, sind eine Reihe von Voraussetzungen zu erfüllen. Die vorliegenden Leitlinien des GMA-Ausschusses Prüfungen und des Kompetenzzentrums Prüfungen des Landes Baden-Württemberg wurden erstellt, um die Fakultäten in dieser Aufgabe zu unterstützen. Die vorliegenden Leitlinien definieren die Qualitätsanforderungen unter Berücksichtigung internationaler Standards und wurden in breitem Konsens entwickelt. Ihre Wirkung im Hinblick auf die Qualitätsverbesserung der fakultären Prüfungen im klinischen

  2. Transitions of bandgap and built-in stress for sputtered HfZnO thin films after thermal treatments

    Energy Technology Data Exchange (ETDEWEB)

    Li, Chih-Hung; Chen, Jian-Zhang [Institute of Applied Mechanics, National Taiwan University, Taipei City 10617, Taiwan (China); Cheng, I-Chun [Graduate Institute of Photonics and Optoelectronics and Department of Electrical Engineering, National Taiwan University, Taipei City 10617, Taiwan (China)

    2013-08-28

    HfZnO thin films with various Hf contents are sputter-deposited on glass substrates from Hf{sub x}Zn{sub 1−x}O (x = 0, 2.5, 5, 7.5, and 10 at. %) targets at room temperature. The incorporation of Hf in the ZnO film leads to the amorphorization of the materials. The amorphous structures of high-Hf-content films remain after annealing at 600 °C for 30 min. The built-in stresses of as-deposited films are compressive. As the annealing temperature increases, the stresses are relaxed and even become tensile. The films exhibit a high transmission of 80% in the visible region. The optical bandgap increases with the Hf content, but it decreases with the annealing temperature. This can be attributed to the alteration of strain (stress) status in the films and atomic substitution. The reduction of bandgap partly results from the grain growth, which is due to the quantum confinement effect of the small grains. Hf doping increases the resistivity of ZnO owing to the disorder of the material structure and the higher bandgap, which result in more carrier traps and less thermally excited carriers in the conduction bands.

  3. Investigation of the concrete foundation of the old living hut built in 1969 at Syowa Station, Antarctic

    Directory of Open Access Journals (Sweden)

    Takayuki Hirai

    2002-09-01

    Full Text Available Concrete specimens taken from the pier of the concrete foundation of the old living hut built in 1969 at Syowa Station, Antarctica, were brought back to Japan for investigation of deterioration conditions. This concrete was made by mixing alumina cement brought from Japan with gravel, sand, and water removed from melted snow, all taken from the surface ground of East Ongul Island on which Syowa Station is located, and by placing and shaping it into permanent form. The pier concrete is examined by composition analysis, compressive strength test and neutralization depth measurement of the cored sample. Transformation of the hydration products of alumina cement, from CAH10 to C3AH6 and AH3, was found to be completed. The maximum neutralization depth was found to be 26 mm. In addition, the compressive strength decreased by 22% from the time of construction as judged from a specimen at construction time. Based on these observations, deterioration of the concrete is in progress, but not to the extent that either its strength or durability is a problem with regard to serviceability.

  4. Efficient azo dye decolorization in a continuous stirred tank reactor (CSTR) with built-in bioelectrochemical system.

    Science.gov (United States)

    Cui, Min-Hua; Cui, Dan; Gao, Lei; Cheng, Hao-Yi; Wang, Ai-Jie

    2016-10-01

    A continuous stirred tank reactor with built-in bioelectrochemical system (CSTR-BES) was developed for azo dye Alizarin Yellow R (AYR) containing wastewater treatment. The decolorization efficiency (DE) of the CSTR-BES was 97.04±0.06% for 7h with sludge concentration of 3000mg/L and initial AYR concentration of 100mg/L, which was superior to that of the sole CSTR mode (open circuit: 54.87±4.34%) and the sole BES mode (without sludge addition: 91.37±0.44%). The effects of sludge concentration and sodium acetate (NaAc) concentration on azo dye decolorization were investigated. The highest DE of CSTR-BES for 4h was 87.66±2.93% with sludge concentration of 12,000mg/L, NaAc concentration of 2000mg/L and initial AYR concentration of 100mg/L. The results in this study indicated that CSTR-BES could be a practical strategy for upgrading conventional anaerobic facilities against refractory wastewater treatment. Copyright © 2016 Elsevier Ltd. All rights reserved.

  5. Smart ECG Monitoring Patch with Built-in R-Peak Detection for Long-Term HRV Analysis.

    Science.gov (United States)

    Lee, W K; Yoon, H; Park, K S

    2016-07-01

    Since heart rate variability (HRV) analysis is widely used to evaluate the physiological status of the human body, devices specifically designed for such applications are needed. To this end, we developed a smart electrocardiography (ECG) patch. The smart patch measures ECG using three electrodes integrated into the patch, filters the measured signals to minimize noise, performs analog-to-digital conversion, and detects R-peaks. The measured raw ECG data and the interval between the detected R-peaks can be recorded to enable long-term HRV analysis. Experiments were performed to evaluate the performance of the built-in R-wave detection, robustness of the device under motion, and applicability to the evaluation of mental stress. The R-peak detection results obtained with the device exhibited a sensitivity of 99.29%, a positive predictive value of 100.00%, and an error of 0.71%. The device also exhibited less motional noise than conventional ECG recording, being stable up to a walking speed of 5 km/h. When applied to mental stress analysis, the device evaluated the variation in HRV parameters in the same way as a normal ECG, with very little difference. This device can help users better understand their state of health and provide physicians with more reliable data for objective diagnosis.

  6. Study of built-in amplifier performance on HV-CMOS sensor for the ATLAS phase-II strip tracker upgrade

    Energy Technology Data Exchange (ETDEWEB)

    Liang, Z., E-mail: zhijun.liang@cern.ch [University of California Santa Cruz, Santa Cruz Institute for Particle Physics (SCIPP) (United States); Institute of High Energy Physics, Beijing (China); Affolder, A. [University of Liverpool (United Kingdom); Arndt, K. [University of Oxford (United Kingdom); Bates, R. [SUPA – School of Physics and Astronomy, University of Glasgow, Glasgow (United Kingdom); Benoit, M.; Di Bello, F. [University of Geneva (Switzerland); Blue, A. [SUPA – School of Physics and Astronomy, University of Glasgow, Glasgow (United Kingdom); Bortoletto, D. [University of Oxford (United Kingdom); Buckland, M. [University of Liverpool (United Kingdom); CERN, European Center for Nuclear Research (Switzerland); Buttar, C. [SUPA – School of Physics and Astronomy, University of Glasgow, Glasgow (United Kingdom); Caragiulo, P. [SLAC National Accelerator Laboratory (United States); Das, D.; Dopke, J. [Rutherford Appleton Laboratory, Didcot (United Kingdom); Dragone, A. [SLAC National Accelerator Laboratory (United States); Ehrler, F. [Karlsruhe Institute of Technology (Germany); Fadeyev, V.; Galloway, Z.; Grabas, H. [University of California Santa Cruz, Santa Cruz Institute for Particle Physics (SCIPP) (United States); Gregor, I.M. [Deutsches Elektronen-Synchrotron (Germany); Grenier, P. [SLAC National Accelerator Laboratory (United States); and others

    2016-09-21

    This paper focuses on the performance of analog readout electronics (built-in amplifier) integrated on the high-voltage (HV) CMOS silicon sensor chip, as well as its radiation hardness. Since the total collected charge from minimum ionizing particle (MIP) for the CMOS sensor is 10 times lower than for a conventional planar sensor, it is crucial to integrate a low noise built-in amplifier on the sensor chip to improve the signal to noise ratio of the system. As part of the investigation for the ATLAS strip detector upgrade, a test chip that comprises several pixel arrays with different geometries, as well as standalone built-in amplifiers and built-in amplifiers in pixel arrays has been fabricated in a 0.35 μm high-voltage CMOS process. Measurements of the gain and the noise of both the standalone amplifiers and built-in amplifiers in pixel arrays were performed before and after gamma radiation of up to 60 Mrad. Of special interest is the variation of the noise as a function of the sensor capacitance. We optimized the configuration of the amplifier for a fast rise time to adapt to the LHC bunch crossing period of 25 ns, and measured the timing characteristics including jitter. Our results indicate an adequate amplifier performance for monolithic structures used in HV-CMOS technology. The results have been incorporated in the next submission of a large-structure chip.

  7. Analysis of ISO/IEEE 11073 built-in security and its potential IHE-based extensibility.

    Science.gov (United States)

    Rubio, Óscar J; Trigo, Jesús D; Alesanco, Álvaro; Serrano, Luis; García, José

    2016-04-01

    The ISO/IEEE 11073 standard for Personal Health Devices (X73PHD) aims to ensure interoperability between Personal Health Devices and aggregators-e.g. health appliances, routers-in ambulatory setups. The Integrating the Healthcare Enterprise (IHE) initiative promotes the coordinated use of different standards in healthcare systems (e.g. Personal/Electronic Health Records, alert managers, Clinical Decision Support Systems) by defining profiles intended for medical use cases. X73PHD provides a robust syntactic model and a comprehensive terminology, but it places limited emphasis on security and on interoperability with IHE-compliant systems and frameworks. However, the implementation of eHealth/mHealth applications in environments such as health and fitness monitoring, independent living and disease management (i.e. the X73PHD domains) increasingly requires features such as secure connections to mobile aggregators-e.g. smartphones, tablets-, the sharing of devices among different users with privacy, and interoperability with certain IHE-compliant healthcare systems. This work proposes a comprehensive IHE-based X73PHD extension consisting of additive layers adapted to different eHealth/mHealth applications, after having analyzed the features of X73PHD (especially its built-in security), IHE profiles related with these applications and other research works. Both the new features proposed for each layer and the procedures to support them have been carefully chosen to minimize the impact on X73PHD, on its architecture (in terms of delays and overhead) and on its framework. Such implications are thoroughly analyzed in this paper. As a result, an extended model of X73PHD is proposed, preserving its essential features while extending them with added value. Copyright © 2016 Elsevier Inc. All rights reserved.

  8. Influence of hydrostatic pressure on the built-in electric field in ZnO/ZnMgO quantum wells

    Energy Technology Data Exchange (ETDEWEB)

    Teisseyre, Henryk, E-mail: teiss@ifpan.edu.pl [Institute of Physics, Polish Academy of Sciences, Al. Lotników 32/46, 02-668 Warsaw (Poland); Institute of High Pressure, Polish Academy of Sciences, Sokołowska 29/37, 01-142 Warsaw (Poland); Kaminska, Agata; Suchocki, Andrzej; Kozanecki, Adrian [Institute of Physics, Polish Academy of Sciences, Al. Lotników 32/46, 02-668 Warsaw (Poland); Birner, Stefan [nextnano GmbH, Südmährenstr. 21, 85586 Poing (Germany); Young, Toby D. [Institute of Fundamental Technological Research, Polish Academy of Sciences, ul. Pawińskiego, 5b, 02-106 Warsaw (Poland)

    2016-06-07

    We used high hydrostatic pressure to perform photoluminescence measurements on polar ZnO/ZnMgO quantum well structures. Our structure oriented along the c-direction (polar direction) was grown by plasma-assisted molecular beam epitaxy on a-plane sapphire. Due to the intrinsic electric field, which exists in polar wurtzite structure at ambient pressure, we observed a red shift of the emission related to the quantum-confined Stark effect. In the high hydrostatic pressure experiment, we observed a strong decrease of the quantum well pressure coefficients with increased thickness of the quantum wells. Generally, a narrower quantum well gave a higher pressure coefficient, closer to the band-gap pressure coefficient of bulk material 20 meV/GPa for ZnO, while for wider quantum wells it is much lower. We observed a pressure coefficient of 19.4 meV/GPa for a 1.5 nm quantum well, while for an 8 nm quantum well the pressure coefficient was equal to 8.9 meV/GPa only. This is explained by taking into account the pressure-induced increase of the strain in our structure. The strain was calculated taking in to account that in-plane strain is not equal (due to fact that we used a-plane sapphire as a substrate) and the potential distribution in the structure was calculated self-consistently. The pressure induced increase of the built-in electric field is the same for all thicknesses of quantum wells, but becomes more pronounced for thicker quantum wells due to the quantum confined Stark effect lowering the pressure coefficients.

  9. SPE coupled to AAS trace determination of Cd(II) and Zn(II) in food samples using amine functionalized GMA-MMA-EGDMA terpolymer: Isotherm and kinetic studies.

    Science.gov (United States)

    Islam, Aminul; Kumar, Suneel; Zaidi, Noushi; Ahmad, Hilal

    2016-12-15

    An ethylenediamine functionalized glycidyl methacrylate (GMA) based terpolymeric chelating resin was synthesized for the separation and preconcentration of Cd(II) and Zn(II) by SPE from bread, rice and fruit juice prior to FAAS determination. The resin was characterized by FT-IR, TGA/DTA, SEM, BET analysis and EDS. Synthesized resin shows a good capacity of 53.96mgg(-1) for Cd(II) and 24.19mgg(-1) for Zn(II) at pH 8.0. Five isotherm equilibrium models were studied to explain the sorption phenomenon out of which Langmuir, Dubinin-Radushkevich, Scatchard and Temkin models were found to be the best fitted. The limit of detection (LOD) and limit of quantification (LOQ) were observed to be 1.5 and 5.1μgL(-1) for Cd and 1.2 and 4.1μgL(-1) for Zn. The reliability of the method was investigated by the analysis of SRM and the recovery of analytes from various spiked food samples. Copyright © 2016 Elsevier Ltd. All rights reserved.

  10. Weight functions for the determination of stress intensity factor and T-stress for edge-cracked plates with built-in ends

    International Nuclear Information System (INIS)

    Li, J.; Wang, X.; Tan, C.L.

    2004-01-01

    This paper presents the weight functions for the determination of the stress intensity factor and T-stress solutions for edge-cracked plates with built-in ends under complex stress distributions. First, a compliance analysis approach is used to calculate stress intensity factor and T-stress for edge cracks in finite width plates with built-in ends with uniform or linear stress distributions acting on the crack face. The results serve as the reference solutions for the next step in which the approaches of deriving weight functions from reference stress intensity factor and T-stress solutions developed for stress boundary conditions are extended to obtain the corresponding weight functions for edge-cracked plates with built-in ends. Finite element analysis is conducted to validate the derived solutions. The weight functions derived are suitable for obtaining stress intensity factors and T-stress solutions under any complex stress field

  11. Structural Diagnostics of CFRP Composite Aircraft Components by Ultrasonic Guided Waves and Built-In Piezoelectric Transducers

    Energy Technology Data Exchange (ETDEWEB)

    Matt, Howard M. [Univ. of California, San Diego, CA (United States)

    2006-01-01

    To monitor in-flight damage and reduce life-cycle costs associated with CFRP composite aircraft, an autonomous built-in structural health monitoring (SHM) system is preferred over conventional maintenance routines and schedules. This thesis investigates the use of ultrasonic guided waves and piezoelectric transducers for the identification and localization of damage/defects occurring within critical components of CFRP composite aircraft wings, mainly the wing skin-to-spar joints. The guided wave approach for structural diagnostics was demonstrated by the dual application of active and passive monitoring techniques. For active interrogation, the guided wave propagation problem was initially studied numerically by a semi-analytical finite element method, which accounts for viscoelastic damping, in order to identify ideal mode-frequency combinations sensitive to damage occurring within CFRP bonded joints. Active guided wave tests across three representative wing skin-to-spar joints at ambient temperature were then conducted using attached Macro Fiber Composite (MFC) transducers. Results from these experiments demonstrate the importance of intelligent feature extraction for improving the sensitivity to damage. To address the widely neglected effects of temperature on guided wave base damage identification, analytical and experimental analyses were performed to characterize the influence of temperature on guided wave signal features. In addition, statistically-robust detection of simulated damage in a CFRP bonded joint was successfully achieved under changing temperature conditions through a dimensionally-low, multivariate statistical outlier analysis. The response of piezoceramic patches and MFC transducers to ultrasonic Rayleigh and Lamb wave fields was analytically derived and experimentally validated. This theory is useful for designing sensors which possess optimal sensitivity toward a given mode-frequency combination or for predicting the frequency dependent

  12. Estudo de alguns parâmetros básicos da soldagem GMAW com transferência por curto-circuito Evaluation of basic parameters of short-circuit GMA welding

    Directory of Open Access Journals (Sweden)

    Paulo J. Modenesi

    2011-03-01

    Full Text Available O processo de soldagem GMAW é caracterizado por uma forte interdependência de seus parâmetros operacionais e uma grande sensibilidade a variações destes. Estas características podem causar variações nas condições operacionais, dificultando o estabelecimento e a reprodução destas condições que, usualmente precisam ser verificadas pela realização de testes. Como uma forma de minimizar esta dificuldade e facilitar o entendimento da relação entre as variáveis deste processo, tem-se trabalhado no desenvolvimento de um modelo matemático capaz de simular aspectos elétricos e operacionais da soldagem GMAW. O objetivo do presente trabalho foi estudar procedimentos de determinação e fatores que afetam duas variáveis fundamentais para o desenvolvimento deste modelo (a resistividade elétrica do arame durante a soldagem e a soma das quedas de tensão anódica e catódica no arco, U AC na soldagem com transferência por curto-circuito. Os testes experimentais envolveram a deposição mecanizada de cordões emaço de baixo carbono usando arames do mesmo material com diferentes gases de proteção. Metodologias para a determinação dos parâmetros citados foram desenvolvidas com base em procedimentos similares indicados na literatura. Os detalhes destes procedimentos são avaliados, os resultados obtidos são comparados com dados da literatura e métodos para estimar a resistência elétrica entre o bico de contato e o eletrodo são apresentados. Os resultados sugerem valores para esta resistência entre 6 e 9 mΩ.GMA welding is characterized by a strong dependence between its operational parameters and a high sensitivity to small variations of those. These characteristics tend to make it harder to replicate welding conditions. It is also a barrier to welding automation and makes it necessary to perform a number of real welding tests before determining operational conditions for a given application. In order to contribute to reduce

  13. Durability study on material of wooden panel elements used for the old living hut built in 1969 at Syowa Station, Antarctica

    Directory of Open Access Journals (Sweden)

    Toshimasa Konishi

    2002-09-01

    Full Text Available The purpose of this study is to determine the durability of the old living hut built in 1969 at Syowa Station, Japan's permanent Antarctic observation facility, especially of its wooden panels. The hut, of high floor type wooden panel construction, was built in January 1969. To determine the durability, part of the hut, which was brought back to Japan after 30 years, was rebuilt, then taken apart again under controlled test conditions. Tests included visual observation, testing of the wooden material, and testing of the performance of the thermal insulation material. The results showed that the material in the roof panels deteriorated considerably more than that in the walls and floors. In the severe polar conditions, the strength of the overall structure depends heavily on the joints between panels. It is clear that material on the indoor sides, and in the interiors of the panels, hardly deteriorated at all after 30 years.

  14. Technical Insight of the High Level Safety Goal for the NPPs Built in China’S Thirteenth Five-Year Period (2016-2020)

    Energy Technology Data Exchange (ETDEWEB)

    Shi, G.; Zhan, W.; Mei, Q.; Sun, D., E-mail: shi@snerdi.com.cn [Shanghai Nuclear Engineering Research and Design Institute, SNPTC Shanghai (China)

    2014-10-15

    The “Nuclear Safety Planning” has been published in Oct. 2012 in China, which stipulates the safety goals for the NPPs which will be built in the future. As for the NPPs which will be built in China's Thirteenth Five-Year (2016-2020) and later, the high level safety goal is described as “the possibility of the large radioactive release should be practically eliminated by design”. A thorough investigation has been performed at SNERDI to explore the technical insights of this high level safety goal by using MEDP hierarchical safety goal approach. The definition of large release is proposed accordingly, DID requirements and probabilistic requirements are derived from this high level safety goal. (author)

  15. Miniaturization of a Quasi-Servo Valve and Its Application to Positon Control of a Rubber Artificial Muscle with Built-in Sensor

    Directory of Open Access Journals (Sweden)

    Moriwake Yoshinori

    2016-01-01

    Full Text Available Nowadays, the care and welfare pneumatic devices to support a nursing care and a self-reliance of the elderly and the disabled are actively researched and developed by many researchers. These wearable devices require many actuators and control valves for multi degrees of freedom. The total weight and volume of the wearable devices increases according to the degree of freedom. Our final goal is to develop a compact wearable actuator with built-in sensor, controller and control valve and to apply it to a wearable assisted device. In our previous study, a small-sized quasi-servo valve which consists of two on/off control valves and an embedded controller was developed. In this study, the quasi-servo valve composing of much smaller-sized (40% in mass, 42% in volume on/off valves is proposed and tested. In addition, the rubber artificial muscle with an ultrasonic sensor as a built-in displacement sensor is proposed and a position control of the muscle is carried out using the tested tiny valve and built-in sensor. As a result, it was confirmed that the position control of the muscle can be realized using the tested ultrasonic sensor.

  16. Laser-GMA Hybrid Pipe Welding System

    National Research Council Canada - National Science Library

    Reutzel, Edward W; Kern, Ludwig; Sullivan, Michael J; Tressler, Jay F; Avalos, Juan

    2007-01-01

    The combination of laser welding with conventional gas metal arc welding technology offers substantial increases in production rate of joining pipe through single-pass joining compared to multi-pass...

  17. Laser-GMA Hybrid Pipe Welding System

    Science.gov (United States)

    2007-11-01

    Investigation of varying laser power. The welded pipe is shown, with close -ups of the rootside reinforcement and macro sections...68 Figure 44. Investigation of varying laser stand-off. The welded pipe is shown, along with close -ups of backside...conventional beveled joints. With appropriate joint configuration and preparation, deep keyhole penetration provided by the laser and additional filler

  18. In-situ calibration of clinical built-in KAP meters with traceability to a primary standard using a reference KAP meter.

    Science.gov (United States)

    Malusek, A; Helmrot, E; Sandborg, M; Grindborg, J-E; Carlsson, G Alm

    2014-12-07

    The air kerma-area product (KAP) is used for settings of diagnostic reference levels. The International Atomic Energy Agency (IAEA) recommends that doses in diagnostic radiology (including the KAP values) be estimated with an accuracy of at least ± 7% (k = 2). Industry standards defined by the International Electrotechnical Commission (IEC) specify that the uncertainty of KAP meter measurements should be less than ± 25% (k = 2). Medical physicists willing to comply with the IAEA's recommendation need to apply correction factors to KAP values reported by x-ray units. The aim of this work is to present and evaluate a calibration method for built-in KAP meters on clinical x-ray units. The method is based on (i) a tandem calibration method, which uses a reference KAP meter calibrated to measure the incident radiation, (ii) measurements using an energy-independent ionization chamber to correct for the energy dependence of the reference KAP meter, and (iii) Monte Carlo simulations of the beam quality correction factors that correct for differences between beam qualities at a standard laboratory and the clinic. The method was applied to the KAP meter in a Siemens Aristos FX plus unit. It was found that values reported by the built-in KAP meter differed from the more accurate values measured by the reference KAP meter by more than 25% for high tube voltages (more than 140 kV) and heavily filtered beams (0.3 mm Cu). Associated uncertainties were too high to claim that the IEC's limit of 25% was exceeded. Nevertheless the differences were high enough to justify the need for a more accurate calibration of built-in KAP meters.

  19. Home noninvasive positive pressure ventilation with built-in software in stable hypercapnic COPD: a short-term prospective, multicenter, randomized, controlled trial.

    Science.gov (United States)

    Zhou, Luqian; Li, Xiaoying; Guan, Lili; Chen, Jianhua; Guo, Bingpeng; Wu, Weiliang; Huo, Yating; Zhou, Ziqing; Liang, Zhenyu; Zhou, Yuqi; Tan, Jie; Chen, Xin; Song, Yuanlin; Chen, Rongchang

    2017-01-01

    The benefits of noninvasive positive pressure ventilation (NPPV) in patients with hypercapnic COPD are controversial. It is presumed that methodology and appropriate use of NIV ventilator might be crucial for the outcomes. With the new built-in software, the performance of NIV can be monitored at home, which can guarantee the compliance and appropriate use. This study investigated effects of home use of NIV in hypercapnia in COPD patients using the NIV ventilator with built-in software for monitoring. The current multicenter prospective, randomized, controlled trial enrolled patients with stable GOLD stages III and IV hypercapnic COPD. Patients were randomly assigned via a computer-generated randomization sequence, with a block size of four patients, to continue optimized treatment (control group) or to receive additional NPPV (intervention group) for 3 months. The primary outcome was arterial carbon dioxide pressure (PaCO 2 ). Data were derived from built-in software and analyzed every 4 weeks. Analysis was carried out with the intention to treat. This study is registered with ClinicalTrials.gov, number NCT02499718. Patients were recruited from 20 respiratory units in China from October 1, 2015, and recruitment was terminated with a record of the vital statistics on May 31, 2016. A total of 115 patients were randomly assigned to the NPPV group (n=57) or the control group (n=58). Patients complied well with NPPV therapy (mean [± standard deviation] day use 5.6±1.4 h). The mean estimation of leaks was 37.99±13.71 L/min. The changes in PaCO 2 (-10.41±0.97 vs -4.32±0.68 mmHg, P =0.03) and 6-min walk distance (6MWD) (38.2% vs 18.2%, P =0.02) were statistically significant in the NPPV group versus the control group. COPD assessment test (CAT) showed a positive trend ( P =0.06) in favor of the NPPV group. Pulmonary function and dyspnea were not different between groups. Ventilators equipped with built-in software provided methodology for monitoring NIV use at home

  20. TLC-SERS Plates with a Built-In SERS Layer Consisting of Cap-Shaped Noble Metal Nanoparticles Intended for Environmental Monitoring and Food Safety Assurance

    Directory of Open Access Journals (Sweden)

    H. Takei

    2015-01-01

    Full Text Available We report on a thin layer chromatograph (TLC with a built-in surface enhanced Raman scattering (SERS layer for in-situ identification of chemical species separated by TLC. Our goal is to monitor mixture samples or diluted target molecules suspended in a host material, as happens often in environmental monitoring or detection of food additives. We demonstrate that the TLC-SERS can separate mixture samples and provide in-situ SERS spectra. One sample investigated was a mixture consisting of equal portions of Raman-active chemical species, rhodamine 6 G (R6G, crystal violet (CV, and 1,2-di(4-pyridylethylene (BPE. The three components could be separated and their SERS spectra were obtained from different locations. Another sample was skim milk with a trace amount of melamine. Without development, no characteristic peaks were observed, but after development, a peak was observed at 694 cm−1. Unlike previous TLC-SERS whereby noble metal nanoparticles are added after development of a sample, having a built-in SERS layer greatly facilitates analysis as well as maintaining high uniformity of noble metal nanoparticles.

  1. Effective suppression of efficiency droop in GaN-based light-emitting diodes: role of significant reduction of carrier density and built-in field

    Science.gov (United States)

    Yoo, Yang-Seok; Na, Jong-Ho; Son, Sung Jin; Cho, Yong-Hoon

    2016-10-01

    A critical issue in GaN-based high power light-emitting diodes (LEDs) is how to suppress the efficiency droop problem occurred at high current injection while improving overall quantum efficiency, especially in conventional c-plane InGaN/GaN quantum well (QW), without using complicated bandgap engineering or unconventional materials and structures. Although increasing thickness of each QW may decrease carrier density in QWs, formation of additional strain and defects as well as increased built-in field effect due to enlarged QW thickness are unavoidable. Here, we propose a facile and effective method for not only reducing efficiency droop but also improving quantum efficiency by utilizing c-plane InGaN/GaN QWs having thinner barriers and increased QW number while keeping the same single well thickness and total active layer thickness. As the barrier thickness decreases and the QW number increases, both internal electric field and carrier density within QWs are simultaneously reduced without degradation of material quality. Furthermore, we found overall improved efficiency and reduced efficiency droop, which was attributed to the decrease of the built-in field and to less influence by non-radiative recombination processes at high carrier density. This simple and effective approach can be extended further for high power ultraviolet, green, and red LEDs.

  2. Impact of built-in fields and contact configuration on the characteristics of ultra-thin GaAs solar cells

    Energy Technology Data Exchange (ETDEWEB)

    Aeberhard, Urs, E-mail: u.aeberhard@fz-juelich.de [IEK-5 Photovoltaik, Forschungszentrum Jülich, D-52425 Jülich (Germany)

    2016-07-18

    We discuss the effects of built-in fields and contact configuration on the photovoltaic characteristics of ultra-thin GaAs solar cells. The investigation is based on advanced quantum-kinetic simulations reaching beyond the standard semi-classical bulk picture concerning the consideration of charge carrier states and dynamics in complex potential profiles. The thickness dependence of dark and photocurrent in the ultra-scaled regime is related to the corresponding variation of both, the built-in electric fields and associated modification of the density of states, and the optical intensity in the films. Losses in open-circuit voltage and short-circuit current due to the leakage of electronically and optically injected carriers at minority carrier contacts are investigated for different contact configurations including electron and hole blocking barrier layers. The microscopic picture of leakage currents is connected to the effect of finite surface recombination velocities in the semi-classical description, and the impact of these non-classical contact regions on carrier generation and extraction is analyzed.

  3. Homepages: Built-in Motivation.

    Science.gov (United States)

    McKenzie, Cheryl

    2000-01-01

    Describes a Web-building class aimed at motivating English-as-a-Foreign-Language students to improve their English writing and editing skills while building a homepage. All students had a basic or better knowledge of keyboarding and Internet search techniques, two had advanced computer skills, but none had ever created a homepage. (Author/VWL)

  4. Built-in potential shift and Schottky-barrier narrowing in organic solar cells with UV-sensitive electron transport layers.

    Science.gov (United States)

    Li, Cheng; Credgington, Dan; Ko, Doo-Hyun; Rong, Zhuxia; Wang, Jianpu; Greenham, Neil C

    2014-06-28

    The performance of organic solar cells incorporating solution-processed titanium suboxide (TiOx) as electron-collecting layers can be improved by UV illumination. We study the mechanism of this improvement using electrical measurements and electroabsorption spectroscopy. We propose a model in which UV illumination modifies the effective work function of the oxide layer through a significant increase in its free electron density. This leads to a dramatic improvement in device power conversion efficiency through several mechanisms - increasing the built-in potential by 0.3 V, increasing the conductivity of the TiOx layer and narrowing the interfacial Schottky barrier between the suboxide and the underlying transparent electrode. This work highlights the importance of considering Fermi-level equilibration when designing multi-layer transparent electrodes.

  5. A built-in mechanism to mitigate the spread of insect-resistance and herbicide-tolerance transgenes into weedy rice populations.

    Directory of Open Access Journals (Sweden)

    Chengyi Liu

    Full Text Available BACKGROUND: The major challenge of cultivating genetically modified (GM rice (Oryza sativa at the commercial scale is to prevent the spread of transgenes from GM cultivated rice to its coexisting weedy rice (O. sativa f. spontanea. The strategic development of GM rice with a built-in control mechanism can mitigate transgene spread in weedy rice populations. METHODOLOGY/PRINCIPAL FINDINGS: An RNAi cassette suppressing the expression of the bentazon detoxifying enzyme CYP81A6 was constructed into the T-DNA which contained two tightly linked transgenes expressing the Bt insecticidal protein Cry1Ab and the glyphosate tolerant 5-enolpyruvylshikimate-3-phosphate synthase (EPSPS, respectively. GM rice plants developed from this T-DNA were resistant to lepidopteran pests and tolerant to glyphosate, but sensitive to bentazon. The application of bentazon of 2000 mg/L at the rate of 40 mL/m(2, which is approximately the recommended dose for the field application to control common rice weeds, killed all F(2 plants containing the transgenes generated from the Crop-weed hybrids between a GM rice line (CGH-13 and two weedy rice strains (PI-63 and PI-1401. CONCLUSIONS/SIGNIFICANCE: Weedy rice plants containing transgenes from GM rice through gene flow can be selectively killed by the spray of bentazon when a non-GM rice variety is cultivated alternately in a few-year interval. The built-in control mechanism in combination of cropping management is likely to mitigate the spread of transgenes into weedy rice populations.

  6. A Built-In Mechanism to Mitigate the Spread of Insect-Resistance and Herbicide-Tolerance Transgenes into Weedy Rice Populations

    Science.gov (United States)

    Liu, Chengyi; Li, Jingjing; Gao, Jianhua; Shen, Zhicheng; Lu, Bao-Rong; Lin, Chaoyang

    2012-01-01

    Background The major challenge of cultivating genetically modified (GM) rice (Oryza sativa) at the commercial scale is to prevent the spread of transgenes from GM cultivated rice to its coexisting weedy rice (O. sativa f. spontanea). The strategic development of GM rice with a built-in control mechanism can mitigate transgene spread in weedy rice populations. Methodology/Principal Findings An RNAi cassette suppressing the expression of the bentazon detoxifying enzyme CYP81A6 was constructed into the T-DNA which contained two tightly linked transgenes expressing the Bt insecticidal protein Cry1Ab and the glyphosate tolerant 5-enolpyruvylshikimate-3-phosphate synthase (EPSPS), respectively. GM rice plants developed from this T-DNA were resistant to lepidopteran pests and tolerant to glyphosate, but sensitive to bentazon. The application of bentazon of 2000 mg/L at the rate of 40 mL/m2, which is approximately the recommended dose for the field application to control common rice weeds, killed all F2 plants containing the transgenes generated from the Crop-weed hybrids between a GM rice line (CGH-13) and two weedy rice strains (PI-63 and PI-1401). Conclusions/Significance Weedy rice plants containing transgenes from GM rice through gene flow can be selectively killed by the spray of bentazon when a non-GM rice variety is cultivated alternately in a few-year interval. The built-in control mechanism in combination of cropping management is likely to mitigate the spread of transgenes into weedy rice populations. PMID:22359609

  7. Students, teachers and technicians are installing a cosmic ray detector in the CMS visitor gallery. The detector was designed and built in the framework of the US Quarknet project under the supervision of physicists from the Notre Dame University (USA)

    CERN Document Server

    Claudia Marcelloni

    2007-01-01

    Students, teachers and technicians are installing a cosmic ray detector in the CMS visitor gallery. The detector was designed and built in the framework of the US Quarknet project under the supervision of physicists from the Notre Dame University (USA)

  8. Electromodulation spectroscopy of direct optical transitions in Ge{sub 1−x}Sn{sub x} layers under hydrostatic pressure and built-in strain

    Energy Technology Data Exchange (ETDEWEB)

    Dybała, F.; Żelazna, K.; Maczko, H.; Gladysiewicz, M.; Misiewicz, J.; Kudrawiec, R., E-mail: robert.kudrawiec@pwr.wroc.pl [Faculty of Fundamental Problems of Technology, Wroclaw University of Technology, Wybrzeze Wyspianskiego 27, 50-370 Wrocław (Poland); Lin, H.; Chen, R.; Shang, C.; Huo, Y.; Kamins, T. I.; Harris, J. S. [Solid State and Photonics Laboratory, Stanford University, Stanford, California 94305-4075 (United States)

    2016-06-07

    Unstrained Ge{sub 1−x}Sn{sub x} layers of various Sn concentration (1.5%, 3%, 6% Sn) and Ge{sub 0.97}Sn{sub 0.03} layers with built-in compressive (ε = −0.5%) and tensile (ε = 0.3%) strain are grown by molecular beam epitaxy and studied by electromodulation spectroscopy (i.e., contactless electroreflectance and photoreflectance (PR)). In order to obtain unstrained GeSn layers and layers with different built-in in-plane strains, virtual InGaAs substrates of different compositions are grown prior to the deposition of GeSn layers. For unstrained Ge{sub 1−x}Sn{sub x} layers, the pressure coefficient for the direct band gap transition is determined from PR measurements at various hydrostatic pressures to be 12.2 ± 0.2 meV/kbar, which is very close to the pressure coefficient for the direct band gap transition in Ge (12.9 meV/kbar). This suggests that the hydrostatic deformation potentials typical of Ge can be applied to describe the pressure-induced changes in the electronic band structure of Ge{sub 1−x}Sn{sub x} alloys with low Sn concentrations. The same conclusion is derived for the uniaxial deformation potential, which describes the splitting between heavy-hole (HH) and light-hole (LH) bands as well as the strain-related shift of the spin-orbit (SO) split-off band. It is observed that the HH, LH, and SO related transitions shift due to compressive and tensile strain according to the Bir-Pikus theory. The dispersions of HH, LH, and SO bands are calculated for compressive and tensile strained Ge{sub 0.97}Sn{sub 0.03} with the 8-band kp Hamiltonian including strain effects, and the mixing of HH and LH bands is discussed. In addition, the dispersion of the electronic band structure is calculated for unstrained Ge{sub 1−x}Sn{sub x} layers (3% and 6% Sn) at high hydrostatic pressure with the 8-band kp Hamiltonian, and the pressure-induced changes in the electronic band structure are discussed.

  9. Investigation of the pressure drop inside a rectangular channel with a built-in U-shaped tube bundle heat exchanger

    Directory of Open Access Journals (Sweden)

    Xi-yue Liu

    2017-01-01

    Full Text Available A simplified approach which utilizes an isotropic porous medium model has been widely adopted for modeling the flow through a compact heat exchanger. With respect to situations where the compact heat exchangers are partially installed inside a channel, such as the application of recuperators in an intercooled recuperative engine, the use of an isotropic porous medium model needs to be carefully assessed because the flow passing through the heat exchanger is very complicated. For this purpose, in this study the isotropic porous medium model is assessed together with specific pressure–velocity relationships for flow field modeling inside a rectangular channel with a built-in double-U-shaped tube bundle heat exchanger. Firstly, experiments were conducted using models to investigate the relationship between the pressure drop and the inlet velocity for a specific heat exchanger with different installation angles inside a rectangular channel. Secondly, a series of numerical computations were carried out using the isotropic porous medium model and the pressure–velocity relationship was then modified by introducing correction coefficients empirically. Finally, a three-dimensional (3-D direct computation was made using a computational fluid dynamics (CFD method for the comparison of detailed flow fields. The results suggest that the isotropic porous medium model is capable of making precise pressure drop predictions given the reasonable pressure–velocity relationship but is unable to precisely simulate the detailed flow features.

  10. Cross-stacked carbon nanotube film as an additional built-in current collector and adsorption layer for high-performance lithium sulfur batteries.

    Science.gov (United States)

    Sun, Li; Kong, Weibang; Li, Mengya; Wu, Hengcai; Jiang, Kaili; Li, Qunqing; Zhang, Yihe; Wang, Jiaping; Fan, Shoushan

    2016-02-19

    Cross-stacked carbon nanotube (CNT) film is proposed as an additional built-in current collector and adsorption layer in sulfur cathodes for advanced lithium sulfur (Li-S) batteries. On one hand, the CNT film with high conductivity, microstructural rough surface, high flexibility and mechanical durability retains stable and direct electronic contact with the sulfur cathode materials, therefore decreasing internal resistivity and suppressing polarization of the cathode. On the other hand, the highly porous structure and the high surface area of the CNT film provide abundant adsorption points to support and confine sulfur cathode materials, alleviate their aggregation and promote high sulfur utilization. Moreover, the lightweight and compact structure of the CNT film adds no extra weight or volume to the sulfur cathode, benefitting the improvement of energy densities. Based on these characteristics, the sulfur cathode with a 100-layer cross-stacked CNT film presents excellent rate performances with capacities of 986, 922 and 874 mAh g(-1) at cycling rates of 0.2C, 0.5C and 1C for sulfur loading of 60 wt%, corresponding to an improvement of 52%, 109% and 146% compared to that without a CNT film. Promising cycling performances are also demonstrated, offering great potential for scaled-up production of sulfur cathodes for Li-S batteries.

  11. Effect of aging and adhesive durability on panel plywood of the old living hut built in 1969 at Syowa Station, Antarctica

    Directory of Open Access Journals (Sweden)

    Hirotsugu Sekiguchi

    2002-09-01

    Full Text Available We herein report on an evaluation of durability of plywood of the old living hut built in 1969 brought back to Japan in terms of adhesiveness as well as adhesive strength between of wooden frame and plywood. Measuring water absorption percentage of test samples taken from wooden panel, we tested on adhesive bonding between veneers and compressed shearing of plywood and wooden frame ,and then measure their adhesive bonding. As a result, we conclude that plywood used for interior obtains high adhesive strength due to low water absorption percentage of the plywood on the other hand, the absorption strength of plywood for exterior is remarkably weakened because of the high water absorption percentage. In addition to that, since adhesive strength between panel plywood and wooden frame is stronger than that of between veneers, epoxy resin is suitable, yet we recognized that adhesion specs on metal panel for exterior should be reviewed in future. After all, weakened adhesive strength of plywood is mainly caused by moisture content in the plywood, and in order to improve panel durability, it is necessary to prevent wooden materials from rising moisture content with countermeasures of incoming of snow melting water, anti-condensation , and anti-rust of steel plate for exterior wall, as well as improve performance of water resisting adhesive.

  12. A Built-In CpG Adjuvant in RSV F Protein DNA Vaccine Drives a Th1 Polarized and Enhanced Protective Immune Response

    Directory of Open Access Journals (Sweden)

    Yao Ma

    2018-01-01

    Full Text Available Human respiratory syncytial virus (RSV is the most significant cause of acute lower respiratory infection in children. However, there is no licensed vaccine available. Here, we investigated the effect of five or 20 copies of C-Class of CpG ODN (CpG-C motif incorporated into a plasmid DNA vaccine encoding RSV fusion (F glycoprotein on the vaccine-induced immune response. The addition of CpG-C motif enhanced serum binding and virus-neutralizing antibody responses in BALB/c mice immunized with the DNA vaccines. Moreover, mice vaccinated with CpG-modified vaccines, especially with the higher 20 copies, resulted in an enhanced shift toward a Th1-biased antibody and T-cell response, a decrease in pulmonary pathology and virus replication, and a decrease in weight loss after RSV challenge. This study suggests that CpG-C motif, cloned into the backbone of DNA vaccine encoding RSV F glycoprotein, functions as a built-in adjuvant capable of improving the efficacy of DNA vaccine against RSV infection.

  13. Characterization of the Photon Counting CHASE Jr., Chip Built in a 40-nm CMOS Process With a Charge Sharing Correction Algorithm Using a Collimated X-Ray Beam

    Energy Technology Data Exchange (ETDEWEB)

    Krzyżanowska, A. [AGH-UST, Cracow; Deptuch, G. W. [Fermilab; Maj, P. [AGH-UST, Cracow; Gryboś, P. [AGH-UST, Cracow; Szczygieł, R. [AGH-UST, Cracow

    2017-08-01

    This paper presents the detailed characterization of a single photon counting chip, named CHASE Jr., built in a CMOS 40-nm process, operating with synchrotron radiation. The chip utilizes an on-chip implementation of the C8P1 algorithm. The algorithm eliminates the charge sharing related uncertainties, namely, the dependence of the number of registered photons on the discriminator’s threshold, set for monochromatic irradiation, and errors in the assignment of an event to a certain pixel. The article presents a short description of the algorithm as well as the architecture of the CHASE Jr., chip. The analog and digital functionalities, allowing for proper operation of the C8P1 algorithm are described, namely, an offset correction for two discriminators independently, two-stage gain correction, and different operation modes of the digital blocks. The results of tests of the C8P1 operation are presented for the chip bump bonded to a silicon sensor and exposed to the 3.5- μm -wide pencil beam of 8-keV photons of synchrotron radiation. It was studied how sensitive the algorithm performance is to the chip settings, as well as the uniformity of parameters of the analog front-end blocks. Presented results prove that the C8P1 algorithm enables counting all photons hitting the detector in between readout channels and retrieving the actual photon energy.

  14. Integrated built-in-test false and missed alarms reduction based on forward infinite impulse response & recurrent finite impulse response dynamic neural networks

    Science.gov (United States)

    Cui, Yiqian; Shi, Junyou; Wang, Zili

    2017-11-01

    Built-in tests (BITs) are widely used in mechanical systems to perform state identification, whereas the BIT false and missed alarms cause trouble to the operators or beneficiaries to make correct judgments. Artificial neural networks (ANN) are previously used for false and missed alarms identification, which has the features such as self-organizing and self-study. However, these ANN models generally do not incorporate the temporal effect of the bottom-level threshold comparison outputs and the historical temporal features are not fully considered. To improve the situation, this paper proposes a new integrated BIT design methodology by incorporating a novel type of dynamic neural networks (DNN) model. The new DNN model is termed as Forward IIR & Recurrent FIR DNN (FIRF-DNN), where its component neurons, network structures, and input/output relationships are discussed. The condition monitoring false and missed alarms reduction implementation scheme based on FIRF-DNN model is also illustrated, which is composed of three stages including model training, false and missed alarms detection, and false and missed alarms suppression. Finally, the proposed methodology is demonstrated in the application study and the experimental results are analyzed.

  15. Estimating state of charge and health of lithium-ion batteries with guided waves using built-in piezoelectric sensors/actuators

    Science.gov (United States)

    Ladpli, Purim; Kopsaftopoulos, Fotis; Chang, Fu-Kuo

    2018-04-01

    This work presents the feasibility of monitoring state of charge (SoC) and state of health (SoH) of lithium-ion pouch batteries with acousto-ultrasonic guided waves. The guided waves are propagated and sensed using low-profile, built-in piezoelectric disc transducers that can be retrofitted onto off-the-shelf batteries. Both experimental and analytical studies are performed to understand the relationship between guided waves generated in a pitch-catch mode and battery SoC/SoH. The preliminary experiments on representative pouch cells show that the changes in time of flight (ToF) and signal amplitude (SA) resulting from shifts in the guided wave signals correlate strongly with the electrochemical charge-discharge cycling and aging. An analytical acoustic model is developed to simulate the variations in electrode moduli and densities during cycling, which correctly validates the absolute values and range of experimental ToF. It is further illustrated via a statistical study that ToF and SA can be used in a prediction model to accurately estimate SoC/SoH. Additionally, by using multiple sensors in a network configuration on the same battery, a significantly more reliable and accurate SoC/SoH prediction is achieved. The indicative results from this study can be extended to develop a unified guided-wave-based framework for SoC/SoH monitoring of many lithium-ion battery applications.

  16. arXiv Charge collection properties in an irradiated pixel sensor built in a thick-film HV-SOI process

    CERN Document Server

    INSPIRE-00541780; Cindro, V.; Gorišek, A.; Hemperek, T.; Kishishita, T.; Kramberger, G.; Krüger, H.; Mandić, I.; Mikuž, M.; Wermes, N.; Zavrtanik, M.

    2017-10-25

    Investigation of HV-CMOS sensors for use as a tracking detector in the ATLAS experiment at the upgraded LHC (HL-LHC) has recently been an active field of research. A potential candidate for a pixel detector built in Silicon-On-Insulator (SOI) technology has already been characterized in terms of radiation hardness to TID (Total Ionizing Dose) and charge collection after a moderate neutron irradiation. In this article we present results of an extensive irradiation hardness study with neutrons up to a fluence of 1x10e16 neq/cm2. Charge collection in a passive pixelated structure was measured by Edge Transient Current Technique (E-TCT). The evolution of the effective space charge concentration was found to be compliant with the acceptor removal model, with the minimum of the space charge concentration being reached after 5x10e14 neq/cm2. An investigation of the in-pixel uniformity of the detector response revealed parasitic charge collection by the epitaxial silicon layer characteristic for the SOI design. The r...

  17. Novel absorptivity centering method utilizing normalized and factorized spectra for analysis of mixtures with overlapping spectra in different matrices using built-in spectrophotometer software.

    Science.gov (United States)

    Lotfy, Hayam Mahmoud; Omran, Yasmin Rostom

    2018-07-05

    A novel, simple, rapid, accurate, and economical spectrophotometric method, namely absorptivity centering (a-Centering) has been developed and validated for the simultaneous determination of mixtures with partially and completely overlapping spectra in different matrices using either normalized or factorized spectrum using built-in spectrophotometer software without a need of special purchased program. Mixture I (Mix I) composed of Simvastatin (SM) and Ezetimibe (EZ) is the one with partial overlapping spectra formulated as tablets, while mixture II (Mix II) formed by Chloramphenicol (CPL) and Prednisolone acetate (PA) is that with complete overlapping spectra formulated as eye drops. These procedures do not require any separation steps. Resolution of spectrally overlapping binary mixtures has been achieved getting recovered zero-order (D 0 ) spectrum of each drug, then absorbance was recorded at their maxima 238, 233.5, 273 and 242.5 nm for SM, EZ, CPL and PA, respectively. Calibration graphs were established with good correlation coefficients. The method shows significant advantages as simplicity, minimal data manipulation besides maximum reproducibility and robustness. Moreover, it was validated according to ICH guidelines. Selectivity was tested using laboratory-prepared mixtures. Accuracy, precision and repeatability were found to be within the acceptable limits. The proposed method is good enough to be applied to an assay of drugs in their combined formulations without any interference from excipients. The obtained results were statistically compared with those of the reported and official methods by applying t-test and F-test at 95% confidence level concluding that there is no significant difference with regard to accuracy and precision. Generally, this method could be used successfully for the routine quality control testing. Copyright © 2018 Elsevier B.V. All rights reserved.

  18. First experiences with apartment buildings built in monolithic construction to Passivhaus standard; Erste Erfahrungen mit Mehrfamilien-Passivhaeusern in monolithischer Bauweise

    Energy Technology Data Exchange (ETDEWEB)

    Messari-Becker, Lamia; Bollinger, Klaus; Grohmann, Manfred [Bollinger + Grohmann Ingenieure GmbH, Frankfurt am Main (Germany)

    2011-02-15

    For the first time, apartment buildings are being built in monolithic construction that meet the most exacting requirements regarding energy efficiency and sustainability. These buildings are under construction in the northern district of Kalbach Sued in Frankfurt (Main) by ABG Frankfurt Holding. The architectural design was produced by Scheffler and Partners, the Frankfurt structural engineers Bollinger + Grohmann undertook the structural design including building physics and energy related aspects, and Baumgartner Engineers took charge of M and E design. These apartment buildings are the first monolithically constructed apartment buildings built to Passivhaus standard. They therefore represent a milestone in single-skin monolithic construction in connection with an exacting energy standard. The challenge for architects and engineers was to consider a range of different aspects and accommodate them in the design. In addition to given parameters such as the urban development plan, client requirements such as the number of apartments, aspects of family living and barrier-free standards, the briefing called for the highest construction standard in terms of efficient use of resources in the widest sense. This meant that the emphasis was not only on energy efficiency. Cost efficiency throughout the entire lifecycle of the building was equally as important in order to ensure long term economic sustainability for users and owners. The experience gained on this project will also provide answers to important questions regarding research and development in sustainable building, which is not in any conflict with the creativity and diversity of our architectural culture. (Copyright copyright 2011 Ernst and Sohn Verlag fuer Architektur und technische Wissenschaften GmbH and Co. KG, Berlin)

  19. Performance of a glucose meter with a built-in automated bolus calculator versus manual bolus calculation in insulin-using subjects.

    Science.gov (United States)

    Sussman, Allen; Taylor, Elizabeth J; Patel, Mona; Ward, Jeanne; Alva, Shridhara; Lawrence, Andrew; Ng, Ronald

    2012-03-01

    Patients consider multiple parameters in adjusting prandial insulin doses for optimal glycemic control. Difficulties in calculations can lead to incorrect doses or induce patients to administer fixed doses, rely on empirical estimates, or skip boluses. A multicenter study was conducted with 205 diabetes subjects who were on multiple daily injections of rapid/ short-acting insulin. Using the formula provided, the subjects manually calculated two prandial insulin doses based on one high and one normal glucose test result, respectively. They also determined the two doses using the FreeStyle InsuLinx Blood Glucose Monitoring System, which has a built-in, automated bolus calculator. After dose determinations, the subjects completed opinion surveys. Of the 409 insulin doses manually calculated by the subjects, 256 (63%) were incorrect. Only 23 (6%) of the same 409 dose determinations were incorrect using the meter, and these errors were due to either confirmed or potential deviations from the study instructions by the subjects when determining dose with meter. In the survey, 83% of the subjects expressed more confidence in the meter-calculated doses than the manually calculated doses. Furthermore, 87% of the subjects preferred to use the meter than manual calculation to determine prandial insulin doses. Insulin-using patients made errors in more than half of the manually calculated insulin doses. Use of the automated bolus calculator in the FreeStyle InsuLinx meter minimized errors in dose determination. The patients also expressed confidence and preference for using the meter. This may increase adherence and help optimize the use of mealtime insulin. © 2012 Diabetes Technology Society.

  20. A Neural Network Approach for GMA Butt Joint Welding

    DEFF Research Database (Denmark)

    Christensen, Kim Hardam; Sørensen, Torben

    2003-01-01

    This paper describes the application of the neural network technology for gas metal arc welding (GMAW) control. A system has been developed for modeling and online adjustment of welding parameters, appropriate to guarantee a certain degree of quality in the field of butt joint welding with full...... penetration, when the gap width is varying during the welding process. The process modeling to facilitate the mapping from joint geometry and reference weld quality to significant welding parameters has been based on a multi-layer feed-forward network. The Levenberg-Marquardt algorithm for non-linear least...

  1. Microstructural Characterization of HSLA-100 GMA-Weldments

    Science.gov (United States)

    1987-09-01

    Intermeiate Oxygen Regime ----------- 66 D.) Schematic CCT Diagram - --------------- 66 9 ACKNOWLEDGEMENTS I wish to express my appreciation to my thesis...have been observed in this research [review Figures 31 (a), (b) and 35 (a)]. Figure 38 (d) shows a schematic CCT diagram reported by Glover (Ref. 5) and...Regime B.) High Ox. gen Regime C. )Interme late Oxygen Regime D.1 Schematic CCT Diagram 66 LIST OF REFERENCES 1. Anderson, T.L., Hyatt J A West, J.C

  2. Structure/property relationships in multipass GMA welding of beryllium.

    Energy Technology Data Exchange (ETDEWEB)

    Hochanadel, P. W. (Patrick W.); Hults, W. L. (William L.); Thoma, D. J. (Dan J.); Dave, V. R. (Vivek R.); Kelly, A. M. (Anna Marie); Pappin, P. A. (Pallas A.); Cola, M. J. (Mark J.); Burgardt, P. (Paul)

    2001-01-01

    Beryllium is an interesting metal that has a strength to weight ratio six times that of steel. Because of its unique mechanical properties, beryllium is used in aerospace applications such as satellites. In addition, beryllium is also used in x-ray windows because it is nearly transparent to x-rays. Joining of beryllium has been studied for decades (Ref.l). Typically joining processes include braze-welding (either with gas tungsten arc or gas metal arc), soldering, brazing, and electron beam welding. Cracking which resulted from electron beam welding was recently studied to provide structure/property relationships in autogenous welds (Ref. 2). Braze-welding utilizes a welding arc to melt filler, and only a small amount of base metal is melted and incorporated into the weld pool. Very little has been done to characterize the braze-weld in terms of the structure/property relationships, especially with reference to multipass welding. Thus, this investigation was undertaken to evaluate the effects of multiple passes on microstructure, weld metal composition, and resulting material properties for beryllium welded with aluminum-silicon filler metal.

  3. Quality assurance and control for robotic GMA welding

    International Nuclear Information System (INIS)

    Xie Max X.

    1992-01-01

    A quality assurance (QA) model has been developed. This model systematically considers the relevant activities before, during and after the welding operations with respect to quality. Efficient quality assurance requires that the functionality of the present robotic welding systems needs to be increased and that the knowledge of the personnel involved in the design and production needs to be improved. The collaboration between different departments and personnel needs also to be improved. The procedure specification aspects have been studied and a method for the determination of optimal welding parameters is presented with regards to process stability, quality requirements and productivity. A main productivity problem of robotic welding systems for small series production is due to the time spent on the specification of welding procedures. In order to improve the efficiency, expert systems technology has been studied and applied to automatically generate optimal welding procedures. An objective method for the assessment of process stability has been developed, based upon the analysis of the electrical signals of welding arcs. Furthermore, a method has been developed to monitor the process stability. It is found that it is possible to identify the causes of the disturbance of process stability and to predict the weld quality characteristics based on the analysis of the electrical signals. Though quality is formed during the welding operation, the diagnosis of the causes of quality disturbances is important for the prevention of quality problems of subsequent welds and has been discussed. To assist the operators, expert systems technology is also applied. Further work should be directed to the integration of various QA functions in the robotic arc welding system so that both quality and productivity aspects of the system ban be further improved. (au)

  4. A Neural Network Approach for GMA Butt Joint Welding

    DEFF Research Database (Denmark)

    Christensen, Kim Hardam; Sørensen, Torben

    2003-01-01

    penetration, when the gap width is varying during the welding process. The process modeling to facilitate the mapping from joint geometry and reference weld quality to significant welding parameters has been based on a multi-layer feed-forward network. The Levenberg-Marquardt algorithm for non-linear least......This paper describes the application of the neural network technology for gas metal arc welding (GMAW) control. A system has been developed for modeling and online adjustment of welding parameters, appropriate to guarantee a certain degree of quality in the field of butt joint welding with full...

  5. Control of GMA Butt Joint Welding Based on Neural Networks

    DEFF Research Database (Denmark)

    Christensen, Kim Hardam; Sørensen, Torben

    2004-01-01

    This paper presents results from an experimentally based research on Gas Metal Arc Welding (GMAW), controlled by the artificial neural network (ANN) technology. A system has been developed for modeling and online adjustment of welding parameters, appropriate to guarantee a high degree of quality......-linear least square error minimization, has been used with the back-propagation algorithm for training the network, while a Bayesian regularization technique has been successfully applied for minimizing the risk of inexpedient over-training....

  6. Biology's built-in Faraday cages

    Science.gov (United States)

    Klee, Maurice M.

    2014-05-01

    Biological fluids are water-based, ionic conductors. As such, they have both high relative dielectric constants and substantial conductivities, meaning they are lossy dielectrics. These fluids contain charged molecules (free charges), whose movements play roles in essentially all cellular processes from metabolism to communication with other cells. Using the problem of a point source in air above a biological fluid of semi-infinite extent, the bound charges in the fluid are shown to perform the function of a fast-acting Faraday cage, which protects the interior of the fluid from external electric fields. Free charges replace bound charges in accordance with the fluid's relaxation time, thereby providing a smooth transition between the initial protection provided by the bound charges and the steady state protection provided by the free charges. The electric fields within the biological fluid are thus small for all times just as they would be inside a classical Faraday cage.

  7. Pseudo 2-transistor active pixel sensor using an n-well/gate-tied p-channel metal oxide semiconductor field eeffect transistor-type photodetector with built-in transfer gate

    Science.gov (United States)

    Seo, Sang-Ho; Seo, Min-Woong; Kong, Jae-Sung; Shin, Jang-Kyoo; Choi, Pyung

    2008-11-01

    In this paper, a pseudo 2-transistor active pixel sensor (APS) has been designed and fabricated by using an n-well/gate-tied p-channel metal oxide semiconductor field effect transistor (PMOSFET)-type photodetector with built-in transfer gate. The proposed sensor has been fabricated using a 0.35 μm 2-poly 4-metal standard complementary metal oxide semiconductor (CMOS) logic process. The pseudo 2-transistor APS consists of two NMOSFETs and one photodetector which can amplify the generated photocurrent. The area of the pseudo 2-transistor APS is 7.1 × 6.2 μm2. The sensitivity of the proposed pixel is 49 lux/(V·s). By using this pixel, a smaller pixel area and a higher level of sensitivity can be realized when compared with a conventional 3-transistor APS which uses a pn junction photodiode.

  8. Hydrostatic Pressure and Built-In Electric Field Effects on the Donor Impurity States in Cylindrical Wurtzite GaN/AlxGa1−xN Quantum Rings

    Directory of Open Access Journals (Sweden)

    Guangxin Wang

    2015-01-01

    Full Text Available Within the framework of the effective mass approximation, the ground-state binding energy of a hydrogenic impurity is investigated in cylindrical wurtzite GaN/AlxGa1-xN strained quantum ring (QR by means of a variational approach, considering the influence of the applied hydrostatic pressure along the QR growth direction and the strong built-in electric field (BEF due to the piezoelectricity and spontaneous polarization. Numerical results show that the donor binding energy for a central impurity increases inchmeal firstly as the QR radial thickness (ΔR decreases gradually and then begins to drop quickly. In addition, the donor binding energy is an increasing (a decreasing function of the inner radius (height. It is also found that the donor binding energy increases almost linearly with the increment of the applied hydrostatic pressure. Moreover, we also found that impurity positions have an important influence on the donor binding energy. The physical reasons have been analyzed in detail.

  9. A new vision of management competencies built in Business Simulations

    Directory of Open Access Journals (Sweden)

    Gabriel Vianna Schlatter

    2015-09-01

    Full Text Available This paper presents a survey conducted on users of an online business simulation for an undergraduate Business Administration course. Previous research on the use of business simulations described the validity of this resource as a method for developing managerial skills, as well as the perceptions of students about the experience. However, few studies sought to directly assess which management competencies are built through the use of simulators. In this study, students expressed their perception of the management competencies developed by participating in the simulation. The survey was structured according to the macro-competencies proposed by the Tuning Latin America Project and identified those with higher and lower perceived development.  It was found that the simulation was useful in building up competencies related to the use of information to support decision-making, management of company resources at the operational level and the identification and management of business risks. Moreover, it was possible to determine through factor analysis that the construction of various competencies occurred simultaneously, creating more elaborate assemblies. Five sets, composed of several competencies, have been identified and described as: carrying out undertakings based on data and facts; managing organization´s processes and projects; developing their own planning process; acting primarily with social responsibility; and, managing change risks through teamwork.

  10. CMOS Image Sensor with a Built-in Lane Detector

    Directory of Open Access Journals (Sweden)

    Li-Chen Fu

    2009-03-01

    Full Text Available This work develops a new current-mode mixed signal Complementary Metal-Oxide-Semiconductor (CMOS imager, which can capture images and simultaneously produce vehicle lane maps. The adopted lane detection algorithm, which was modified to be compatible with hardware requirements, can achieve a high recognition rate of up to approximately 96% under various weather conditions. Instead of a Personal Computer (PC based system or embedded platform system equipped with expensive high performance chip of Reduced Instruction Set Computer (RISC or Digital Signal Processor (DSP, the proposed imager, without extra Analog to Digital Converter (ADC circuits to transform signals, is a compact, lower cost key-component chip. It is also an innovative component device that can be integrated into intelligent automotive lane departure systems. The chip size is 2,191.4 x 2,389.8 mm, and the package uses 40 pin Dual-In-Package (DIP. The pixel cell size is 18.45 x 21.8 mm and the core size of photodiode is 12.45 x 9.6 mm; the resulting fill factor is 29.7%.

  11. Built-In Test Engine For Memory Test

    OpenAIRE

    McEvoy, Paul; Farrell, Ronan

    2004-01-01

    In this paper we will present an on-chip method for testing high performance memory devices, that occupies minimal area and retains full flexibility. This is achieved through microcode test instructions and the associated on-chip state machine. In addition, the proposed methodology will enable at-speed testing of memory devices. The relevancy of this work is placed in context with an introduction to memory testing and the techniques and algorithms generally used today.

  12. MPR multi-purpose reactor to be built in Egypt

    International Nuclear Information System (INIS)

    Anon.

    1992-01-01

    Competing with two enterprises from the US and Canada and with a French-German consortium, INVAP won a bid for the supply of a research reactor to Egypt. This is the most important contract ever made by Argentina involving the supply, on a turnkey operation, of a complex facility that incorporates advanced technologies developed in our country and for a sum of approximately 80 million US dollars

  13. CMOS Image Sensor with a Built-in Lane Detector.

    Science.gov (United States)

    Hsiao, Pei-Yung; Cheng, Hsien-Chein; Huang, Shih-Shinh; Fu, Li-Chen

    2009-01-01

    This work develops a new current-mode mixed signal Complementary Metal-Oxide-Semiconductor (CMOS) imager, which can capture images and simultaneously produce vehicle lane maps. The adopted lane detection algorithm, which was modified to be compatible with hardware requirements, can achieve a high recognition rate of up to approximately 96% under various weather conditions. Instead of a Personal Computer (PC) based system or embedded platform system equipped with expensive high performance chip of Reduced Instruction Set Computer (RISC) or Digital Signal Processor (DSP), the proposed imager, without extra Analog to Digital Converter (ADC) circuits to transform signals, is a compact, lower cost key-component chip. It is also an innovative component device that can be integrated into intelligent automotive lane departure systems. The chip size is 2,191.4 × 2,389.8 μm, and the package uses 40 pin Dual-In-Package (DIP). The pixel cell size is 18.45 × 21.8 μm and the core size of photodiode is 12.45 × 9.6 μm; the resulting fill factor is 29.7%.

  14. On the effect of N-GaN/P-GaN/N-GaN/P-GaN/N-GaN built-in junctions in the n-GaN layer for InGaN/GaN light-emitting diodes.

    Science.gov (United States)

    Kyaw, Zabu; Zhang, Zi-Hui; Liu, Wei; Tan, Swee Tiam; Ju, Zhen Gang; Zhang, Xue Liang; Ji, Yun; Hasanov, Namig; Zhu, Binbin; Lu, Shunpeng; Zhang, Yiping; Sun, Xiao Wei; Demir, Hilmi Volkan

    2014-01-13

    N-GaN/P-GaN/N-GaN/P-GaN/N-GaN (NPNPN-GaN) junctions embedded between the n-GaN region and multiple quantum wells (MQWs) are systematically studied both experimentally and theoretically to increase the performance of InGaN/GaN light emitting diodes (LEDs) in this work. In the proposed architecture, each thin P-GaN layer sandwiched in the NPNPN-GaN structure is completely depleted due to the built-in electric field in the NPNPN-GaN junctions, and the ionized acceptors in these P-GaN layers serve as the energy barriers for electrons from the n-GaN region, resulting in a reduced electron over flow and enhanced the current spreading horizontally in the n- GaN region. These lead to increased optical output power and external quantum efficiency (EQE) from the proposed device.

  15. Virtual Reality Presentation of Moment Tensor Analysis by SiGMA

    International Nuclear Information System (INIS)

    Ohtsu, Masayasu; Shigeishi, Mitsuhiro

    2003-01-01

    Nucleation of a crack is readily defected by acoustic emission (AE) method. One powerful technique for AE waveform analysis has been developed as SiGMh (Simplified Greens functions for Moment tensor Analysis), as crack kinematics of locations, types and orientations are quantitatively determined. Because these kinematical outcomes are obtained as three-dimensional (3-D) locations and vectors, 3-D visualization is definitely desirable. To this end, the visualization system has been developed by using VRML (Virtual Reality Modeling Language). As an application, failure protest of a reinforced concrete beam is discussed

  16. Optimization of arc-start performance by wire-feeding control for GMA welding

    Energy Technology Data Exchange (ETDEWEB)

    Kang, Jong Gu; Ryu, Gyeong Su; Rhee, Se Hun [Hanyang University, Seoul (Korea, Republic of); Kim, Dong Cheol; Kang, Mun Jin [Korea Institute of Industrial Technology, Incheon (Korea, Republic of); Park, Young Whan [Pukyong National University, Busan (Korea, Republic of)

    2013-02-15

    The wire feeding system for gas metal arc welding usually consists of a wire feeder and a torch. In many industries, the distance between the wire feeder and the torch is generally 3 m to 5 m. In a conventional wire feeder, a direct current (DC) motor is used for wire feeding. However, a significant problem with this system is the impossibility of feedback control because of inner or outer impedance. In this paper, a digital wire feeder was developed by using a DC encoder motor and a push-pull torch. An optimized wire-feeding system was also developed by experiment. The welding process was observed using a high-speed camera. The resulting wire-feeding system exhibits low spatter generation and arc stability.

  17. Active site of mycobacterial dUTPase: Structural characteristics and a built-in sensor

    International Nuclear Information System (INIS)

    Varga, Balazs; Barabas, Orsolya; Takacs, Eniko; Nagy, Nikolett; Nagy, Peter; Vertessy, Beata G.

    2008-01-01

    dUTPases are essential to eliminate dUTP for DNA integrity and provide dUMP for thymidylate biosynthesis. Mycobacterium tuberculosis apparently lacks any other thymidylate biosynthesis pathway, therefore dUTPase is a promising antituberculotic drug target. Crystal structure of the mycobacterial enzyme in complex with the isosteric substrate analog, α,β-imido-dUTP and Mg 2+ at 1.5 A resolution was determined that visualizes the full-length C-terminus, previously not localized. Interactions of a conserved motif important in catalysis, the Mycobacterium-specific five-residue-loop insert and C-terminal tetrapeptide could now be described in detail. Stacking of C-terminal histidine upon the uracil moiety prompted replacement with tryptophan. The resulting sensitive fluorescent sensor enables fast screening for binding of potential inhibitors to the active site. K d for α,β-imido-dUTP binding to mycobacterial dUTPase is determined to be 10-fold less than for human dUTPase, which is to be considered in drug optimization. A robust continuous activity assay for kinetic screening is proposed

  18. Design and Characterization of a Built-In CMOS TID Smart Sensor

    Science.gov (United States)

    Agustin, Javier; Gil, Carlos; Lopez-Vallejo, Marisa; Ituero, Pablo

    2015-04-01

    This paper describes a total ionization dose (TID) sensor that presents the following advantages: it is a digital sensor able to be integrated in CMOS circuits; it has a configurable sensitivity that allows radiation doses ranging from very low to high levels; its interface helps to integrate this design in a multidisciplinary sensor network; and it is self-timed, hence it does not need a clock signal. We designed, implemented and manufactured the sensor in a 0.35 μm CMOS commercial technology. It was irradiated with a 60Co source. This test was used to characterize the sensor in terms of the radiation response up to 575 krad. After irradiation, we monitored the sensor to control charge redistribution and annealing effects for 80 hours. We also exposed our design to meticulous temperature analysis from 0 to 50°C and we studied the acceleration on the annealing phenomena due to high temperatures. Sensor calibration takes into account the results of all tests. Finally we propose to use this sensor in a self-recovery system. The sensor manufactured in this work has an area of 0.047 mm 2, of which 22% is dedicated to measuring radiation. Its energy per conversion is 463 pJ.

  19. Reconstruction and durability study of the old living hut built in 1969 at Syowa Station, Antarctica

    Directory of Open Access Journals (Sweden)

    Toshio Hannuki

    2002-09-01

    Full Text Available The living hut was built by the 10th Japanese Antarctic Research Expedition (JARE-10 at Syowa Station in 1969. The living hut, which had been used over 29 years at Syowa Station, was demolished and the prefabricated building elements of the hut were brought back to Japan in 1998. The building elements were reconstructed for the durability test and the present conditions of the reconstructed living hut were investigated. The reconstruction work of the hut was finished within 5 days and with a total of 22 workers. The elements and devices were usable on the whole. The building can be reused if damaged parts are restored and external facing and interior finish are renewed.

  20. Enhancing self-healing of lime mortars by built-in crystallization inhibitors

    NARCIS (Netherlands)

    Granneman, S.J.C.; Lubelli, B.; Van Hees, R.P.J.

    2013-01-01

    The weathering of porous materials due to the presence of salts has been known since antiquity. However, serious studies and investigations were not conducted until the 19th century. One of the fi elds of interest includes historic masonry, where salt damage can affect natural stone, brick and

  1. Theoretical study of built-in-polarization effect on relaxation time and ...

    Indian Academy of Sciences (India)

    Thermal management issues for miniaturised devices and their application for energy production through thermoelec- ... They have reported a method of improving ther- ..... [3] Morkoc H 2008 Handbook of nitride semiconductors and devices ...

  2. Modular Autonomous C&DH Software with Built-In Simulation/Test, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — NASA, the Department of Defense (DoD), and Commercial spacecraft programs have the desire to minimize program costs while continuing to ensure mission robustness and...

  3. Silently transformable: the many ways bacteria conceal their built-in capacity of genetic exchange.

    Science.gov (United States)

    Attaiech, Laetitia; Charpentier, Xavier

    2017-06-01

    Bacteria can undergo genetic transformation by actively integrating genetic information from phylogenetically related or unrelated organisms. The original function of natural transformation remains a subject of debate, but it is well established as a major player in genome evolution. Naturally transformable bacteria use a highly conserved DNA uptake system to internalize DNA and integrate it in their chromosome by homologous recombination. Expression of the DNA uptake system, often referred to as competence, is tightly controlled and induced by signals that are often elusive. Initially thought to be restricted to a few bacterial species, natural transformation increasingly seems widespread in bacteria. Yet, the triggering signals and regulatory mechanisms involved appear diverse and are understood only in a limited set of species. As a result, natural transformation in most bacterial species remains poorly documented and the potential impact of this mechanism on global genetic mobilization is likely underappreciated. Indeed, even when a conserved activator can be identified to artificially induce the expression of the DNA uptake system, the considered species may still remain non-transformable. Recent works indicate that the DNA uptake system is directly subjected to silencing. At least in Legionella pneumophila and possibly in other species, a small non-coding RNA prevents expression of the DNA uptake system. Silencing constitutes one more way bacteria control expression of their engine of genetic exchange. It may also be the underlying reason of the undetectable natural transformation of many bacterial species grown under laboratory conditions even though they possess a DNA uptake system.

  4. A built-in radiotracer (24Na) for measuring circulation catalyst rates

    International Nuclear Information System (INIS)

    Domondon, D.B; Berbano, M.C.

    1975-01-01

    A local petroleum refinery intended to calibrate its catalyst flow measuring instrument (propeller blade) using the radioactive tracer technique (RTT). For this purpose, a method of incorporating a suitable radiotracer in commercial catalyst beads had to be found. Two methods of labelling are described. One method involved the incorporation of the radiotracer in a gel of the same composition as the commercial catalyst and subsequent conversion of the gel into a from like that of the commercial catalyst beads. Another method utilized the strong adsorptive properties of the commercial catalyst beads for the chosen isotopes, e.g., 144 Cs, 46 Sc. To effect quantitative adsorption, commercial catalyst beads were simply stirred in a slightly acidic (pH4) chloride solution of the radiotracers for some time. The radiotracers were found to distribute almost uniformly over the entire catalyst surface and no evidence of volatilization of the isotopes from the catalyst surface under condition of use in commercial units was observed. Another probable method was suggested by the Research and Development Division, Philippine Atomic Energy Commission. Aluminium is a major component of the ceramic catalyst beads and sodium is present as impurity. Hence, a radiotracer ( 24 Na) can be formed in the beads by the reaction 23 Na (n,gamma) 24 Na, 27 Al (n,alpha) 24 Na. This possible method of simply irradiating the commercial catalyst beads in the reactor thereby inducing the radiotracer. 24 Na in situ fulfils all the criteria for the selection of an appropriate radiotracer. The method is very simple but reliable

  5. Concurrent progressive-ratio schedules: built-in controls in the study of delayed reward efficacy.

    Science.gov (United States)

    Jarmolowicz, David P; Hudnall, Jennifer L

    2014-08-15

    Delayed rewards maintain lower rates of operant responding than immediate rewards, and when given a choice between immediate and delayed rewards, individuals typically choose the immediate reward, even when it is smaller (a phenomenon called delay discounting). The behavioral and neural mechanisms underlying these behavioral patterns, however, are not conclusively understood. The present study developed a method to examine the efficacy of delayed rewards in a way that is suitable for pharmacological manipulation of delayed reward efficacy (while controlling for general changes in reward efficacy). The progressive ratio (PR) paradigm often used to examine reward efficacy was modified such that two PR schedules for lever pressing concurrently yet independently were presented. Across a series of conditions, a range of delays (3-81s) were arranged on one of the levers while the reward on the other lever remained immediate. PR breakpoints (the highest ratio completed on each lever, our measure of reward efficacy) systematically decreased on the delayed, but not on the immediate reward lever, suggesting that delays decreased reward efficacy. This decrease in breakpoint resulted in bias in within-session responding that was accounted for by models that adjusted reward value by the delay to that reward. Unlike the standard PR paradigm, the present arrangement provided the controls needed to differentiate delay specific from general changes in reward efficacy. The present method should be helpful in the study of the behavioral and neural mechanisms of delayed reward efficacy. Modifications of the present paradigm should be useful for pharmacological studies. Copyright © 2014 Elsevier B.V. All rights reserved.

  6. The Ocean Observatories Initiative: Data Acquisition Functions and Its Built-In Automated Python Modules

    Science.gov (United States)

    Smith, M. J.; Vardaro, M.; Crowley, M. F.; Glenn, S. M.; Schofield, O.; Belabbassi, L.; Garzio, L. M.; Knuth, F.; Fram, J. P.; Kerfoot, J.

    2016-02-01

    The Ocean Observatories Initiative (OOI), funded by the National Science Foundation, provides users with access to long-term datasets from a variety of oceanographic sensors. The Endurance Array in the Pacific Ocean consists of two separate lines off the coasts of Oregon and Washington. The Oregon line consists of 7 moorings, two cabled benthic experiment packages and 6 underwater gliders. The Washington line comprises 6 moorings and 6 gliders. Each mooring is outfitted with a variety of instrument packages. The raw data from these instruments are sent to shore via satellite communication and in some cases, via fiber optic cable. Raw data is then sent to the cyberinfrastructure (CI) group at Rutgers where it is aggregated, parsed into thousands of different data streams, and integrated into a software package called uFrame. The OOI CI delivers the data to the general public via a web interface that outputs data into commonly used scientific data file formats such as JSON, netCDF, and CSV. The Rutgers data management team has developed a series of command-line Python tools that streamline data acquisition in order to facilitate the QA/QC review process. The first step in the process is querying the uFrame database for a list of all available platforms. From this list, a user can choose a specific platform and automatically download all available datasets from the specified platform. The downloaded dataset is plotted using a generalized Python netcdf plotting routine that utilizes a data visualization toolbox called matplotlib. This routine loads each netCDF file separately and outputs plots by each available parameter. These Python tools have been uploaded to a Github repository that is openly available to help facilitate OOI data access and visualization.

  7. Built-In Device Orientation Sensors for Ad-Hoc Pairing and Spatial Awareness

    DEFF Research Database (Denmark)

    Grønbæk, Jens Emil; O'Hara, Kenton

    Mobile devices are equipped with multiple sensors. The ubiquity of these sensors is key in their ability to support in-the-wild application and use. Building on the ubiquity we look at how we can use this existing sensing infrastructure combined with user mediation to support ad-hoc sharing with ...

  8. Reconfigurable EVA Radio with Built-In Navigation Capability, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — Intelligent Automation, Inc. and its sub-contractor, Purdue University, propose to develop a power-efficient miniaturized reconfigurable EVA radio system with...

  9. Image deblurring in smartphone devices using built-in inertial measurement sensors

    Science.gov (United States)

    Šindelář, Ondřej; Šroubek, Filip

    2013-01-01

    Long-exposure handheld photography is degraded with blur, which is difficult to remove without prior information about the camera motion. In this work, we utilize inertial sensors (accelerometers and gyroscopes) in modern smartphones to detect exact motion trajectory of the smartphone camera during exposure and remove blur from the resulting photography based on the recorded motion data. The whole system is implemented on the Android platform and embedded in the smartphone device, resulting in a close-to-real-time deblurring algorithm. The performance of the proposed system is demonstrated in real-life scenarios.

  10. Image deblurring in smartphone devices using built-in inertial measurement sensors

    Czech Academy of Sciences Publication Activity Database

    Šindelář, O.; Šroubek, Filip

    2013-01-01

    Roč. 22, č. 1 (2013), 011003-1-011003-8 ISSN 1017-9909 R&D Projects: GA ČR GAP103/11/1552 Grant - others:GA AV ČR(CZ) M100751201 Institutional support: RVO:67985556 Keywords : deconvolution * motion sensors * smartphone s Subject RIV: JD - Computer Applications, Robotics Impact factor: 0.850, year: 2013 http://library.utia.cas.cz/separaty/2013/ZOI/sroubek-0389233.pdf

  11. 26 CFR 1.1502-15 - SRLY limitation on built-in losses.

    Science.gov (United States)

    2010-04-01

    ... the same transferor (whether corporate or non-corporate, foreign or domestic) pursuant to the same... immediately before becoming a member of the M group, notwithstanding their actual affiliation history. As a..., value $20), in exchange for T stock in a transaction that is described in section 351. (ii) P's...

  12. X-ray TV image analyzer with built-in microcomputer

    International Nuclear Information System (INIS)

    Takizawa, Masaomi; Maruyama, Kiyoshi; Fujii, Tadashige; Hirayama, Jiro

    1979-01-01

    X-ray TV system (XTV) is indispensable for inspections such as cardiac catheter inspection and urinary tract inspection as well as gastrointestinal tract inspection. The XTV has been so far employed for observing the appropriate time for making images and grasping the position to be photographed in X-ray photographing. However, taking the considerable amount of radiation exposure given to patients during fluoroscopy into account, it is better to utilize the information within living bodies more effectively. The experiments to record fluoroscopic images using VTRs (video tape recorder) and to analyze the moving pictures by means of VTR playback have been carried out by videodensitometry and videoplanimetry. The authors have produced an image analyzing system of XTV, which incorporates a microprocessor, on the basis of the experiences of minicomputer-assisted videodensitometry. The system uses the digital frame memory controlled by a microcomputer, and transfers the data from this memory to the main memory by the command from the microcomputer. This alloys to sample freely image data in any direction. To the microprocessor memory, 16 kbytes EPROM (erasable and programmable read only memory) and 16 kbytes RAM (random access memory) are attached. At present, the programs for the measurement of such as the inspection of local pulmonary function and the change of urethrae in urination accompanying the imaging of bladders are being developed. Some results of videodensitometry under test are presented. Wider applications for future are expected in the discussions. (Wakatsuki, Y.)

  13. Image deblurring in smartphone devices using built-in inertial measurement sensors

    Czech Academy of Sciences Publication Activity Database

    Šindelář, O.; Šroubek, Filip

    2013-01-01

    Roč. 22, č. 1 (2013), 011003-1-011003-8 ISSN 1017-9909 R&D Projects: GA ČR GAP103/11/1552 Grant - others:GA AV ČR(CZ) M100751201 Institutional support: RVO:67985556 Keywords : deconvolution * motion sensors * smartphones Subject RIV: JD - Computer Applications, Robotics Impact factor: 0.850, year: 2013 http://library.utia.cas.cz/separaty/2013/ZOI/sroubek-0389233.pdf

  14. G-protein-coupled receptor structures were not built in a day.

    Science.gov (United States)

    Blois, Tracy M; Bowie, James U

    2009-07-01

    Among the most exciting recent developments in structural biology is the structure determination of G-protein-coupled receptors (GPCRs), which comprise the largest class of membrane proteins in mammalian cells and have enormous importance for disease and drug development. The GPCR structures are perhaps the most visible examples of a nascent revolution in membrane protein structure determination. Like other major milestones in science, however, such as the sequencing of the human genome, these achievements were built on a hidden foundation of technological developments. Here, we describe some of the methods that are fueling the membrane protein structure revolution and have enabled the determination of the current GPCR structures, along with new techniques that may lead to future structures.

  15. Utilization of probabilistic methods for evaluating the safety of PWRs built in France

    International Nuclear Information System (INIS)

    Queniart, D.; Brisbois, J.; Lanore, J.M.

    1985-01-01

    Firstly, it is recalled that, in France, PWRs are designed on a deterministic basis by studying the consequences of a limited number of conventional incidents whose estimated frequency is specified in order-of-magnitude terms and for which it is shown that the consequences, for each category of frequency, predominate over those of the other situations in the same category. These situations are called dimensioning situations. The paper then describes the use made of probabilistic methods. External attacks and loss of redundant systems are examined in particular. A probabilistic approach is in fact well suited to the evaluation of risks due, among other things, to aircraft crashes and the industrial environment. Analysis of the reliability of redundant systems has shown that, in the light of the overall risk assessment objective, their loss should be examined with a view to instituting counteraction to reduce the risks associated with such loss (particularly the introduction of special control procedures). Probabilistic methods are used to evaluate the effectiveness of the counteraction proposed and such a study has been carried out for total loss of electric power supply. Finally, the probabilistic study of hazard initiated post factum by the French safety authorities for the standardized 900 MW(e) power units is described. The study, which is not yet complete, will serve as the basis for a permanent safety analysis tool taking into account control procedures and the total operating experience acquired using these power units. (author)

  16. Protein-only, antimicrobial peptide-containing recombinant nanoparticles with inherent built-in antibacterial activity.

    Science.gov (United States)

    Serna, Naroa; Sánchez-García, Laura; Sánchez-Chardi, Alejandro; Unzueta, Ugutz; Roldán, Mónica; Mangues, Ramón; Vázquez, Esther; Villaverde, Antonio

    2017-09-15

    The emergence of bacterial antibiotic resistances is a serious concern in human and animal health. In this context, naturally occurring cationic antimicrobial peptides (AMPs) might play a main role in a next generation of drugs against bacterial infections. Taking an innovative approach to design self-organizing functional proteins, we have generated here protein-only nanoparticles with intrinsic AMP microbicide activity. Using a recombinant version of the GWH1 antimicrobial peptide as building block, these materials show a wide antibacterial activity spectrum in absence of detectable toxicity on mammalian cells. The GWH1-based nanoparticles combine clinically appealing properties of nanoscale materials with full biocompatibility, structural and functional plasticity and biological efficacy exhibited by proteins. Because of the largely implemented biological fabrication of recombinant protein drugs, the protein-based platform presented here represents a novel and scalable strategy in antimicrobial drug design, that by solving some of the limitations of AMPs offers a promising alternative to conventional antibiotics. The low molecular weight antimicrobial peptide GWH1 has been engineered to oligomerize as self-assembling protein-only nanoparticles of around 50nm. In this form, the peptide exhibits potent and broad antibacterial activities against both Gram-positive and Gram-negative bacteria, without any harmful effect over mammalian cells. As a solid proof-of-concept, this finding strongly supports the design and biofabrication of nanoscale antimicrobial materials with in-built functionalities. The protein-based homogeneous composition offer advantages over alternative materials explored as antimicrobial agents, regarding biocompatibility, biodegradability and environmental suitability. Beyond the described prototype, this transversal engineering concept has wide applicability in the design of novel nanomedicines for advanced treatments of bacterial infections. Copyright © 2017 Acta Materialia Inc. Published by Elsevier Ltd. All rights reserved.

  17. Respiratory rate estimation from the built-in cameras of smartphones and tablets.

    Science.gov (United States)

    Nam, Yunyoung; Lee, Jinseok; Chon, Ki H

    2014-04-01

    This paper presents a method for respiratory rate estimation using the camera of a smartphone, an MP3 player or a tablet. The iPhone 4S, iPad 2, iPod 5, and Galaxy S3 were used to estimate respiratory rates from the pulse signal derived from a finger placed on the camera lens of these devices. Prior to estimation of respiratory rates, we systematically investigated the optimal signal quality of these 4 devices by dividing the video camera's resolution into 12 different pixel regions. We also investigated the optimal signal quality among the red, green and blue color bands for each of these 12 pixel regions for all four devices. It was found that the green color band provided the best signal quality for all 4 devices and that the left half VGA pixel region was found to be the best choice only for iPhone 4S. For the other three devices, smaller 50 × 50 pixel regions were found to provide better or equally good signal quality than the larger pixel regions. Using the green signal and the optimal pixel regions derived from the four devices, we then investigated the suitability of the smartphones, the iPod 5 and the tablet for respiratory rate estimation using three different computational methods: the autoregressive (AR) model, variable-frequency complex demodulation (VFCDM), and continuous wavelet transform (CWT) approaches. Specifically, these time-varying spectral techniques were used to identify the frequency and amplitude modulations as they contain respiratory rate information. To evaluate the performance of the three computational methods and the pixel regions for the optimal signal quality, data were collected from 10 healthy subjects. It was found that the VFCDM method provided good estimates of breathing rates that were in the normal range (12-24 breaths/min). Both CWT and VFCDM methods provided reasonably good estimates for breathing rates that were higher than 26 breaths/min but their accuracy degraded concomitantly with increased respiratory rates. Overall, the VFCDM method provided the best results for accuracy (smaller median error), consistency (smaller interquartile range of the median value), and computational efficiency (less than 0.5 s on 1 min of data using a MATLAB implementation) to extract breathing rates that varied from 12 to 36 breaths/min. The AR method provided the least accurate respiratory rate estimation among the three methods. This work illustrates that both heart rates and normal breathing rates can be accurately derived from a video signal obtained from smartphones, an MP3 player and tablets with or without a flashlight.

  18. The LFSR and BCA VHDL Models for Built-in Self-test Circuits

    Directory of Open Access Journals (Sweden)

    J. Mitrych

    2002-04-01

    Full Text Available The various test structures are proposed for BIST techniques [1],[2]. A typical structure used for generation of pseudo-random test setsis the linear feedback shift register (LFSR. The BIST techniques havewide application in testing whole devices and embedded components. Wefocus on the analysis of the state coverage, fault coverage, andoptimal structure of BIST schemes.

  19. Low-Power Built-In Self-Test Techniques for Embedded SRAMs

    Directory of Open Access Journals (Sweden)

    Shyue-Kung Lu

    2007-01-01

    Full Text Available The severity of power consumption during parallel BIST of embedded memory cores is growing significantly. In order to alleviate this problem, a row bank-based precharge technique based on the divided wordline (DWL architecture is proposed for low-power testing of embedded SRAMs. The memory cell array is first divided into row banks. The effectiveness of the row bank-based precharge technique is due to the predictable address sequence during test. In low-power test mode, instead of precharging the entire memory array, only the current accessed row bank is precharged. This will result in significant power saving for the precharge circuitry. The precharge power can be reduced to 1/b of that of the traditional precharge techniques, where b denotes the number of row banks in the memory array. With simple transmission gates and inverters, the modified precharge control circuitry was also designed. The hardware overhead for implementing the low-power technique is almost negligible. Moreover, the corresponding BIST design to implement the low-power technique is almost the same as the conventional BIST designs. It is also notable that the inherent low-power characteristics of the DWL architecture can be preserved. According to experimental results, 48.9% power reduction can be achieved for a 256 × 256 bit-oriented SRAM. The memory is divided into 8 row banks. Moreover, if the number of row banks increases, the power saving will also increase.

  20. Monitoring of noninvasive ventilation by built-in software of home bilevel ventilators: a bench study.

    Science.gov (United States)

    Contal, Olivier; Vignaux, Laurence; Combescure, Christophe; Pepin, Jean-Louis; Jolliet, Philippe; Janssens, Jean-Paul

    2012-02-01

    Current bilevel positive-pressure ventilators for home noninvasive ventilation (NIV) provide physicians with software that records items important for patient monitoring, such as compliance, tidal volume (Vt), and leaks. However, to our knowledge, the validity of this information has not yet been independently assessed. Testing was done for seven home ventilators on a bench model adapted to simulate NIV and generate unintentional leaks (ie, other than of the mask exhalation valve). Five levels of leaks were simulated using a computer-driven solenoid valve (0-60 L/min) at different levels of inspiratory pressure (15 and 25 cm H(2)O) and at a fixed expiratory pressure (5 cm H(2)O), for a total of 10 conditions. Bench data were compared with results retrieved from ventilator software for leaks and Vt. For assessing leaks, three of the devices tested were highly reliable, with a small bias (0.3-0.9 L/min), narrow limits of agreement (LA), and high correlations (R(2), 0.993-0.997) when comparing ventilator software and bench results; conversely, for four ventilators, bias ranged from -6.0 L/min to -25.9 L/min, exceeding -10 L/min for two devices, with wide LA and lower correlations (R(2), 0.70-0.98). Bias for leaks increased markedly with the importance of leaks in three devices. Vt was underestimated by all devices, and bias (range, 66-236 mL) increased with higher insufflation pressures. Only two devices had a bias ventilation must be aware of differences in the estimation of leaks and Vt by ventilator software. Also, leaks are reported in different ways according to the device used.

  1. Transient classification for the IRIS reactor using self-organized maps built in free platform

    International Nuclear Information System (INIS)

    Doraskevicius Junior, Waldemar

    2005-01-01

    Kohonen's Self Organized Maps (SOM) were tested with data from several operational conditions of the nuclear reactor IRIS (International Reactor Innovative and Secure) to develop an effective tool in the classification and transient identification in nuclear reactors. The data were derived from 56 simulations of the operation of IRIS, from steady-state conditions to accidents. The digital system built for the tests was based on the JAVA platform for the portability and scalability, and for being one of the free development platforms. Satisfactory results of operation classification were obtained with reasonable processing time in personal computers; about two to five minutes were spent for ordination and convergence of the learning on the data base. The methodology of this work was extended to the supervision of logistics of natural gas for Brazilian pipelines, showing satisfactory results for the classification of deliveries for simultaneous measurement in several points. (author)

  2. Predicting Extubation Outcome by Cough Peak Flow Measured Using a Built-in Ventilator Flow Meter.

    Science.gov (United States)

    Gobert, Florent; Yonis, Hodane; Tapponnier, Romain; Fernandez, Raul; Labaune, Marie-Aude; Burle, Jean-François; Barbier, Jack; Vincent, Bernard; Cleyet, Maria; Richard, Jean-Christophe; Guérin, Claude

    2017-12-01

    Successful weaning from mechanical ventilation depends on the patient's ability to cough efficiently. Cough peak flow (CPF) could predict extubation success using a dedicated flow meter but required patient disconnection. We aimed to predict extubation outcome using an overall model, including cough performance assessed by a ventilator flow meter. This was a prospective observational study conducted from November 2014 to October 2015. Before and after a spontaneous breathing trial, subjects were encouraged to cough as strongly as possible before freezing the ventilator screen to assess CPF and tidal volume (V T ) in the preceding inspiration. Early extubation success rate was defined as the proportion of subjects not re-intubated 48 h after extubation. Diagnostic performance of CPF and V T was assessed by using the area under the curve of the receiver operating characteristic curve. Cut-off values for CPF and V T were defined according to median values and used to describe the performance of a predictive test combining them with risk factors of early extubation failure. Among 673 subjects admitted, 92 had a cough assessment before extubation. For the 81 subjects with early extubation success, the median CPF was -67.7 L/min, and median V T was 0.646 L. For the 11 subjects with early extubation failure, the median CPF was -57.3 L/min, and median V T was 0.448 L. Area under the curve was 0.61 (95% CI 0.37-0.83) for CPF and 0.64 (95% CI 0.42-0.84) for CPF/V T combined. After dichotomization (CPF 0.55 L), there was a synergistic effect to predict early extubation success ( P meter of an ICU ventilator was able to predict extubation success and to build a composite score to predict extubation failure. The results were close to that found in previous studies that used a dedicated flow meter. This could help to identify high-risk subjects to prevent extubation failure. (ClinicalTrials.gov registration NCT02847221.). Copyright © 2017 by Daedalus Enterprises.

  3. Computer-Aided Design for Built-In-Test (CADBIT) - Software Specification. Volume 3

    Science.gov (United States)

    1989-10-01

    CADD COMAN WIDO IO-CNURET MSL PPLYING~ TET ATEN Figur 3-13- TUTORIA FIGUR PLCMI IN CAD-NVIOMENT ON BOAR SEFTST- 1"os-rnenu, long-tur d nnnih que- list...have software package for reliability calculation A-8 LIBRARY ELEMENT DATA SHE T’" BIT TECHNIQUE: ON-BOARD ROM CATEGORY: L’ONG TUTORIA PAGE ,5 of 14

  4. Computer-Aided Design for Built-In-Test (CADBIT) - BIT Library. Volume 2

    Science.gov (United States)

    1989-10-01

    TECHNIQUE: ON-BOARD RONI CATEGORY: LONG TUTORIA \\L PAG E 5 of 14I SUBCATEGORY: BIT TECHNIQUE ATTRIBUTES DATA TYPE: TEXT El LIST E] TABLE [ GRAPHIC E...SHIFT REGISTER (MISR) CATEGORY: LONG TUTORIA -L PAGE i Of 13 SUBCATEGORY: BIT TECH-{MQUE ATTRIBUTES DATA TYPE: TEXT LIST El TABLE GRAPHIC E EQUATIONS...ELEMENT DATA SHEET BIT TECHNIQUE: UTILIZING REDUNDANCY CATEGORY: LONG TUTORIA L PAGE 9 of 10 SUBCATEGORY: PARTS DATA TABLE DATA TYPE: TEXT F1 UST C3

  5. Solar harvesting by a heterostructured cell with built-in variable width quantum wells

    Science.gov (United States)

    Brooks, W.; Wang, H.; Mil'shtein, S.

    2018-02-01

    We propose cascaded heterostructured p-i-n solar cells, where inside of the i-region is a set of Quantum Wells (QWs) with variable thicknesses to enhance absorption of different photonic energies and provide quick relaxation for high energy carriers. Our p-i-n heterostructure carries top p-type and bottom n-type 11.3 Å thick AlAs layers, which are doped by acceptors and donor densities up to 1019/cm3. The intrinsic region is divided into 10 segments where each segment carries ten QWs of the same width and the width of the QWs in each subsequent segment gradually increases. The top segment consists of 10 QWs with widths of 56.5Å, followed by a segment with 10 wider QWs with widths of 84.75Å, followed by increasing QW widths until the last segment has 10 QWs with widths of 565Å, bringing the total number of QWs to 100. The QW wall height is controlled by alternating AlAs and GaAs layers, where the AlAs layers are all 11.3Å thick, throughout the entire intrinsic region. Configuration of variable width QWs prescribes sets of energy levels which are suitable for absorption of a wide range of photon energies and will dissipate high electron-hole energies rapidly, reducing the heat load on the solar cell. We expect that the heating of the solar cell will be reduced by 8-11%, enhancing efficiency. The efficiency of the designed solar cell is 43.71%, the Fill Factor is 0.86, the density of short circuit current (ISC) will not exceed 338 A/m2 and the open circuit voltage (VOC) is 1.51V.

  6. Built-in future: integration, technical and market-development issues for PV

    International Nuclear Information System (INIS)

    Nordmann, T.

    2005-01-01

    Although large ground-mounted multi-megawatt photovoltaic plants have become common, it is argued that integration of photovoltaics into the fabric of buildings is their optimum use. In Germany, with its well-established grid network, there is a marked imbalance in the deployment of photovoltaics and only 1% are integrated into the roofs or facades of buildings. A similar pattern is found in most other countries in central Europe and the article seeks to discover the reasons for this. The situation in Japan is different in that the relatively high cost of electricity has encouraged a robust market for domestic photovoltaics. It is argued that the market for building-integrated photovoltaics in Europe has massive potential

  7. Built-in test of electrode degradation of multi-electrode array biosensors

    NARCIS (Netherlands)

    Liu, H.Y.; Dumas, N.; Richardson, A.; Heal, R.; Kerkhoff, Hans G.

    2006-01-01

    Micro-electrode array (MEA) is a widely used platform in biosensor systems, which provide a technology in communicating with micro chemical and biological world. This paper addresses hte topic of testing micro electrode degradation for MEAs, which is a common encountered damage during its

  8. Wood, the indigenous energy source. 1100 plants built in 20 years, all of them 'Swiss made'

    International Nuclear Information System (INIS)

    Wahlen, B.

    1999-01-01

    The company HOBAG Brienz, Ltd., specialised in the field of automatic wood-burning plants, continuously developed its unique system over the past 20 years and has more than 1100 satisfied clients in Switzerland as well as in foreign countries. It is equally dealing with log boilers, wood chip boilers, or pellet boilers. Nowadays, the company is seen as the market leader for modern, full automatic log-burning plants and wood conditioning equipment including containers for logs or wood chips

  9. 78 FR 54971 - Limitations on the Importation of Net Built-In Losses

    Science.gov (United States)

    2013-09-09

    ... property as paid-in surplus or contributions to capital, each a section 362(a) transaction) and in... published in the Federal Register. Drafting Information The principal author of these regulations is John P... for using a long-term contract method of accounting that are acquired in a section 332 liquidation. (2...

  10. Analyses and testing of model prestressed concrete reactor vessels with built-in planes of weakness

    International Nuclear Information System (INIS)

    Dawson, P.; Paton, A.A.; Fleischer, C.C.

    1990-01-01

    This paper describes the design, construction, analyses and testing of two small scale, single cavity prestressed concrete reactor vessel models, one without planes of weakness and one with planes of weakness immediately behind the cavity liner. This work was carried out to extend a previous study which had suggested the likely feasibility of constructing regions of prestressed concrete reactor vessels and biological shields, which become activated, using easily removable blocks, separated by a suitable membrane. The paper describes the results obtained and concludes that the planes of weakness concept could offer a means of facilitating the dismantling of activated regions of prestressed concrete reactor vessels, biological shields and similar types of structure. (author)

  11. PhilDB: the time series database with built-in change logging

    Directory of Open Access Journals (Sweden)

    Andrew MacDonald

    2016-03-01

    Full Text Available PhilDB is an open-source time series database that supports storage of time series datasets that are dynamic; that is, it records updates to existing values in a log as they occur. PhilDB eases loading of data for the user by utilising an intelligent data write method. It preserves existing values during updates and abstracts the update complexity required to achieve logging of data value changes. It implements fast reads to make it practical to select data for analysis. Recent open-source systems have been developed to indefinitely store long-period high-resolution time series data without change logging. Unfortunately, such systems generally require a large initial installation investment before use because they are designed to operate over a cluster of servers to achieve high-performance writing of static data in real time. In essence, they have a ‘big data’ approach to storage and access. Other open-source projects for handling time series data that avoid the ‘big data’ approach are also relatively new and are complex or incomplete. None of these systems gracefully handle revision of existing data while tracking values that change. Unlike ‘big data’ solutions, PhilDB has been designed for single machine deployment on commodity hardware, reducing the barrier to deployment. PhilDB takes a unique approach to meta-data tracking; optional attribute attachment. This facilitates scaling the complexities of storing a wide variety of data. That is, it allows time series data to be loaded as time series instances with minimal initial meta-data, yet additional attributes can be created and attached to differentiate the time series instances when a wider variety of data is needed. PhilDB was written in Python, leveraging existing libraries. While some existing systems come close to meeting the needs PhilDB addresses, none cover all the needs at once. PhilDB was written to fill this gap in existing solutions. This paper explores existing time series database solutions, discusses the motivation for PhilDB, describes the architecture and philosophy of the PhilDB software, and performs an evaluation between InfluxDB, PhilDB, and SciDB.

  12. URBAN-LLANERA MUSIC CULTURE, AN IMAGINARY BUILT IN THE CITIES OF FOOTHILLS

    Directory of Open Access Journals (Sweden)

    Carlos Andres Rivera Arenas

    2010-11-01

    Full Text Available The llanera music and culture is a social construction that has been developed for over 200 years in the Colombian-Venezuelan plains. However, this imaginary has been adopted and strengthened in a relatively short time in the Colombian  province of Meta since 1960. The vastness of the Colombian-Venezuelan plains has lead to a differentiation of various types of llanero, as each one of them live and experience the llanera culture in a particular way, depending on the characteristics of the place where they live, their daily tasks, and so on. The ";urban llanero of foothill "; -inhabitant of cities like Yopal and Villavicencio- is multicultural and cosmopolitan; he feels, worships  and experiences the llanera culture and its music, as well as other different kinds of music and visions of the world, in his own particular way. Hence the necessity to think it all again, in order to find a new meaning for the notion of the llanero in the city, adapting it to the urban context and disregarding any static vision of this kind of culture, in order to encourage its construction in the city as an ";urban music";.

  13. YALIN ALTI SİGMA PROJELERİ İÇİN KRİTİK BAŞARI FAKTÖRLERİ (SUCCESS FACTORS FOR LEAN SIX SIGMA PROJECTS

    Directory of Open Access Journals (Sweden)

    Ali Rıza FİRUZAN

    2012-10-01

    Full Text Available Nowadays many companies focus on various kinds of quality improvement techniques to carry the service quality beyond costumer expectations. The selected quality technique should be appropriate to the company's culture and should be sufficient for carry out targeted improvement; this will enhance the company’s superiority in market place.For this purpose, Lean Six Sigma methods are one of the important methods being used today as an intensive use of statistical tools and techniques. Lean Six Sigma methods can be implemented in almost all sectors and successful gains can be obtained. Lean Six Sigma has wide range application in the world. Most applications are successful, while some of them are failed. In this study, reasons for unsuccessful Lean Six Sigma projects are examined. The way to convert unsuccessful project into successful project are suggested. Some solutions are carried out for this purpose.

  14. A Facile Strategy to Enhance the Dielectric and Mechanical Properties of MWCNTs/PVDF Composites with the Aid of MMA-co-GMA Copolymer

    Science.gov (United States)

    Song, Shixin; Xia, Shan; Jiang, Shangkun; Lv, Xue; Sun, Shulin; Li, Quanming

    2018-01-01

    A facile strategy is adopted to prepare carboxylic functionalized multiwalled carbon nanotube (c-MWCNT) modified high dielectric constant (high-k) poly(vinylidene fluoride) (PVDF) composites with the aid of methyl methacrylate-co-glycidyl methacrylate copolymer (MG). The MG is miscible with PVDF and the epoxy groups of the copolymer can react with the carboxylic groups of c-MWCNT, which induce the uniform dispersion of c-MWCNT and a form insulator layer on the surface of c-MWCNT. The c-MWCNTs/MG/PVDF composites with 8 vol % c-MWCNT present excellent dielectric properties with high dielectric constant (~448) and low dielectric loss (~2.36) at the frequency of 1 KHz, the dielectric loss is much lower than the c-MWCNT/PVDF composites without MG. The obvious improvement in dielectric properties ascribes to the existence of MG, which impede the direct contact of c-MWCNTs and PVDF and avoid the formation of conductive network. Therefore, we propose a practical and simple strategy for preparing composites with excellent dielectric properties, which are promising for applications in electronics devices. PMID:29495491

  15. Effects of He{sup +} ion implantation on surface properties of UV-cured Bis-GMA/TEGDMA bio-compatible resins

    Energy Technology Data Exchange (ETDEWEB)

    Fuentes, G.G., E-mail: gfuentes@ain.e [Center of Advanced Surface Engineering, AIN, Cordovilla-Pamplona, E-31191 (Spain); Esparza, J.; Rodriguez, R.J. [Center of Advanced Surface Engineering, AIN, Cordovilla-Pamplona, E-31191 (Spain); Manso-Silvan, M. [Departamento de Fisica Aplicada, Universidad Autonoma de Madrid, Cantoblanco, E-28049 (Spain); Palomares, J. [Instituto de Ciencia de Materiales de Madrid, ICMM-CSIC, Cantoblanco, E-28049 (Spain); Juhasz, J.; Best, S. [Cambridge Centre for Medical Materials, Department of Materials Science and Metallurgy, University of Cambridge, Pembroke Str, Cambridge CB2 3QZ (United Kingdom); Mattilla, R.; Vallittu, P. [Institute of Dentistry, Turku Clinical Biomaterials Centre, Itaeinen Pitkaekatu 4, B FI-20520, Turku (Finland); Achanta, S. [Falex Tribology Wingepark 23 B, 3110 Rotselaar (Belgium); Giazzon, M.; Weder, G. [Centre Suisse d' Electronique et de Microtechnique, CSEM, Jaquet-Drot 1, CH-2002 Neuchatel (Switzerland); Donati, I. [Department of Life Sciences, University of Trieste, Via Licio Giorgieri 1, I 34127 Trieste (Italy)

    2011-01-15

    This work reports on the surface characterisation of 2,2-bis[4-(2-hydroxy-3-methacryloxyl-oxypropoxy)phenyl]propane/triethylene glycol dimethacrylate bio-compatible resins after high energy He{sup +} ion implantation treatments. The samples have been characterised by diffuse reflectance FT-IR, X-ray photo-electron spectroscopy, ultramicro-hardness and nano-scratch wear tests. In addition, osteblast cell assays MG-63 have been used to test the bio-compatibility of the resin surfaces after the ion implantation treatments. It has been observed that the maximum surface hardening of the resin surfaces is achieved at He-ion implantation energies of around 50 keV and fluences of 1 x 10{sup 16} cm{sup -2}. At 50 keV of He-ion bombardment, the wear rate of the resin surface decreases by a factor 2 with respect to the pristine resin. Finally, in vitro tests indicate that the He-ion implantation does not affect to the cell-proliferation behaviour of the UV-cured resins. The enhancement of the surface mechanical properties of these materials can have beneficial consequences, for instance in preventing wear and surface fatigue of bone-fixation prostheses, whose surfaces are continuously held to sliding and shearing contacts of sub-millimetre scale lengths.

  16. Obtaining information ultra-fast as-built in areas of high radiation to support decisions in maintenance

    International Nuclear Information System (INIS)

    Sarti Fernandez, F.

    2010-01-01

    One of the problems that arise when studying, planning and assessing a particular maintenance operation has to be performed in high radiation areas, is the determination of the level of reliability of information starting from the one available. For the past several years have been used in nuclear power plants worldwide acquisition systems called 3D laser scanner models.

  17. Built-in adjuvanticity of genetically and protein-engineered chimeric molecules for targeting of influenza A peptide epitopes.

    Science.gov (United States)

    Kerekov, Nikola S; Ivanova, Iva I; Mihaylova, Nikolina M; Nikolova, Maria; Prechl, Jozsef; Tchorbanov, Andrey I

    2014-10-01

    Highly purified, subunit, or synthetic viral antigens are known to be weakly immunogenic and potentate only the antibody, rather than cell-mediated immune responses. An alternative approach for inducing protective immunity with small viral peptides would be the direct targeting of viral epitopes to the immunocompetent cells by DNA vaccines encoding antibody fragments specific to activating cell surface co-receptor molecules. Here, we are exploring as a new genetic vaccine, a DNA chimeric molecule encoding a T and B cell epitope-containing influenza A virus hemagglutinin peptide joined to sequences encoding a single-chain variable fragment antibody fragment specific for the costimulatory B cell complement receptors 1 and 2. This recombinant DNA molecule was inserted into eukaryotic expression vector and used as a naked DNA vaccine in WT and CR1/2 KO mice. The intramuscular administration of the DNA construct resulted in the in vivo expression of an immunogenic chimeric protein, which cross-links cell surface receptors on influenza-specific B cells. The DNA vaccination was followed by prime-boosting with the protein-engineered replica of the DNA construct, thus delivering an activation intracellular signal. Immunization with an expression vector containing the described construct and boosting with the protein chimera induced a strong anti-influenza cytotoxic response, modulation of cytokine profile, and a weak antibody response in Balb/c mice. The same immunization scheme did not result in generation of influenza-specific response in mice lacking the target receptor, underlining the molecular adjuvant effect of receptor targeting.

  18. Testing measurement equivalence of experienced holiday quality: Evidence on built-in bias in the Flash Eurobarometer survey data

    NARCIS (Netherlands)

    Gelissen, J.P.T.M.

    2018-01-01

    In this contribution, we evaluate the degree of measurement equivalence between countries and over time for a measure of experienced holiday quality that has repeatedly been included in a public opinion survey series of high policy relevance: the Flash Eurobarometer survey series (2014–2016). The

  19. Angular acceptance analysis of an infrared focal plane array with a built-in stationary Fourier transform spectrometer.

    Science.gov (United States)

    Gillard, Frédéric; Ferrec, Yann; Guérineau, Nicolas; Rommeluère, Sylvain; Taboury, Jean; Chavel, Pierre

    2012-06-01

    Stationary Fourier transform spectrometry is an interesting concept for building reliable field or embedded spectroradiometers, especially for the mid- and far- IR. Here, a very compact configuration of a cryogenic stationary Fourier transform IR (FTIR) spectrometer is investigated, where the interferometer is directly integrated in the focal plane array (FPA). We present a theoretical analysis to explain and describe the fringe formation inside the FTIR-FPA structure when illuminated by an extended source positioned at a finite distance from the detection plane. The results are then exploited to propose a simple front lens design compatible with a handheld package.

  20. Dormant origins as a built-in safeguard in eukaryotic DNA replication against genome instability and disease development.

    Science.gov (United States)

    Shima, Naoko; Pederson, Kayla D

    2017-08-01

    DNA replication is a prerequisite for cell proliferation, yet it can be increasingly challenging for a eukaryotic cell to faithfully duplicate its genome as its size and complexity expands. Dormant origins now emerge as a key component for cells to successfully accomplish such a demanding but essential task. In this perspective, we will first provide an overview of the fundamental processes eukaryotic cells have developed to regulate origin licensing and firing. With a special focus on mammalian systems, we will then highlight the role of dormant origins in preventing replication-associated genome instability and their functional interplay with proteins involved in the DNA damage repair response for tumor suppression. Lastly, deficiencies in the origin licensing machinery will be discussed in relation to their influence on stem cell maintenance and human diseases. Copyright © 2017 Elsevier B.V. All rights reserved.

  1. A Weibull statistics-based lignocellulose saccharification model and a built-in parameter accurately predict lignocellulose hydrolysis performance.

    Science.gov (United States)

    Wang, Mingyu; Han, Lijuan; Liu, Shasha; Zhao, Xuebing; Yang, Jinghua; Loh, Soh Kheang; Sun, Xiaomin; Zhang, Chenxi; Fang, Xu

    2015-09-01

    Renewable energy from lignocellulosic biomass has been deemed an alternative to depleting fossil fuels. In order to improve this technology, we aim to develop robust mathematical models for the enzymatic lignocellulose degradation process. By analyzing 96 groups of previously published and newly obtained lignocellulose saccharification results and fitting them to Weibull distribution, we discovered Weibull statistics can accurately predict lignocellulose saccharification data, regardless of the type of substrates, enzymes and saccharification conditions. A mathematical model for enzymatic lignocellulose degradation was subsequently constructed based on Weibull statistics. Further analysis of the mathematical structure of the model and experimental saccharification data showed the significance of the two parameters in this model. In particular, the λ value, defined the characteristic time, represents the overall performance of the saccharification system. This suggestion was further supported by statistical analysis of experimental saccharification data and analysis of the glucose production levels when λ and n values change. In conclusion, the constructed Weibull statistics-based model can accurately predict lignocellulose hydrolysis behavior and we can use the λ parameter to assess the overall performance of enzymatic lignocellulose degradation. Advantages and potential applications of the model and the λ value in saccharification performance assessment were discussed. Copyright © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  2. COMBINED UNCOVERED SHEET-AND-TUBE PVT-COLLECTOR SYSTEM WITH BUILT-IN STORAGE WATER HEATER

    Directory of Open Access Journals (Sweden)

    Muhammad Abid

    2012-02-01

    Full Text Available This work describes the design and investigation of a simple combined uncovered sheet-and-tube photo-voltaic-thermal (PVT collector system. The PVT-collector system consists of a support, standard PV module (1.22x0.305m, area=0.37m2, fill factor=0.75, sheet-and-tube water collector and storage tank-heater. The collector was fixed under PV module. Inclination angle of the PVT-collector to the horizontal plane was 45 degree. The storage tank-heater played double role i.e. for storage of hot water and for water heating. The PVT-collector system could work in the fixed and tracking modes of operation. During investigations of PVT-collector in natural conditions, solar irradiance, voltage and current of PV module, ambient temperature and water temperature in storage tank were measured. Average thermal and electrical powers of the PVT-collector system at the tracking mode of operation observed were 39W and 21W, with efficiencies of 15% and 8% respectively at the input power of 260W. The maximum temperature of the water obtained was 42oC. The system was observed efficient for low-temperature applications. The PVT-collector system may be used as a prototype for design of PVT-collector system for domestic application, teaching aid and for demonstration purposes.

  3. Experimental study on depth of paraffin wax over floating absorber plate in built-in storage solar water heater

    Directory of Open Access Journals (Sweden)

    R Sivakumar

    2015-11-01

    Full Text Available The aim of this article is to study the effect of depth of phase change material over the absorber surface of an integrated collector-storage type flat plate solar water heater. Flat plate solar water heaters are extensively used all over the world to utilize the natural source of solar energy. In order to utilize the solar energy during off-sunshine hours, it is inevitable to store and retain solar thermal energy as long as possible. Here, phase change material is not used for heat storage, but to minimize losses during day and night time only. The depth of phase change material over a fixed depth of water in a solar thermal collector is an important geometric parameter that influences the maximum temperature rise during peak solar irradiation and hence the losses. From the results of the studies for different masses of paraffin wax phase change material layers, the optimum depth corresponding to the maximum heat gain till evening is found to be 2 mm, and the heat retention till the next day morning is found to be 4 mm.

  4. AGREEMENT ON THE SALE AND PURCHASE OF HOUSES TO BE BUILT IN CONJUNCTION WITH THE CONSUMER PROTECTION ACT

    Directory of Open Access Journals (Sweden)

    Ahmad Fauzi

    2018-03-01

    Full Text Available In residential buying agreements, contracts governing default are usually common. Default is stated by expressing negligence in two respects, whether it is negligence in payment of instalment or negligence in the delay of settlement of house construction which will be delivered to the consumer. The developer's responsibility is usually related to the delay of the house construction and delivery to the consumer. In the execution of the sale and purchase transaction of the house to be built, consumers rarely gain consumer protection rights as regulated and mentioned in the article on consumer rights and business actor obligations contained in Article 4 and 7 of Law no. 8 of 1999 on Consumer Protection. Furthermore, field practice reality shows that consumers and developers do not have the same bargaining position, where the consumer are usually required to follow the agreement that has been standardized by developers who are legally contrary to Article 18 of Law no. 8 of 1999 on Consumer Protection.

  5. Student Responses to a Flipped Introductory Physics Class with built-in Post-Video Feedback Quizzes

    Science.gov (United States)

    Ramos, Roberto

    We present and analyze student responses to multiple Introductory physics classes in a university setting, taught in a ''flipped'' class format. The classes included algebra- and calculus-based introductory physics. Outside class, students viewed over 100 online video lectures on Classical Mechanics, Electricity and Magnetism, and Modern Physics prepared by this author and in some cases, by a third-party lecture package available over YouTube. Inside the class, students solved and discussed problems and conceptual issues in greater detail. A pre-class online quiz was deployed as an important source of feedback. I will report on the student reactions to the feedback mechanism, student responses using data based on anonymous surveys, as well as on learning gains from pre-/post- physics diagnostic tests. The results indicate a broad mixture of responses to different lecture video packages that depend on learning styles and perceptions. Students preferred the online quizzes as a mechanism to validate their understanding. The learning gains based on FCI and CSEM surveys were significant.

  6. 60 GHz system-on-chip (SoC) with built-in memory and an on-chip antenna

    KAUST Repository

    Ghaffar, Farhan A.; Arsalan, Muhammad; Cheema, Hammad; Salama, Khaled N.; Shamim, Atif

    2014-01-01

    A novel 60 GHz transmitter SoC with an on-chip antenna and integrated memory in CMOS 65 nm technology is presented in this paper. This highly integrated transmitter design can support a data rate of 2 GBPS with a transmission range of 1 m. The transmitter consists of a fundamental frequency 60 GHz PLL which covers the complete ISM band. The modulator following the PLL can support both BPSK and OOK modulation schemes. Both stored data on the integrated memory or directly from an external source can be transmitted. A tapered slot on chip antenna is integrated with the power amplifier to complete the front end of the transmitter design. Size of the complete transmitter with on-chip antenna is only 1.96 mm × 1.96 mm. The core circuits consume less than 100 mW of power. The high data rate capability of the design makes it extremely suitable for bandwidth hungry applications such as unencrypted HD video streaming and transmission.

  7. Impact of pest control strategies on the arthropodofauna living in bird nests built in nestboxes in pear and apple orchards.

    Science.gov (United States)

    Roy, Lise; Bouvier, Jean-Charles; Lavigne, Claire; Galès, Mathieu; Buronfosse, Thierry

    2013-08-01

    Pesticide applications have a strong impact on biodiversity in agroecosystems. The present study aimed to assess the impact of pest control strategies on the arthropodofauna of Parus major nests built within nestboxes installed in orchards. Unlike many studied groups, these arthropod communities are not in direct contact with pesticide sprays (on account of their being sheltered by nestboxes) and are also unable to move away from the treated area. In this pilot study, we estimated the prevalence and the taxonomic and ecological diversities of arthropodofauna sampled in the nests and assessed the extent to which the whole and nest-specific arthropodofauna were affected by pest control strategies. Sixteen different insect and arachnid Primary Taxonomic Groups (PTGs, order level or below) were found in nests. The best represented PTGs (≥10% occurrence in years 2007 and 2008) were Psocoptera (Insecta, detritivorous/saprophagous), detritivorous/saprophagous Astigmata (Acari) and hematophagous Mesostigmata (Acari). Pest control strategies had a large impact on the prevalence of arthropods in nests, with higher proportions of nests hosting arthropods in organic orchards than in conventional orchards and with intermediate proportions in nests in Integrated Pest Management orchards. In contrast, pest control strategies had no significant effect on the composition of the arthropod communities when only nests hosting nidicolous arthropods were considered.

  8. Housing development in the 1950s in Serbia-typical examples of residential blocks built in Belgrade

    Directory of Open Access Journals (Sweden)

    Milašinović-Marić Dijana

    2012-01-01

    Full Text Available To date, the Serbian architecture of the nineteen-fifties has not yet been more comprehensively studied albeit the fact that there are sufficient sources, data, literature, and structures built at that time. The reason for the lack of interest in architecture of that period may be found in the relationship between the non-understanding and insufficient valuation of architectural results of the modern architecture of the time, but also in the general opinion that the immediate postwar years were the time of a poor social housing development, which is also characterized by the lack of distinct architectural values. Furthermore, there has been an obvious unreadiness to analyze in more detail and in time distance the subject of the sociorealistic construction, which was also partially present in this period. After a short period of the so-called Socio-Realism 1945-1950, characterized by reconstruction of the war devastated country with extensive participation of youth brigades, the housing construction in particular got a big boost, considering the changes in population structure, as well as the fact that a significant portion of population moved from rural areas to towns. The subject decade of the newly established socialist society was, in every respect, marked with upward path of economic, political and social development, which was an important base for overall architectural and cultural construction. This was the time when Serbian architects of different generations created a great number of works, which were diverse in they contents. The architects of older generation often created their most important works, while young architects, looking into future, but also into own architectural heritage and accomplishments, achieved their first significant results, thus generating autochthonous architectural trend and expression which would soon be recognized as the Belgrade School of Architecture. In the conditions in which the Serbian architecture developed, it actually meant fitting within the world development trends along with preservation of own and regional specificities.

  9. Energy and Environmental Performance of Multi-Story Apartment Buildings Built in Timber Construction Using Passive House Principles

    Directory of Open Access Journals (Sweden)

    Maria Wall

    2013-03-01

    Full Text Available This paper presents energy and environmental performance analyses, a study of summer indoor temperatures and occupant behavior for an eight story apartment building, with the goal to combine high energy efficiency with low environmental impact, at a reasonable cost. Southern Portvakten building is built with prefabricated timber elements using passive house principles in the North European climate. Energy performance was analyzed through parametric studies, as well as monitored energy data, and complemented with analysis of occupant behavior during one year. Results show that airtight, low-energy apartment buildings can be successfully built with prefabricated timber elements in a cold climate. The monitored total energy use was 47.6 kWh/m2, excluding household electricity (revised to a normal year, which is considerably lower than of a standard building built today in Sweden—90 kWh/m2. However, the occupancy level was low during the analyzed year, which affects the energy use compared to if the building had been fully occupied. Environmental analysis shows that the future challenges lie in lowering the household and common electricity use, as well as in improving the choices of materials. More focus should also lie on improving occupant behavior and finding smart solar shading solutions for apartment buildings.

  10. 60 GHz system-on-chip (SoC) with built-in memory and an on-chip antenna

    KAUST Repository

    Ghaffar, Farhan A.

    2014-04-01

    A novel 60 GHz transmitter SoC with an on-chip antenna and integrated memory in CMOS 65 nm technology is presented in this paper. This highly integrated transmitter design can support a data rate of 2 GBPS with a transmission range of 1 m. The transmitter consists of a fundamental frequency 60 GHz PLL which covers the complete ISM band. The modulator following the PLL can support both BPSK and OOK modulation schemes. Both stored data on the integrated memory or directly from an external source can be transmitted. A tapered slot on chip antenna is integrated with the power amplifier to complete the front end of the transmitter design. Size of the complete transmitter with on-chip antenna is only 1.96 mm × 1.96 mm. The core circuits consume less than 100 mW of power. The high data rate capability of the design makes it extremely suitable for bandwidth hungry applications such as unencrypted HD video streaming and transmission.

  11. A built-in co-carcinogenic effect due to viruses involved in latent or persistent infections

    DEFF Research Database (Denmark)

    Hersoug, Lars-Georg; Arnau, José

    2007-01-01

    instability. Because of chromosomal instability, the genome of these cell lines will lead to changes from generation to generation and will face a remarkable selection pressure both from lost traits, apoptosis, and from the immune system. Viruses causing latent or persistent infections have evolved many...

  12. Evaluation of Passive Containment Cooling System design of SMART built in GBS for ocean environment under the Fukushima Accident Condition

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Min Gil; Kim, Seong Gu; Lee, Jeong Ik; Lee, Kang Heon; Lee, Phil Seung [Korea Advanced Institue of Science and Technology, Daejeon (Korea, Republic of)

    2013-10-15

    The ONPP can be towed to the installation site after the SMART is constructed within the GBS in a dry dock. And, by incorporating IPSS (Integrated Passive Safety System), proposed by KAIST, in the ocean SMART the safety of the whole system will be significantly increased which can potentially eliminate any possibility of repeating Fukushima accident again. In recent years, KAIST research team is developing a very advanced concept of ocean NPPs which can avoid natural disasters while potentially increasing economy and enhancing public acceptance. Authors chose Korean small reactor, SMART as a reference system to demonstrate the feasibility of the proposed ocean NPP. Ocean SMART is mounted on GBS (Gravity Based Structure)

  13. Evaluation of a photovoltaic energy mechatronics system with a built-in quadratic maximum power point tracking algorithm

    Energy Technology Data Exchange (ETDEWEB)

    Chao, R.M.; Ko, S.H.; Lin, I.H. [Department of Systems and Naval Mechatronics Engineering, National Cheng Kung University, Tainan, Taiwan 701 (China); Pai, F.S. [Department of Electronic Engineering, National University of Tainan (China); Chang, C.C. [Department of Environment and Energy, National University of Tainan (China)

    2009-12-15

    The historically high cost of crude oil price is stimulating research into solar (green) energy as an alternative energy source. In general, applications with large solar energy output require a maximum power point tracking (MPPT) algorithm to optimize the power generated by the photovoltaic effect. This work aims to provide a stand-alone solution for solar energy applications by integrating a DC/DC buck converter to a newly developed quadratic MPPT algorithm along with its appropriate software and hardware. The quadratic MPPT method utilizes three previously used duty cycles with their corresponding power outputs. It approaches the maximum value by using a second order polynomial formula, which converges faster than the existing MPPT algorithm. The hardware implementation takes advantage of the real-time controller system from National Instruments, USA. Experimental results have shown that the proposed solar mechatronics system can correctly and effectively track the maximum power point without any difficulties. (author)

  14. Setup of the development tools for a small-sized controller built in a robot using Linux

    International Nuclear Information System (INIS)

    Lee, Jae Cheol; Jun, Hyeong Seop; Choi, Yu Rak; Kim, Jae Hee

    2004-03-01

    This report explains a setup method of practical development tools for robot control software programming. Well constituted development tools make a programmer more productive and a program more reliable. We ported a proven operating system to the target board (our robot's controller) to avoid such convention. We selected open source Linux as operating system, because it is free, reliable, flexible and widely used. First, we setup the host computer with Linux, and installed a cross compiler on it. And we ported Linux to the target board and connected to the host computer with ethernet, and setup NFS to both the host and the target. So the target board can use host computer's hard disk as it's own disk. Next, we installed gdb server on the target board and gdb client and DDD to the host computer for debugging the target program in the host computer with graphic environment. Finally, we patched the target board's Linux kernel with another one which have realtime capability. In this way, we can have a realtime embedded hardware controller for a robot with convenient software developing tools. All source programs are edited and compiled on the host computer, and executable codes exist in the NFS mounted directory that can be accessed from target board's directory. We can execute and debugging the code by means of logging into the target through the ethernet or the serial line

  15. Trees Containing Built-In Pulping Catalysts - Final Report - 08/18/1997 - 08/18/2000

    Energy Technology Data Exchange (ETDEWEB)

    Pullman, G.; Dimmel, D.; Peter, G.

    2000-08-18

    Several hardwood and softwood trees were analyzed for the presence of anthraquinone-type molecules. Low levels of anthraquinone (AQ) and anthrone components were detected using gas chromatography-mass spectroscopy and sensitive selected-ion monitoring techniques. Ten out of seventeen hardwood samples examined contained AQ-type components; however, the levels were typically below {approximately}6 ppm. No AQs were observed in the few softwood samples that were examined. The AQs were more concentrated in the heartwood of teak than in the sapwood. The delignification of pine was enhanced by the addition of teak chips ({approximately}0.7% AQ-equivalence content) to the cook, suggesting that endogenous AQs can be released from wood during pulping and can catalyze delignification reactions. Eastern cottonwood contained AQ, methyl AQ, and dimethyl AQ, all useful for wood pulping. This is the first time unsubstituted AQ has been observed in wood extracts. Due to the presence of these pulping catalysts, rapid growth rates in plantation settings, and the ease of genetic transformation, eastern cottonwood is a suitable candidate for genetic engineering studies to enhance AQ content. To achieve effective catalytic pulping activity, poplar and cottonwood, respectively, require {approximately}100 and 1000 times more for pulping catalysts. A strategy to increase AQ concentration in natural wood was developed and is currently being tested. This strategy involves ''turning up'' isochorismate synthase (ICS) through genetic engineering. Isochorismate synthase is the first enzyme in the AQ pathway branching from the shikimic acid pathway. In general, the level of enzyme activity at the first branch point or committed step controls the flux through a biosynthetic pathway. To test if the level of ICS regulates AQ biosynthesis in plant tissues, we proposed to over-express this synthase in plant cells. A partial cDNA encoding a putative ICS was available from the random cDNA sequencing project carried out with Arabidopsis thaliana. We used this putative plant ICS gene fragment to isolate and sequence a full-length ICS cDNA from Arabidopsis thaliana. The putative full-length cDNA encodes for a 569 amino acid protein of {approximately}62kDa. This sequence represents the first full-length ICS cDNA isolated from a plant. When inserted into E. coli, our isolated cDNA over-expressed ICS protein in the insoluble inclusion bodies. A plant expression vector containing the ICS cDNA, NP II for selection on the antibiotic kanamycin, and duplicated 35S-cauliflower mosaic virus promoter were inserted into Agrobacterium tumefaciens strain GV3101. Transformation experiments for insertion of these foreign genes into Populus deltoides 'C175' resulted in eight lines able to regenerate shoots and grow roots in the presence of kanamycin. Plants from these eight lines have acclimated to growth in sterile soil and will be moved to a greenhouse environment in spring 2001. Non rooted shoots from each line are currently being multiplied by shoot culture. When enough shoot tissue and/or greenhouse plant stem tissue is available, AQ analysis will be done and compared with non transformed control tissue.

  16. Self-assembling protein nanoparticles with built-in flagellin domains increases protective efficacy of a Plasmodium falciparum based vaccine.

    Science.gov (United States)

    Kaba, Stephen A; Karch, Christopher P; Seth, Labdhi; Ferlez, Karen M B; Storme, Casey K; Pesavento, Danielle M; Laughlin, Paige Y; Bergmann-Leitner, Elke S; Burkhard, Peter; Lanar, David E

    2018-02-01

    To eliminate the problems associated with the use of extraneous adjuvants we have designed a Self-Assembling Protein Nanoparticle (SAPN) containing epitopes from the Plasmodium falciparum circumsporozoite protein (PfCSP) (designated FMP014) and portions of the TLR5 agonist flagellin (designated FMP014 D0D1 ) as an intrinsic adjuvant. By combining different molar ratios of FMP014 to FMP014 D0D1 monomers before self-assembly, we generated multiple nanoparticles and investigated their biophysical characteristics, immunogenicity and protective efficacy. Immunization with the construct formulated with the ratio 58:2 of FMP014 to FMP014 D0D1 had the highest protective efficacy against a challenge with a transgenic P. berghei sporozoite expressing PfCSP. Increasing the proportion of flagellin per particle resulted in an inverse relationship with levels of both antibody titers and protection. The cytokine profiles of the various immunization groups were evaluated and quantitative amounts of the cytokines IL-2, IFN-γ, IL-12/p70 (Th1); IL4, IL5 (Th2); TNF-α, IL1β, IL-6, KC/GRO (pro-inflammatory), and IL-10 (immunomodulatory) were measured. The relationship of the cytokines to each other revealed a strong immunomodulatory effect depending on the proportion of flagellin in the construct. Our results demonstrate that SAPNs with flagellin may be a promising strategy for the development and delivery of a safe vaccine for infectious diseases. Published by Elsevier Ltd.

  17. MPR multi-purpose reactor to be built in Egypt. MPR reactor de usos multiples a construir en Egipto

    Energy Technology Data Exchange (ETDEWEB)

    Anon,

    1992-01-01

    Competing with two enterprises from the US and Canada and with a French-German consortium, INVAP won a bid for the supply of a research reactor to Egypt. This is the most important contract ever made by Argentina involving the supply, on a turnkey operation, of a complex facility that incorporates advanced technologies developed in our country and for a sum of approximately 80 million US dollars.

  18. A real-time deflection monitoring system for wind turbine blades using a built-in laser displacement sensor

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Hyeong-Cheol; Giri, Paritosh; Lee, Jung-Ryul [Korea Chonbuk National Univ., Jeonbuk (Korea, Republic of). Dept. of Aerospace Engineering and LANL-CBNU Engineering Inst.

    2012-07-01

    Renewable energy is considered a good alternative to deal with the issues related to fossil fuel and environmental pollution. Wind energy as one of such renewable energy alternatives has seen a substantial growth. With commercially viable global wind power potential, wind energy penetration is further expected to rise, and so will the related problems. One of the issues is the collision of wind blade and tower during operation. To improve safety during operation, to minimize the risk of sudden failure or total breakdown, and to ensure reliable power generation and reduce wind turbine life cycle costs, a structural health monitoring (SHM) technology is required. This study proposes a single laser displacement sensor (LDS) system, where all of the rotating blades could be evaluated effectively. The system is cost-effective as well, as the system costs only a mere thousand dollars. If the blade bolt loosening occurs, it causes deflection in the affected blade. In a similar manner, nacelle tilt or mass loss damage in the blade will result in change of blade's position and the proposed system can identify such problems with ease. With increased demand of energy, the sizes of wind blades are getting bigger and bigger due to which people are installing wind turbines very high above the ground level or offshore. It is impractical to monitor the deflection through wired connection in these cases and hence can be replaced by a wireless solution. This wireless solution is achieved using Zigbee technology which operates in the industrial, scientific and medical (ISM) radio bands, typically 2.4 GHz, 915 MHz and 868 MHz. The output from the LDS is fed to the microcontroller which acts as an analog to digital converter which in turn is connected to the Zigbee transceiver module, which transmits the data. At the other end, the Zigbee reads the data and displays on the PC from where user can monitor the condition of wind blades. (orig.)

  19. Understanding Keystroke Dynamics for Smartphone Users Authentication and Keystroke Dynamics on Smartphones Built-In Motion Sensors

    Directory of Open Access Journals (Sweden)

    Hyungu Lee

    2018-01-01

    Full Text Available Personal Identification Numbers (PINs and pattern drawing have been used as common authentication methods especially on smartphones. Such methods, however, are very vulnerable to the shoulder surfing attack. Thus, keystroke dynamics that authenticate legitimate users based on their typing manner have been studied for years. However, many of the studies have focused on PC keyboard keystrokes. More studies on mobile and smartphones keystroke dynamics are warranted; as smartphones make progress in both hardware and software, features from smartphones have been diversified. In this paper, using various features including keystroke data such as time interval and motion data such as accelerometers and rotation values, we evaluate features with motion data and without motion data. We also compare 5 formulas for motion data, respectively. We also demonstrate that opposite gender match between a legitimate user and impostors has influence on authenticating by our experiment results.

  20. Biodegradable scaffold with built-in vasculature for organ-on-a-chip engineering and direct surgical anastomosis

    Science.gov (United States)

    Zhang, Boyang; Montgomery, Miles; Chamberlain, M. Dean; Ogawa, Shinichiro; Korolj, Anastasia; Pahnke, Aric; Wells, Laura A.; Massé, Stéphane; Kim, Jihye; Reis, Lewis; Momen, Abdul; Nunes, Sara S.; Wheeler, Aaron R.; Nanthakumar, Kumaraswamy; Keller, Gordon; Sefton, Michael V.; Radisic, Milica

    2016-06-01

    We report the fabrication of a scaffold (hereafter referred to as AngioChip) that supports the assembly of parenchymal cells on a mechanically tunable matrix surrounding a perfusable, branched, three-dimensional microchannel network coated with endothelial cells. The design of AngioChip decouples the material choices for the engineered vessel network and for cell seeding in the parenchyma, enabling extensive remodelling while maintaining an open-vessel lumen. The incorporation of nanopores and micro-holes in the vessel walls enhances permeability, and permits intercellular crosstalk and extravasation of monocytes and endothelial cells on biomolecular stimulation. We also show that vascularized hepatic tissues and cardiac tissues engineered by using AngioChips process clinically relevant drugs delivered through the vasculature, and that millimetre-thick cardiac tissues can be engineered in a scalable manner. Moreover, we demonstrate that AngioChip cardiac tissues implanted with direct surgical anastomosis to the femoral vessels of rat hindlimbs establish immediate blood perfusion.

  1. Graphene macro-assembly-fullerene composite for electrical energy storage

    Science.gov (United States)

    Campbell, Patrick G.; Baumann, Theodore F.; Biener, Juergen; Merrill, Matthew; Montalvo, Elizabeth; Worsley, Marcus A.; Biener, Monika M.; Hernandez, Maira Raquel Ceron

    2018-01-16

    Disclosed here is a method for producing a graphene macro-assembly (GMA)-fullerene composite, comprising providing a GMA comprising a three-dimensional network of graphene sheets crosslinked by covalent carbon bonds, and incorporating at least 20 wt. % of at least one fullerene compound into the GMA based on the initial weight of the GMA to obtain a GMA-fullerene composite. Also described are a GMA-fullerene composite produced, an electrode comprising the GMA-fullerene composite, and a supercapacitor comprising the electrode and optionally an organic or ionic liquid electrolyte in contact with the electrode.

  2. Study of lamellar structure and crystallization behavior of poly(butylene terephthalate (PBT) in PBT/ABS and PBT/ABS/MMA-GMA blends using DSC, SAXS and DMTA

    International Nuclear Information System (INIS)

    Mantovani, Gerson L.; Pessan, Luiz A.; Hage, Elias; Torriani, Iris L.

    2001-01-01

    The effects of processing conditions and blend composition in the crystallization behaviour and lamellar structure of poly(butylene terephthalate) (PBT) in blends with acrylonitrile-butadiene-styrene copolymer (ABS) were studied. Differential scanning calorimetry (DSC), small-angle X-ray scattering (SAXS) and dynamic mechanical thermal analysis (DMTA) were used to observe those effects. Addition of reactive acrylic compatibilizer to the PBT/ABS blends has promoted an increase in the heat of crystallization of the related blends. The Long Period (L), obtained from the peak in the Lorentz-corrected SAXS pattern, was used to observe the effect in the lamellar structure of PBT phase in the blends. The results were in good agreement with the calculated values from de correlation function and the values of L do not show a significant dependence with the PBT mass fraction, either in the binary blends (PBT/ABS) or in the compatibilized blends. A slight but clear increase of the long period (from 3 to 5 angstrom) is noted for the systems injection molded at 240 deg C when compared to the ones molded at 260 deg C, although PBT crystallinity in the blends does not change significantly with blend composition or processing conditions. DMTA curves show a slight shift in the temperature of the tan δ main peaks for both PBT and ABS phases in the compatibilized blends, thereby indicating changes in the degree of miscibility or interaction between phases of those blends. Changes in the compatibilized blends miscibility may be responsible by the effects in the crystallization behaviour and lamellar structure of the PBT/ABS blends. (author)

  3. Study of lamellar structure and crystallization behavior of poly(butylene terephthalate (PBT) in PBT/ABS and PBT/ABS/MMA-GMA blends using DSC, SAXS and DMTA

    Energy Technology Data Exchange (ETDEWEB)

    Mantovani, Gerson L.; Pessan, Luiz A.; Hage, Elias [Sao Carlos Univ., SP (Brazil). Dept. de Engenharia de Materiais]. E-mail: elias@power.ufscar.br; Plivelic, Tomas S. [Laboratorio Nacional de Luz Sincrotron (LNLS), Campinas, SP (Brazil); Torriani, Iris L. [Universidade Estadual de Campinas, SP (Brazil). Inst. de Fisica Gleb Wataghin

    2001-07-01

    The effects of processing conditions and blend composition in the crystallization behaviour and lamellar structure of poly(butylene terephthalate) (PBT) in blends with acrylonitrile-butadiene-styrene copolymer (ABS) were studied. Differential scanning calorimetry (DSC), small-angle X-ray scattering (SAXS) and dynamic mechanical thermal analysis (DMTA) were used to observe those effects. Addition of reactive acrylic compatibilizer to the PBT/ABS blends has promoted an increase in the heat of crystallization of the related blends. The Long Period (L), obtained from the peak in the Lorentz-corrected SAXS pattern, was used to observe the effect in the lamellar structure of PBT phase in the blends. The results were in good agreement with the calculated values from de correlation function and the values of L do not show a significant dependence with the PBT mass fraction, either in the binary blends (PBT/ABS) or in the compatibilized blends. A slight but clear increase of the long period (from 3 to 5 angstrom) is noted for the systems injection molded at 240 deg C when compared to the ones molded at 260 deg C, although PBT crystallinity in the blends does not change significantly with blend composition or processing conditions. DMTA curves show a slight shift in the temperature of the tan {delta} main peaks for both PBT and ABS phases in the compatibilized blends, thereby indicating changes in the degree of miscibility or interaction between phases of those blends. Changes in the compatibilized blends miscibility may be responsible by the effects in the crystallization behaviour and lamellar structure of the PBT/ABS blends. (author)

  4. Measurement of gamma-dose caused by built in coal slags with elevated 226Ra concentration, and the modelling of shielding

    International Nuclear Information System (INIS)

    Nemeth, Cs.; Somlai, J.; Nenyei, A.; Skrinyar, M.; Kanyar, B.; Nemeth, P.; Hoffer, K.

    2000-01-01

    Slags, derived from coal mined in the neighbourhood of the town Tatabanya in Hungary, have been used as filling and insulating material for buildings of houses, block of flats, schools and kindergartens. The slag samples come from here have elevated concentrations of 226 Ra (range of 850 - 2400 Bq x kg -1 ). Therefore, the external gamma dose rates at 1 m height were about four times higher than the world average. It has been found, based on the modelling, that the dose rate could be decreased with 70 - 80% using an appropriate thickness of concrete or barite-concrete layers. (author)

  5. On the Role of Built-in Electric Fields on the Ignition of Oxide Coated NanoAluminum: Ion Mobility versus Fickian Diffusion

    Science.gov (United States)

    2010-01-01

    on Al ion diffu- sion can be computed using the Nernst –Planck equation . The Nernst –Plank equation is given in Eq. 4,22 J = − D dC dx − zFDC RT d dx...The use of the bulk diffusion equation is reason- able since during the time scales considered the movement of only the atoms initially on the surface

  6. Lessons learned from exchanges between the french and german safety authorities. Comparison of the safety levels achieved for reactors built in these two countries

    International Nuclear Information System (INIS)

    Droulers, Y.

    1988-12-01

    It is important to emphasize, right at the beginning, the exceptional extent of the assessment work performed over several years on the nuclear power plants in each country (exchange of confidential documents, communication of incidents during the plant building stage, specialist visits to the site, joint reports by the Franco-German Commission on all important safety problems). The D.F.K. (Franco-German Commission) has been the official framework for these exchanges since 1976 (the exchanges relating to FESSENHEIM and its ''twin'' plant NECKARWESTHEIM 1 began as far back as 1973 and were pursued, when construction of CATTENOM began, by a comparison with PHILIPPSBURG). Apart from its annual plenary session, it presently comprises 6 standing working groups dealing respectively with general safety problems (including primary system technology problems and exchanges on incidents discussed by two subcommittees), emergency plans, radiation protection problems, radioactive waste, fuel cycle installations, fast breeder reactors. It is also worth noting the regular meetings held by the standing groups of experts (GPR and RSK), which have enabled periodical assessment of the extent to which the approaches of the two countries to the main safety problems are tending to converge (severe accidents, operating feedback, containment, followup on the TMI and CHERNOBYL accidents, etc) and the exchanges between the IPSN and the GRS on the corresponding research programs

  7. SEISMIC EVALUATION OF EXISTING MID-RISE REINFORCED CONCRETE BUILDINGS ACCORDING TO SPECIFICATION FOR BUILDING STRUCTURES TO BE BUILT IN DISASTER AREAS

    Directory of Open Access Journals (Sweden)

    Mehmet İNEL

    2007-01-01

    Full Text Available Over the past several decades, Turkey has been hit by devastating earthquakes and remarkable number of reinforced concrete buildings has been damaged in the high seismicity regions of our country. The aim of this study is to evaluate the seismic performance of the mid-rise reinforced concrete buildings that are major part of building stock of our earthquake-prone country, according to recent Turkish Earthquake Code. 4- and 7-story buildings were selected to represent mid-rise building stock. After determining the structural parameters, each building was subjected to pushover analysis and the capacity curves were obtained. Earthquake performance of each building was determined in the light of their capacity curves according to the recent Turkish Earthquake Code.

  8. Active Pixel HgCdTe Detectors With Built-in Dark Current Reduction for Near-Room Temperature Operation, Phase II

    Data.gov (United States)

    National Aeronautics and Space Administration — High sensitivity HgCdTe infrared arrays operating at 77K can now be tailored in a wide range of wavelengths from 1 to 14 microns. However, due to the cooling...

  9. The churches dedicated to Saint Bishop and Martyr Stanisław in Kraków, built in 20th century

    Directory of Open Access Journals (Sweden)

    Józef Szymon Wroński

    2003-12-01

    Full Text Available 1. Die Pfarrkirche Zum Hl Bischof und Märtyrer Stanislaus in Dąbie Dąbie liegt 3 Kilometer östlich vom Stadtzentrum entfernt. In die Stadt wurde es 1911 eingemeindet. In den Jahren 1965-75 entstand hier eine Wohnsiedlung. In den nächsten Jahren -infolge der zunehmenden Einwohnerzahl - erfolgte eine Verdichtung der Wohnsiedlungsbebauung. Das Grundstück, auf dem die Kirche steht, liegt im Winkel zwischen der Weichsel und der Białucha, im Bereich der ehemaligen österreichischen Schanze FS-16. Es war stark mit Bäumen bepflanzt. Das bereitete aber viele Schwierigkeiten, d.h. es gab Probleme sowohl mit der Ausdünnung der Bäume, als auch mit der Erhaltung des restlichen Baumbestandes. Am 11. März 1982 erhielt Dąbie endlich eine Baugenehmigung für den Bau einer Kirche in der Wohnsiedlung. Die Kirche, die nach einem Projekt des Architekten Henryk Kamiński in den Jahren 1984-2000 errichtet wurde, ist der Gemeinde zur Verfügung gestellt, aber im Innern noch nicht ausgestattet. Der Bau der Kirche zerfällt in zwei Phasen: die erste Phase dauerte bis zum Jahre 1989, in dem es zu einem Probstwechsel kam. Der neue Probst und zugleich der Investor Wiesław Macuda übernahm den Bau in dem Moment, als die Mauern der Kirche bis zu den Sohlbänken ausgeführt waren. Mit voller Energie ging er ans Werk, um den Bau weiterzuführen. Die Kirche hat zwei Geschosse: - die sog. Unterkirche im Erdgeschoss und die Oberkirche. Die Kirche hat einen fast quadratischen Grundriss, der diagonal gestellt und stark modifiziert ist. Die eigentliche Kirche - die Oberkirche ist dreischiffig. Die Seitenschiffe sind von dem Mittelschiff durch (je einen Pfeiler getrennt. Das Mittelschiff hat einen Obergaden (Region der Fenster im Mittelschiff iner Basilika in der Form einer Lichtnische, durch die das Licht in den Raum hineinfällt und die ganze Kirche mit Licht überflutet ist. Von hier aus streben die „Scheiben-wände” der Obergadenlichtnische nach oben. Ziel ist die größte Höhe über dem Altarraum. Die Stahlbetondecke ist in mehrere Flächen zergliedert, die auf vielen Ebenen liegen. Der Altar steht auf einem vielstufigem Podest. Ihm gegenüber liegt der Chor, der aus Konstruktionsgründen drei Etagen hat (eine Seltenheit in der Architektur Krakaus. Die Schönheit der Kirche drückt sich in ihrer Geräumigkeit, der vielflächigen Decke aus, die reichgestaltet ist und dadurch Licht-Schatteneffekte hervorruft. Da die Kirche unter der Schutzherrschaft des Hl. Bischofs Stanislaus steht, hat sie eine symbolträchtige Form. Sowohl der Grundriss als auch der Baukörper der Kirche nahm die Form einer Mitra an (zwei schildförmige Wände, vom und hinten gebogen, oben dreieckig - spitz zulaufend, die durch Balkenträger verbunden sind. Architektonisch gesehen, gehört die Kirche der späteren Moderne an. 2. Die Pfarrkirche Zum Hl. Bischof und Märtyrer Stanislaus in Kantorowice Sie ist als typischer Integrationsbau niedrig gehalten und zwischen den Siedlungshäusern eingebunden. Die Kirche wurde in den Jahren 1985-1986 als Notkirche errichtet und zwei Jahre darauf vom Bischof Kazimierz Nycz eingeweiht. Als eigene Pfarrei existiert sie erst seit dem 2. Februar 1994. Die Kirche ist ein eingessossiger Längsbau, der mit einem Satteldach gedeckt ist. Von außen sieht sie wie ein größeres Wirtschaftsgebäude aus, mit einem Dachreiter (Signaturtürmchen auf dem Dachfirst. Beim Betreten des Innenraumes bemerkt man, daß der Bau in drei Schiffe eingeteilt ist. Das rechte Seitenschiff hat die Rundbogenarkaden und dient zusätzlich als Kapelle, das linke aber ruht nur auf einem Pfeiler und bildet mit dem Hauptschiff einen Raum. An der Altarwand hängt das Bild des Hl. Stanislaus, das vom Maler Piotr Moskal gemalt wurde. Der Altar steht auf einem einstufigem Podest. Stilistisch gehört die Kirche zur Moderne. 3. Die Kirche Zum Hl. Bischof und Märtyrer Stanislaus in Tonie Tonie ist ein ehemaliges Dorf am Sudolufer malerisch gelegen. Es liegt 7 Kilometer nördlich vom Stadtzentrum, an der alten Handelsstraße über Będzin nach Schlesien. 1961 wurde es in die Stadt eingemeindet. In Tonie steht ein alter Bildstock, der den Hl. Stanislaus (den Bischof und Märtyrer darstellt. Er ist wahrscheinlich eine Replik des berühmt gewordenen Bildstocks des Hl. Stanislaus Auf dem Felsen. An diesem Bildstock, der von der dortigen Bevölkerung verehrt wurde, fanden Maiandachten statt und später wurden Messen gelesen. Es stand daher fest, daß die Kirche, die in Zukunft gebaut werden sollte, den Namen des Hl. Stanislaus tragen muß. Am 3. September 1990 begann Priester Jan Urbański eine seelsorgerische Tätigkeit in Tonie. Im März nächsten Jahres begann der Neubau unter seiner Leitung. Der Plan der Kirche wurde vom Architekten Wiesław Stefański unter Mitarbeit von Ireneusz Piotrowski vorbereitet. Nach dem Ablauf der sieben Monate stand die Kirche fertig und der Kardinal Franciszek Macharski konnte die erste Messe in den rohen Mauern dieser neuen Kirche lesen. Am 20. Mai 1993 wurde offiziell ein Seelsorgezentrum ins Leben gerufen. Die Kirche hat einen originellen Plan. Sie ist ein Längsbau, dreischiffig. Diese Dreischiffigkeit ist aber ungewöhnlich gestaltet, d.h. das Hauptschiff ist von der Achse „pendelartig” abgerückt, so daß die beiden Seitenschiffe keilhaft oder besser gesagt trapezförmig gestaltet sind. Die Richtung der Schiffe läuft nicht, wie üblich, parallel zu Außenwänden; durch die Schrägstellung des Mittelschiffes sind die Seitenschiffe trapezförmig. Eine ähnliche Originalität zeigt die Gestaltung der Apsis, die in der Form einer Schleife gebaut wurde. Die Chortreppe ist auch anders als sonst gestaltet. Der eine Treppenlauf hängt über dem Eingang, um zu zeigen, daß der Eintretende geistig in die Kirche steigen muß. Alles andere ist hier fast wie im alten Kirchenbau. Der Baukörper erinnert an schlichte italienische Kirchenbauten des Mittelalters. Stilistisch gehört die Kirche zur Postmodeme mit einigen de-konstruktiven Elementen.

  10. Computer-Supported Argumentative Writer : An authoring tool with built-in scaffolding and self-regulation for novice writers of argumentative texts

    OpenAIRE

    Benetos, Kalliopi

    2006-01-01

    Argumentative writing is a valued genre in a range of disciplines and curricula because it requires that writers develop relationships between ideas and build a deep and multifaceted understanding of the topic. Due to the multifaceted demands, and inherent structure and conventions of argumentative writing, it is also among the most difficult to master. The aim of this masters thesis is to create a prototype of an authoring tool that can help novices (13-19 years old) of argumentative essay w...

  11. Modeled Neutron Induced Nuclear Reaction Cross Sections for Radiochemsitry in the region of Thulium, Lutetium, and Tantalum I. Results of Built in Spherical Symmetry in a Deformed Region

    Energy Technology Data Exchange (ETDEWEB)

    Hoffman, R. D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2013-09-06

    We have developed a set of modeled nuclear reaction cross sections for use in radiochemical diagnostics. Systematics for the input parameters required by the Hauser-Feshbach statistical model were developed and used to calculate neutron induced nuclear reaction cross sections for targets ranging from Terbium (Z = 65) to Rhenium (Z = 75). Of particular interest are the cross sections on Tm, Lu, and Ta including reactions on isomeric targets.

  12. A synaptic device built in one diode-one resistor (1D-1R) architecture with intrinsic SiOx-based resistive switching memory

    Science.gov (United States)

    Chang, Yao-Feng; Fowler, Burt; Chen, Ying-Chen; Zhou, Fei; Pan, Chih-Hung; Chang, Kuan-Chang; Tsai, Tsung-Ming; Chang, Ting-Chang; Sze, Simon M.; Lee, Jack C.

    2016-04-01

    We realize a device with biological synaptic behaviors by integrating silicon oxide (SiOx) resistive switching memory with Si diodes to further minimize total synaptic power consumption due to sneak-path currents and demonstrate the capability for spike-induced synaptic behaviors, representing critical milestones for the use of SiO2-based materials in future neuromorphic computing applications. Biological synaptic behaviors such as long-term potentiation, long-term depression, and spike-timing dependent plasticity are demonstrated systemically with comprehensive investigation of spike waveform analyses and represent a potential application for SiOx-based resistive switching materials. The resistive switching SET transition is modeled as hydrogen (proton) release from the (SiH)2 defect to generate the hydrogenbridge defect, and the RESET transition is modeled as an electrochemical reaction (proton capture) that re-forms (SiH)2. The experimental results suggest a simple, robust approach to realize programmable neuromorphic chips compatible with largescale complementary metal-oxide semiconductor manufacturing technology.

  13. A built-in sensor with carbon nanotubes coated by Ag clusters for deformation monitoring of glass fibre/epoxy composites

    Science.gov (United States)

    Slobodian, P.; Riha, P.; Matyas, J.; Olejnik, R.; Lloret Pertegás, S.; Schledjewski, R.; Kovar, M.

    2018-03-01

    A multiwalled carbon nanotube network embedded in a polyurethane membrane was integrated into a glass fibre reinforced epoxy composite by means of vacuum infusion to become a part of the composite and has been serving for a strain self-sensing functionality. Besides the pristine nanotubes also nanotubes with Ag nanoparticles attached to their surfaces were used to increase strain sensing. Moreover, the design of the carbon nanotube/polyurethane sensor allowed formation of network micro-sized cracks which increased its reversible electrical resistance resulted in an enhancement of strain sensing. The resistance sensitivity, quantified by a gauge factor, increased more than hundredfold in case of a pre-strained sensor with Ag decorated nanotubes in comparison with the sensor with pristine nanotubes.

  14. Incorporation of Immune Checkpoint Blockade into Chimeric Antigen Receptor T Cells (CAR-Ts): Combination or Built-In CAR-T.

    Science.gov (United States)

    Yoon, Dok Hyun; Osborn, Mark J; Tolar, Jakub; Kim, Chong Jai

    2018-01-24

    Chimeric antigen receptor (CAR) T cell therapy represents the first U.S. Food and Drug Administration approved gene therapy and these engineered cells function with unprecedented efficacy in the treatment of refractory CD19 positive hematologic malignancies. CAR translation to solid tumors is also being actively investigated; however, efficacy to date has been variable due to tumor-evolved mechanisms that inhibit local immune cell activity. To bolster the potency of CAR-T cells, modulation of the immunosuppressive tumor microenvironment with immune-checkpoint blockade is a promising strategy. The impact of this approach on hematological malignancies is in its infancy, and in this review we discuss CAR-T cells and their synergy with immune-checkpoint blockade.

  15. Deep Learning Algorithm for Auto-Delineation of High-Risk Oropharyngeal Clinical Target Volumes With Built-In Dice Similarity Coefficient Parameter Optimization Function.

    Science.gov (United States)

    Cardenas, Carlos E; McCarroll, Rachel E; Court, Laurence E; Elgohari, Baher A; Elhalawani, Hesham; Fuller, Clifton D; Kamal, Mona J; Meheissen, Mohamed A M; Mohamed, Abdallah S R; Rao, Arvind; Williams, Bowman; Wong, Andrew; Yang, Jinzhong; Aristophanous, Michalis

    2018-06-01

    Automating and standardizing the contouring of clinical target volumes (CTVs) can reduce interphysician variability, which is one of the largest sources of uncertainty in head and neck radiation therapy. In addition to using uniform margin expansions to auto-delineate high-risk CTVs, very little work has been performed to provide patient- and disease-specific high-risk CTVs. The aim of the present study was to develop a deep neural network for the auto-delineation of high-risk CTVs. Fifty-two oropharyngeal cancer patients were selected for the present study. All patients were treated at The University of Texas MD Anderson Cancer Center from January 2006 to August 2010 and had previously contoured gross tumor volumes and CTVs. We developed a deep learning algorithm using deep auto-encoders to identify physician contouring patterns at our institution. These models use distance map information from surrounding anatomic structures and the gross tumor volume as input parameters and conduct voxel-based classification to identify voxels that are part of the high-risk CTV. In addition, we developed a novel probability threshold selection function, based on the Dice similarity coefficient (DSC), to improve the generalization of the predicted volumes. The DSC-based function is implemented during an inner cross-validation loop, and probability thresholds are selected a priori during model parameter optimization. We performed a volumetric comparison between the predicted and manually contoured volumes to assess our model. The predicted volumes had a median DSC value of 0.81 (range 0.62-0.90), median mean surface distance of 2.8 mm (range 1.6-5.5), and median 95th Hausdorff distance of 7.5 mm (range 4.7-17.9) when comparing our predicted high-risk CTVs with the physician manual contours. These predicted high-risk CTVs provided close agreement to the ground-truth compared with current interobserver variability. The predicted contours could be implemented clinically, with only minor or no changes. Copyright © 2018 Elsevier Inc. All rights reserved.

  16. Development of signal processing electronics for self powered neutron detector signal with built-in on-line insulation monitoring [Paper No.:E3

    International Nuclear Information System (INIS)

    Das, Amitabha; Chaganty, S.P.

    1993-01-01

    Self powered neutron detectors (SPNDs) are employed to monitor in-core neutron flux in nuclear reactors for control, safety and mapping of in-core neutron flux. The d.c. current produced by SPND is converted into a proportional d.c. voltage, which in turn is used for various purposes stated above. This paper describes various features of the SPND amplifier developed in the Electronics Division of Bhabha Atomic Research Centre (BARC). It also outlines the principle of working of on-line monitoring of insulation resistance (IR) of the detector and associated mineral insulated (MI) and soft cables. The amplifier generates an alarm in case of the IR of the detector and the cable assembly falls below an accepted value or the cable is not connected to the amplifier and relieves the operator from periodic and manual checking of each of the individual detectors and ensures the validity of the signal for further processing. (author). 3 figs

  17. Highly sensitive and area-efficient CMOS image sensor using a PMOSFET-type photodetector with a built-in transfer gate

    Science.gov (United States)

    Seo, Sang-Ho; Kim, Kyoung-Do; Kong, Jae-Sung; Shin, Jang-Kyoo; Choi, Pyung

    2007-02-01

    In this paper, a new CMOS image sensor is presented, which uses a PMOSFET-type photodetector with a transfer gate that has a high and variable sensitivity. The proposed CMOS image sensor has been fabricated using a 0.35 μm 2-poly 4- metal standard CMOS technology and is composed of a 256 × 256 array of 7.05 × 7.10 μm pixels. The unit pixel has a configuration of a pseudo 3-transistor active pixel sensor (APS) with the PMOSFET-type photodetector with a transfer gate, which has a function of conventional 4-transistor APS. The generated photocurrent is controlled by the transfer gate of the PMOSFET-type photodetector. The maximum responsivity of the photodetector is larger than 1.0 × 10 3 A/W without any optical lens. Fabricated 256 × 256 CMOS image sensor exhibits a good response to low-level illumination as low as 5 lux.

  18. Active Pixel HgCdTe Detectors With Built-in Dark Current Reduction for Near-Room Temperature Operation, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — High sensitivity HgCdTe infrared arrays operating at 77K can now be tailored in a wide range of wavelengths from 1 to14 um. However, the cooling requirements make...

  19. Commentary on "Performance of a glucose meter with a built-in automated bolus calculator versus manual bolus calculation in insulin-using subjects".

    Science.gov (United States)

    Rossetti, Paolo; Vehí, Josep; Revert, Ana; Calm, Remei; Bondia, Jorge

    2012-03-01

    Since the early 2000s, there has been an exponentially increasing development of new diabetes-applied technology, such as continuous glucose monitoring, bolus calculators, and "smart" pumps, with the expectation of partially overcoming clinical inertia and low patient compliance. However, its long-term efficacy in glucose control has not been unequivocally proven. In this issue of Journal of Diabetes Science and Technology, Sussman and colleagues evaluated a tool for the calculation of the prandial insulin dose. A total of 205 insulin-treated patients were asked to compute a bolus dose in two simulated conditions either manually or with the bolus calculator built into the FreeStyle InsuLinx meter, revealing the high frequency of wrong calculations when performed manually. Although the clinical impact of this study is limited, it highlights the potential implications of low diabetesrelated numeracy in poor glycemic control. Educational programs aiming to increase patients' empowerment and caregivers' knowledge are needed in order to get full benefit of the technology. © 2012 Diabetes Technology Society.

  20. Incorporation of Immune Checkpoint Blockade into Chimeric Antigen Receptor T Cells (CAR-Ts: Combination or Built-In CAR-T

    Directory of Open Access Journals (Sweden)

    Dok Hyun Yoon

    2018-01-01

    Full Text Available Chimeric antigen receptor (CAR T cell therapy represents the first U.S. Food and Drug Administration approved gene therapy and these engineered cells function with unprecedented efficacy in the treatment of refractory CD19 positive hematologic malignancies. CAR translation to solid tumors is also being actively investigated; however, efficacy to date has been variable due to tumor-evolved mechanisms that inhibit local immune cell activity. To bolster the potency of CAR-T cells, modulation of the immunosuppressive tumor microenvironment with immune-checkpoint blockade is a promising strategy. The impact of this approach on hematological malignancies is in its infancy, and in this review we discuss CAR-T cells and their synergy with immune-checkpoint blockade.

  1. High pressure thimble/guide tube seal fitting with built-in low pressure seal especially suitable for facilitated and more efficient nuclear reactor refueling service

    International Nuclear Information System (INIS)

    Bhatt, P.N.; Blaushield, R.M.

    1991-01-01

    This patent describes a HP/LP seal arrangement for an elongated guide tube and an elongated thimble disposed therein. The guide tube and thimble extending outwardly from the core of a nuclear reactor to a seal table where the guide tube is welded to the seal table to provide a high pressure seal relative thereto. It comprises: a tubular seal fitting disposed in alignment with the guide tube with the thimble extending therethrough on the low pressure side of the seal table; first high pressure sealing means coupling one end of the fitting to an end of the guide tube to prevent leakage from within the guide tube; inwardly facing thread means disposed adjacent the other and outer end of the seal fitting; a nut having an opening through which the thimble extends and further having outwardly facing threading in mating engagement with the fitting thread means; the fitting having a seal seat spaced longitudinally inwardly from the thread means and facing the fitting outer end and further disposed annularly about the inner surface of the fitting; deformable ring seal means; second releasable high pressure sealing means coupling the thimble to the outer end portion of the guide tube

  2. Fusion of Built in Test (BIT) Technologies with Embeddable Fault Tolerant Techniques for Power System and Drives in Space Exploration, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — As NASA develops next generation space exploration systems as part of the Constellation program, new prognostics and health management tools are needed to ensure...

  3. Experimental and computational study of the effect of breath-actuated mechanism built in the NEXThaler® dry powder inhaler.

    Science.gov (United States)

    Farkas, Árpád; Lewis, David; Church, Tanya; Tweedie, Alan; Mason, Francesca; Haddrell, Allen E; Reid, Jonathan P; Horváth, Alpár; Balásházy, Imre

    2017-11-25

    The breath-actuated mechanism (BAM) is a mechanical unit included in NEXThaler ® with the role of delaying the emission of the drug until the inhalation flow rate of the patient is sufficiently high to detach the drug particles from their carriers. The main objective of this work was to analyse the effect of the presence of BAM on the size distribution of the emitted drug and its airway deposition efficiency and distribution. Study of the hygroscopic growth of the emitted drug particles and its effect on the deposition was another goal of this study. Size distributions of Foster ® NEXThaler ® drug particles emitted by dry powder inhalers with and without BAM have been measured by a Next Generation Impactor. Three characteristic inhalation profiles of asthmatic patients (low, moderate and high flow rates) were used for both experimental and modelling purposes. Particle hygroscopic growth was determined by a new method, where experimental measurements are combined with simulations. Upper airway and lung deposition fractions were computed assuming 5s and 10s breath-hold times. By the inclusion of BAM the fine particle fraction of the steroid component increased from 24 to 30% to 47-51%, while that of bronchodilator from 25-34% to 52-55%. The predicted upper airway steroid and bronchodilator doses decreased from about 60% to 35-40% due to BAM. At the same time, predicted lung doses increased from about 20%-35% (steroid) and from 22% to 38% (bronchodilator) for the moderate flow profile and from about 25% to 40% (steroid) and from 29% to 47% (bronchodilator) for the high inhalation flow profile. Although BDP and FF upper airway doses decreased by a factor of about two when BAM was present, lung doses of both components were about the same in the BAM and no-BAM configurations at the weakest flow profile. However, lung dose increased by 2-3% even for this profile when hygroscopic growth was taken into account. In conclusion, the NEXThaler ® BAM mechanism is a unique feature enabling high emitted fine particle fraction and enhanced drug delivery to the lungs. Copyright © 2017 The Authors. Published by Elsevier B.V. All rights reserved.

  4. Using built-in functions of Adobe Acrobat Pro DC to help the selection process in systematic reviews of randomised trials.

    Science.gov (United States)

    Nur, Selin; Adams, Clive E; Brailsford, David F

    2016-02-18

    This letter describes a simple way of using Adobe Acrobat Pro DC to help select and auto-extract data from Portable Document Format (PDFs) of randomised trials in order to assist swift early selection of trials for a systematic review.

  5. Techno-economic analysis of a concentrating solar collector with built-in shell and tube latent heat thermal energy storage

    International Nuclear Information System (INIS)

    Li, Qiyuan; Tehrani, S. Saeed Mostafavi; Taylor, Robert A.

    2017-01-01

    In this paper, the feasibility of a medium temperature, low profile concentrated solar thermal collector integrated with latent heat thermal energy storage (LHTES) is investigated. The proposed modular integrated collector storage (ICS) system consists of six solar receiver units and seven cylindrical shell and tube LHTES tanks. By implementing an innovative optical concentration assembly and an internal linear tracking mechanism, the collector can concentrate beam radiation to the tube receivers during the highest flux hours of a day without any external or rotational motion. The collector's efficiency correlations were obtained experimentally and its integrated performance – with the LHTES units – was evaluated numerically. To demonstrate the potential of this proposed ICS system, an annual analysis was carried out for a characteristic industrial application – a dairy dehydration process that requires a constant 50 kW th of heat in the 120–150 °C temperature range. It was found that adding the storage units will increase the capital costs by ∼10%, but it can increase the annual thermal output of the system by up to ∼20%. A solar fraction of 65% was achievable with some design alternatives, but the optimum techno-economic design had a solar fraction of ∼35% and an annual charging efficiency of nearly 100%. It was also found that if the capital cost of the ICS (collector and LHTES tank) system could be reduced by 50% from an estimated ∼1000 US$/m 2 to ∼500 US$/m 2 through mass production and/or further design optimizations, this system could provide industrial process heat with a levelized cost of heating (LCOH) of ∼0.065 US$/kWh th . - Highlights: • An innovative ICS system was proposed and analyzed for industrial heat applications. • The optimum design can achieve a ∼35% solar fraction with ∼100% charging efficiency. • A 0.12 US$/kWh LCOH was found, but further reductions could result in 0.065 US$/kWh. • Costs reductions of the ICS to 250–400 US$/m 2 could yield a 10 year payback time.

  6. Photoplethysmography Signal Analysis for Optimal Region-of-Interest Determination in Video Imaging on a Built-In Smartphone under Different Conditions

    Directory of Open Access Journals (Sweden)

    Yunyoung Nam

    2017-10-01

    Full Text Available Smartphones and tablets are widely used in medical fields, which can improve healthcare and reduce healthcare costs. Many medical applications for smartphones and tablets have already been developed and widely used by both health professionals and patients. Specifically, video recordings of fingertips made using a smartphone camera contain a pulsatile component caused by the cardiac pulse equivalent to that present in a photoplethysmographic signal. By performing peak detection on the pulsatile signal, it is possible to estimate a continuous heart rate and a respiratory rate. To estimate the heart rate and respiratory rate accurately, which pixel regions of the color bands give the most optimal signal quality should be investigated. In this paper, we investigate signal quality to determine the best signal quality by the largest amplitude values for three different smartphones under different conditions. We conducted several experiments to obtain reliable PPG signals and compared the PPG signal strength in the three color bands when the flashlight was both on and off. We also evaluated the intensity changes of PPG signals obtained from the smartphones with motion artifacts and fingertip pressure force. Furthermore, we have compared the PSNR of PPG signals of the full-size images with that of the region of interests (ROIs.

  7. Evaluation of the Shielding Performance for the Hot-cell built in 100-MeV Isotope Beam-line of KOMAC

    Energy Technology Data Exchange (ETDEWEB)

    Park, Jeong Min; Park, Sung Kyun; Min, Yi Sub; Cho, Yong Sub [KAERI, Daejeon (Korea, Republic of)

    2016-05-15

    This study describes the structure of the hot-cell constructed in KOMAC for radioisotope production and evaluates the shielding performance for the hot-cell via the radiation shielding ability test. Korea multi-purpose accelerator complex (KOMAC) is currently operating 20-MeV and 100-MeV beam-line one by on. Additional 100-MeV beam-line and target room (TR101) are planned for the purpose of the radioisotope production in this year. The initial goal of the radioisotope production is to produce the radioactive isotopes, Sr-82 or Cu-67, used widely for the diagnosis and treatment of the cancer. In order to produce these radioisotopes mentioned, the proton beam with the energy between 70-MeV and 100- MeV at a beam current of 300 μA is irradiated into a solid target made of ZnO or RbCl. After the irradiation of the proton beam during approximately 100 hours, the radioisotope Sr-82 with the radioactivity amount of about 3.8 Ci or the Cu-67 with the amount of about 2.7 Ci will be produced. Radioisotopes produced though this process should be conveyed from the TR101 target room to the PR101 processing room and then in order to be delivered into the place for the next process step, a hot-cell is necessary. Result of the shielding performance evaluation of the hot-cell for producing radioisotopes shows the necessity of the shield reinforcement using lead material at side of the lead glass window.

  8. Improvement of cytocompatibility of polylactide by filling with marine algae powder

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Tung-Yi [Department of Materials Science and Engineering, National Taiwan University of Science and Technology, Taipei 10607, Taiwan (China); Yang, Ming-Chien, E-mail: myang@mail.ntust.edu.tw [Department of Materials Science and Engineering, National Taiwan University of Science and Technology, Taipei 10607, Taiwan (China); Hsu, Yi-Chiang [Graduate Institute of Medical Science, College of Health Sciences, Chang Jung Christian University, Tainan 71101, Taiwan (China); Innovative Research Center of Medicine, College of Health Sciences, Chang Jung Christian University, Tainan 71101, Taiwan (China)

    2015-05-01

    This work evaluated the cytocompatibility, thermal and mechanical properties of composites of polylactide (PLA) and marine algae powder (MAP). To improve the thermal and mechanical properties of PLA–MAP composites, glycidyl methacrylate (GMA) was used as the compatibilizer for the blending of PLA and MAP. The PLA-g-GMA/MAP composites exhibited superior mechanical properties, attributing to higher compatibility between the polymer and MAP, comparing to PLA/MAP composites. The dispersion of MAP in the PLA-g-GMA matrix was highly homogeneous as a result of etherification. The lower melt torque of the PLA-g-GMA/MAP composites also made them more processable than PLA/MAP. To assess the cytocompatibility, normal human foreskin fibroblasts (FBs) were seeded onto each type of the composites. Results of FB proliferation, collagen production, and cytotoxicity assays indicated greater cytocompatibility for the PLA/MAP composites than for the PLA-g-GMA/MAP composites. Furthermore, both PLA/MAP and PLA-g-GMA/MAP composites were more cytocompatible than pure PLA. - Highlights: • PLA was grafted with GMA to form ether bond with marine algae powder (MAP). • Composites of PLA-g-GMA and MAP exhibited cytocompatibility with fibroblasts. • PLA-g-GMA/MAP composites exhibited mechanical properties superior to PLA/MAP. • PLA-g-GMA/MAP composites were more processable than PLA/MAP.

  9. Production of sorption-active polypropylene fibers by radiation-induce grafting of glycidyl methacrylate as a precursor monomer

    International Nuclear Information System (INIS)

    Bondar, Yu.V.; Kim, H.J.; Lim, Y.J.; Kravets, L.I.

    2004-01-01

    Full text: Two types of sorption-active polypropylene fiber carrying strong-acid sulfonate groups and amino groups have been synthesized by radiation-induced graft polymerization of glycidyl methacrylate (GMA) with subsequent chemical modification of the epoxy groups of poly-GMA graft chains. The effect of various polymerization parameters on the GMA grafting degree was investigated in detail. The epoxy ring-opening of poly-GMA graft chains with introduction of strong-acid sulfonate groups was carried out with sodium hydrogen sulfite in water-dimethylformamide solution at 70 o C. The main peculiarities of the sulfonation reaction in depending on the reaction time and GMA grafting degree have been investigated. It was shown that for the samples with GMA grafting degree more than 50% two simultaneous processes take place during the sulfonation reaction, namely the incorporation of the sulfonate groups via opening of the GMA epoxy-rings as well as hydrolysis of the GMA epoxy-rings with the formation of α-glycol groups. Amine groups were incorporated by treatment of GMA-grafted polypropylene fibers with excess of diethylene triamine reagent. The conversion of the epoxy groups into the functional groups was investigated as a function of the degree of GMA grafting and reaction time. The ion-exchange characteristics of obtained sorption-active polypropylene fibers were determined

  10. Production of sorption-active polypropylene fiber by radiation-induce grafting of glycidyl methacrylate as a precursor monomer

    International Nuclear Information System (INIS)

    Bondar, Yu.V.; Kim, H.J.; Lim, Y.J.; Kravets, L.I.

    2004-01-01

    Two types of sorption-active polypropylene fiber carrying strong-acid sulfonate groups and amino groups have been synthesized by radiation-induced graft polymerization of glycidyl methacrylate (GMA) with subsequent chemical modification of the epoxy groups of poly-GMA graft chains. The effect of various polymerization parameters on the GMA grafting degree was investigated in detail. The epoxy ring-opening of poly-GMA graft chains with introduction of strong-acid sulfonate groups was carried out with sodium hydrogen sulfite in water-dimethylformamide solution at 70 o C. The main peculiarities of the sulfonation reaction in depending on the reaction time and GMA grafting degree have been investigated. It was shown that for the samples with GMA grafting degree more than 50% two simultaneous processes take place during the sulfonation reaction, namely the incorporation of the sulfonate groups via opening of the GMA epoxy-rings as well as hydrolysis of the GMA epoxy-rings with the formation of α-glycol groups. Amine groups were incorporated by treatment of GMA-grafted polypropylene fibers with excess of diethylene triamine reagent. The conversion of the epoxy groups into the functional groups was investigated as a function of the degree of GMA grafting and reaction time. The ion-exchange characteristics of obtained sorption-active polypropylene fibers were determined. (author)

  11. Improvement of cytocompatibility of polylactide by filling with marine algae powder

    International Nuclear Information System (INIS)

    Wu, Tung-Yi; Yang, Ming-Chien; Hsu, Yi-Chiang

    2015-01-01

    This work evaluated the cytocompatibility, thermal and mechanical properties of composites of polylactide (PLA) and marine algae powder (MAP). To improve the thermal and mechanical properties of PLA–MAP composites, glycidyl methacrylate (GMA) was used as the compatibilizer for the blending of PLA and MAP. The PLA-g-GMA/MAP composites exhibited superior mechanical properties, attributing to higher compatibility between the polymer and MAP, comparing to PLA/MAP composites. The dispersion of MAP in the PLA-g-GMA matrix was highly homogeneous as a result of etherification. The lower melt torque of the PLA-g-GMA/MAP composites also made them more processable than PLA/MAP. To assess the cytocompatibility, normal human foreskin fibroblasts (FBs) were seeded onto each type of the composites. Results of FB proliferation, collagen production, and cytotoxicity assays indicated greater cytocompatibility for the PLA/MAP composites than for the PLA-g-GMA/MAP composites. Furthermore, both PLA/MAP and PLA-g-GMA/MAP composites were more cytocompatible than pure PLA. - Highlights: • PLA was grafted with GMA to form ether bond with marine algae powder (MAP). • Composites of PLA-g-GMA and MAP exhibited cytocompatibility with fibroblasts. • PLA-g-GMA/MAP composites exhibited mechanical properties superior to PLA/MAP. • PLA-g-GMA/MAP composites were more processable than PLA/MAP

  12. Built-in hyperspectral camera for smartphone in visible, near-infrared and middle-infrared lights region (third report): spectroscopic imaging for broad-area and real-time componential analysis system against local unexpected terrorism and disasters

    Science.gov (United States)

    Hosono, Satsuki; Kawashima, Natsumi; Wollherr, Dirk; Ishimaru, Ichiro

    2016-05-01

    The distributed networks for information collection of chemical components with high-mobility objects, such as drones or smartphones, will work effectively for investigations, clarifications and predictions against unexpected local terrorisms and disasters like localized torrential downpours. We proposed and reported the proposed spectroscopic line-imager for smartphones in this conference. In this paper, we will mention the wide-area spectroscopic-image construction by estimating 6 DOF (Degrees Of Freedom: parallel movements=x,y,z and rotational movements=θx, θy, θz) from line data to observe and analyze surrounding chemical-environments. Recently, smartphone movies, what were photographed by peoples happened to be there, had worked effectively to analyze what kinds of phenomenon had happened around there. But when a gas tank suddenly blew up, we did not recognize from visible-light RGB-color cameras what kinds of chemical gas components were polluting surrounding atmospheres. Conventionally Fourier spectroscopy had been well known as chemical components analysis in laboratory usages. But volatile gases should be analyzed promptly at accident sites. And because the humidity absorption in near and middle infrared lights has very high sensitivity, we will be able to detect humidity in the sky from wide field spectroscopic image. And also recently, 6-DOF sensors are easily utilized for estimation of position and attitude for UAV (Unmanned Air Vehicle) or smartphone. But for observing long-distance views, accuracies of angle measurements were not sufficient to merge line data because of leverage theory. Thus, by searching corresponding pixels between line spectroscopic images, we are trying to estimate 6-DOF in high accuracy.

  13. Targeted theranostic platinum(IV) prodrug with a built-in aggregation-induced emission light-up apoptosis sensor for noninvasive early evaluation of its therapeutic responses in situ.

    Science.gov (United States)

    Yuan, Youyong; Kwok, Ryan T K; Tang, Ben Zhong; Liu, Bin

    2014-02-12

    Targeted drug delivery to tumor cells with minimized side effects and real-time in situ monitoring of drug efficacy is highly desirable for personalized medicine. In this work, we report the synthesis and biological evaluation of a chemotherapeutic Pt(IV) prodrug whose two axial positions are functionalized with a cyclic arginine-glycine-aspartic acid (cRGD) tripeptide for targeting integrin αvβ3 overexpressed cancer cells and an apoptosis sensor which is composed of tetraphenylsilole (TPS) fluorophore with aggregation-induced emission (AIE) characteristics and a caspase-3 enzyme specific Asp-Glu-Val-Asp (DEVD) peptide. The targeted Pt(IV) prodrug can selectively bind to αvβ3 integrin overexpressed cancer cells to facilitate cellular uptake. In addition, the Pt(IV) prodrug can be reduced to active Pt(II) drug in cells and release the apoptosis sensor TPS-DEVD simultaneously. The reduced Pt(II) drug can induce the cell apoptosis and activate caspase-3 enzyme to cleave the DEVD peptide sequence. Due to free rotation of the phenylene rings, TPS-DEVD is nonemissive in aqueous media. The specific cleavage of DEVD by caspase-3 generates the hydrophobic TPS residue, which tends to aggregate, resulting in restriction of intramolecular rotations of the phenyl rings and ultimately leading to fluorescence enhancement. Such noninvasive and real-time imaging of drug-induced apoptosis in situ can be used as an indicator for early evaluation of the therapeutic responses of a specific anticancer drug.

  14. Built-in hyperspectral camera for smartphone in visible, near-infrared and middle-infrared lights region (second report): sensitivity improvement of Fourier-spectroscopic imaging to detect diffuse reflection lights from internal human tissues for healthcare sensors

    Science.gov (United States)

    Kawashima, Natsumi; Hosono, Satsuki; Ishimaru, Ichiro

    2016-05-01

    We proposed the snapshot-type Fourier spectroscopic imaging for smartphone that was mentioned in 1st. report in this conference. For spectroscopic components analysis, such as non-invasive blood glucose sensors, the diffuse reflection lights from internal human skins are very weak for conventional hyperspectral cameras, such as AOTF (Acousto-Optic Tunable Filter) type. Furthermore, it is well known that the spectral absorption of mid-infrared lights or Raman spectroscopy especially in long wavelength region is effective to distinguish specific biomedical components quantitatively, such as glucose concentration. But the main issue was that photon energies of middle infrared lights and light intensities of Raman scattering are extremely weak. For improving sensitivity of our spectroscopic imager, the wide-field-stop & beam-expansion method was proposed. Our line spectroscopic imager introduced a single slit for field stop on the conjugate objective plane. Obviously to increase detected light intensities, the wider slit width of the field stop makes light intensities higher, regardless of deterioration of spatial resolutions. Because our method is based on wavefront-division interferometry, it becomes problems that the wider width of single slit makes the diffraction angle narrower. This means that the narrower diameter of collimated objective beams deteriorates visibilities of interferograms. By installing the relative inclined phaseshifter onto optical Fourier transform plane of infinity corrected optical systems, the collimated half flux of objective beams derived from single-bright points on objective surface penetrate through the wedge prism and the cuboid glass respectively. These two beams interfere each other and form the infererogram as spatial fringe patterns. Thus, we installed concave-cylindrical lens between the wider slit and objective lens as a beam expander. We successfully obtained the spectroscopic characters of hemoglobin from reflected lights from human fingers.

  15. Decree 343/012. Is regulated the servitude established by Decree-Law 10,383, on several lines of electricity conduction -150 KV to be built in the departments of Florida, Cerro Largo, Maldonado, Flores, San Jose and Tacuarembo

    International Nuclear Information System (INIS)

    2012-01-01

    This decree regulates the establishment of electricity conduction in Florida, Cerro Largo, Maldonado, Flores, San Jose and Tacuarembo towns. These electrical lines are necessary to provide the public service by UTE

  16. Effects of molecular structure of the resins on the volumetric shrinkage and the mechanical strength of dental restorative composites.

    Science.gov (United States)

    Kim, L U; Kim, J W; Kim, C K

    2006-09-01

    To prepare a dental composite that has a low amount of curing shrinkage and excellent mechanical strength, various 2,2-bis[4-(2-hydroxy-3-methacryloyloxy propoxy) phenyl] propane (Bis-GMA) derivatives were synthesized via molecular structure design, and afterward, properties of their mixtures were explored. Bis-GMA derivatives, which were obtained by substituting methyl groups for hydrogen on the phenyl ring in the Bis-GMA, exhibited lower curing shrinkage than Bis-GMA, whereas their viscosities were higher than that of Bis-GMA. Other Bis-GMA derivatives, which contained a glycidyl methacrylate as a molecular end group exhibited reduced curing shrinkage and viscosity. Methoxy substitution for hydroxyl groups on the Bis-GMA derivatives was performed for the further reduction of the viscosity and curing shrinkage. Various resin mixtures, which had the same viscosity as the commercial one, were prepared, and their curing shrinkage was examined. A resin mixture containing 2,2-bis[3,5-dimethyl, 4-(2-methoxy-3-methacryloyloxy propoxy) phenyl] propane] (TMBis-M-GMA) as a base resin and 4-tert-butylphenoxy-2-methyoxypropyl methacrylate (t-BP-M-GMA) as a diluent exhibited the lowest curing shrinkage among them. The composite prepared from this resin mixture also exhibited the lowest curing shrinkage along with enhanced mechanical properties.

  17. Synthesis and characterization of monosize magnetic poly(glycidyl methacrylate) beads

    Institute of Scientific and Technical Information of China (English)

    Evrim Banu Alt1nta(s); Lokman Uzun; Adil Denizli

    2007-01-01

    Monosize, 1.6 μm, magnetic beads of poly(glycidyl methacrylate) [M-poly(GMA)], were prepared by dispersion polymerization in the presence of Fe3O4 nano-powder. Monosize M-poly(GMA) beads were characterized by swelling tests, density measurements, electron spin resonance (ESR), vibrating sample magnetometer (VSM) and scanning electron microscopy (SEM). The characteristic functional groups of M-poly(GMA)beads were analyzed by Fourier transform infrared spectrometer (FTIR). The M-poly(GMA) beads are highly uniform in size and have a spherical shape and non-porous structure. Polydispersity index (PDI) of M-poly(GMA) beads was calculated to be around 1.008. The hydrated density of the M-poly(GMA) beads measured at 25 ℃ was 1.14 g/cm3. The content of oxirane groups on the surface of the M-poly(GMA) sample was found to be 3.46 mmol/g by using perchloric acid titration. The specific surface area of the M-poly(GMA) beads was determined to be 3.2 m2/g.The equilibrium swelling ratio was 52%. The volume fraction of magnetite nanopowder in the M-poly(GMA) beads was found to be 4.5%. The g factor, that can be considered as a quantity characteristic of the molecules in which the unpaired electrons are located, was found to be 2.28for M-poly(GMA). The external magnetic field at resonance was calculated to be 2055 Gs which was found sufficient to excite all of the dipole moments present in 1.0 g of M-poly(GMA) sample.

  18. Grapho-Morphological Awareness in Spanish L2 Reading: How Do Learners Use This Metalinguistic Skill?

    Science.gov (United States)

    Miguel, Nausica Marcos

    2012-01-01

    This paper contributes to the literature on the transferability of grapho-morphological awareness (GMA) for second language (L2) learners by analysing L2 learners' knowledge of morphology in reading. GMA helps readers to identify grammatical categories, infer meanings of unfamiliar words, and access stored lexical information. Previous research…

  19. Quantitative aspects of enzyme histochemistry on sections of freeze-substituted glycol methacrylate-embedded rat liver

    NARCIS (Netherlands)

    Frederiks, W. M.; Bosch, K. S.

    1993-01-01

    Freeze-substituted rat liver embedded in glycol methacrylate (GMA) has been used to demonstrate the activities of several enzymes. The following enzymes could be detected in GMA-sections by the indicated histochemical procedure(s): 5'-nucleotidase (lead salt, cerium-diaminobenzidine), alkaline

  20. Modification of macroporous membranes by graft co-polymerization induced by pre-irradiation with an electron accelerator; Modificacion de membranas macroporosas para la recuperacion de protemas por intercambio ionico

    Energy Technology Data Exchange (ETDEWEB)

    Grasselli, M [Buenos Aires Univ. (Argentina). Facultad de Farmacia y Bioquimica; Yoshii, Fumio [Japan Atomic Energy Research Inst., Takasaki, Gunma (Japan). Takasaki Radiation Chemistry Research Establishment

    1999-07-01

    Glycidyl methacrylate (GMA) and N,N-dimethylacrylamide (DMAA) have been co-grafted on hollow fiber membranes of macroporous polyethylene. Grafted copolymers have been obtained with different ratios of the monomers (molar ratio between 0 and 2 DMAA/GMA). The properties of the modified membranes are studied.

  1. Modification of macroporous membranes by graft co-polymerization induced by pre-irradiation with an electron accelerator

    International Nuclear Information System (INIS)

    Grasselli, M.; Yoshii, Fumio

    1999-01-01

    Glycidyl methacrylate (GMA) and N,N-dimethylacrylamide (DMAA) have been co-grafted on hollow fiber membranes of macroporous polyethylene. Grafted copolymers have been obtained with different ratios of the monomers (molar ratio between 0 and 2 DMAA/GMA). The properties of the modified membranes are studied

  2. Preparation of epoxy-functionalized methyl methacrylate-butadiene-styrene core-shell particles and investigation of their dispersion in polyamide-6

    NARCIS (Netherlands)

    Aerdts, A.M.; Groeninckx, G.; Zirkzee, H.F.; Aert, van H.A.M.; Geurts, J.M.

    1997-01-01

    Functional core—shell impact modifiers of glycidyl methacrylate (GMA) functionalized methyl methacrylate—butadiene—styrene (MBS) have been prepared via a seeded semi-continuous emulsion polymerization. These functional MBS—GMA particles were blended with polyamide-6. Investigations by transmission

  3. THE EFFECTS OF GLYCOL METHACRYLATE AS A DEHYDRATING AGENT ON THE DIMENSIONAL CHANGES OF LIVER-TISSUE

    NARCIS (Netherlands)

    GERRITS, PO; HOROBIN, RW; STOKROOS, [No Value

    The dimensional changes of liver sections during the course of processing with glycol methacrylate (GMA) or with ethanol are described. Tissue processing with ethanol served as a control. During prolonged processing steps (24 h each), linear shrinkage of tissue specimens dehydrated with GMA at room

  4. The Sensitive, Imaginative, Articulate Art Student and Conservative, Cool, Numerate Science Student: Individual Differences in Art and Science Students

    Science.gov (United States)

    Furnham, Adrian; Crump, John

    2013-01-01

    In all 794 young people aged around 30 yrs completed three intelligence (Raven's Progressive matrices: GMA Numerical and GMA Verbal) and one personality inventory (16PF). They were all graduates and 173 were identified clearly as Arts graduates and 518 as Science students. There were various sex differences on all measures. All seven hypotheses…

  5. An association between geomagnetic activity and dream bizarreness.

    Science.gov (United States)

    Lipnicki, Darren M

    2009-07-01

    Daily disturbances of the earth's magnetic field produce variations in geomagnetic activity (GMA) that are reportedly associated with widespread effects on human health and behaviour. Some of these effects could be mediated by an established influence of GMA on the secretion of melatonin. There is evidence from unrelated research that melatonin influences dream bizarreness, and it is hypothesised here that there is an association between GMA and dream bizarreness. Also reported is a preliminary test of this hypothesis, a case study in which the dreams recorded over 6.5 years by a young adult male were analysed. Reports of dreams from the second of two consecutive days of either low or high GMA (K index sum or = 28) were self-rated for bizarreness on a 1-5 scale. Dreams from low GMA periods (n=69, median bizarreness=4) were found to be significantly more bizarre than dreams from high GMA periods (n=85, median bizarreness=3; p=0.006), supporting the hypothesised association between GMA and dream bizarreness. Studies with larger samples are needed to verify this association, and to determine the extent to which melatonin may be involved. Establishing that there is an association between GMA and dream bizarreness would have relevance for neurophysiological theories of dreaming, and for models of psychotic symptoms resembling bizarre dream events.

  6. Osteointegration of a bisphenol-a-glycidyl-dimethacrylate composite and its use in anterior skull base defects: an experimental study in an experimental design model of cerebrospinal fluid leak.

    Science.gov (United States)

    Sanus, Galip Zihni; Kucukyuruk, Baris; Biceroglu, Huseyin; Isler, Cihan; Tanriverdi, Taner; Bas, Ahmet; Albayram, Sait; Kurkcu, Mehmet; Oz, Buge

    2014-07-01

    Promising clinical results were reported in watertight closure of anterior skull base defects (ASBDs) with bisphenol-a-glycidyl-dimethacrylate (bis-GMA)-based materials to prevent the cerebrospinal fluid leaks. However, interrelation of these materials with surrounding bones in histologic level, referred to as the osteointegration, has not been reported in the anterior skull base. In addition, an illustrative case with an ASBD that was repaired using a bis-GMA composite has been presented. Twenty New Zealand rabbits were divided into 4 groups: control and sham groups consisted of 2 and 6 rabbits, respectively. The "skull base defect" group (n = 6) underwent a unifrontal craniectomy and an iatrogenic ASBD followed by creating a dural defect to obtain a cerebrospinal fluid leak. Similar bony and dural defects were acquired in the "repair with bis-GMA based allograft" group (n = 6), but the bony defect was closed with bis-GMA-based allograft. All animals in the "skull base defect" group died in 3 weeks after surgery. There were no animal losses in the "repair with bis-GMA based allograft" group at the sixth month. Histologic evaluation revealed complete osteointegration of bis-GMA composite with surrounding bones. bis-GMA based allograft achieved a watertight repair of the ASBD. Histologic findings of this study showed that bis-GMA composite is a reliable material to be used in the closure of anterior skull base bony defects.

  7. Synthesis and Properties of Reactive Interfacial Agents for Polycaprolactone-Starch Blends

    NARCIS (Netherlands)

    Sugih, Asaf K.; Drijfhout, Jan. P.; Picchioni, Francesco; Janssen, Leon P. B. M.; Heeres, Hero J.

    2009-01-01

    The synthesis of two reactive interfacial agents for starch-polycaprolactone (PCL) blends, PCL-g-glycidyl methacrylate (PCL-g-GMA) and PCL-g-diethyl maleate (PCL-g-DEM) is described. The compounds were prepared by reacting a low molecular weight PCL. (M(w) 3000) with GMA or DEM in the presence of

  8. Formal training in general movement assessment is required to effectively evaluate infants with perinatal asphyxia in outpatient settings

    DEFF Research Database (Denmark)

    Brown, Annemette K; Greisen, Gorm; Haugsted, Ulla

    2016-01-01

    recordings to assess GMA, in a busy Danish outpatient clinic. METHODS: The study comprised 30-term infants born with perinatal asphyxia, who were video recorded at three months. They were assessed by two certified GMA observers and re-assessed two weeks later. Interobserver and intra-observer agreements were...

  9. When intelligence is (dys)functional for achieving sales performance

    NARCIS (Netherlands)

    Verbeke, W.J.; Belschak, F.D.; Bakker, A.B.; Dietz, B.

    2008-01-01

    Using two samples of salespeople, the authors investigate how a combination of general mental ability (GMA) and specific skills and capabilities (social competence and thinking styles) enables salespeople to reach their sales goals. The study finds evidence for an interaction between GMA and social

  10. Optimization of process parameter for graft copolymerization of glycidyl methacrylate onto delignified banana fibers

    International Nuclear Information System (INIS)

    Selambakkannu, S.; Nor Azillah Fatimah Othman; Siti Fatahiyah Mohamad

    2016-01-01

    This paper focused on pre-treated banana fibers as a trunk polymer for optimization of radiation-induced graft copolymerization process parameters. Pre-treated banana fiber was grafted with glycidyl methacrylate (GMA) via electron beam irradiation. Optimization of grafting parameters in term of grafting yield was analyzed at numerous radiation dose, monomer concentration and reaction time. Grafting yield had been calculated gravimetrically against all the process parameters. The grafting yield at 40 kGy had increases from 14 % to 22.5 % at 1 h and 24 h of reaction time respectively. Grafting yield at 1 % of GMA was about 58 % and it increases to 187 % at 3 % GMA. The grafting of GMA onto pre-treated banana fibers confirmed with the characterization using FTIR, SEM and TGA. Grafting of GMA onto pre-treated fibers was successfully carried out and it was confirmed by the results obtained via the characterization. (author)

  11. Toughening modification of poly(butylene terephthalate)/poly(ethylene terephthalate) blends by an epoxy-functionalized elastomer

    Science.gov (United States)

    Zhang, Weizhou; Wang, Kai; Yan, Wei; Guo, Weihong

    2017-10-01

    New toughened poly(butylene terephthalate) (PBT)/poly(ethylene terephthalate) (PET) (40/60 wt%) blends were obtained by melting with Glycidyl methacrylate grafted poly(ethylene octane) copolymer (POE-g-GMA), varying the POE-g-GMA content up to 20 wt%, in a twin-screw extruder, followed by injection molding. The influence of POE-g-GMA on the properties of the PBT/PET blends was investigated by mechanical testing, Fourier transform infrared (FT-IR) analysis, gel fractions analysis, dynamic mechanical analysis (DMA), differential scanning calorimetry (DSC) and scanning electronic microscopy (SEM). The mechanical testing results indicated that the incorporation of POE-g-GMA led to increases in the notched impact strength and decreases in the tensile strength, flexural strength, and flexural modulus. When POE-g-GMA content reached 20 wt%, the notched impact strength (8.0 kJ m-2) was achieved for the PBT/PET/POE-g-GMA blends. FT-IR results proved that some PBT/PET/POE-g-GMA copolymers were produced, which improved the compatibility between POE-g-GMA and the PBT/PET matrix. The extent of crosslinking was observed by gel fraction measurements. DMA results further testified chain-extending and micro-crosslink reactions occurred between POE-g-GMA and PBT/PET blends. In addition, the reactions induced by POE-g-GMA affected the crystallization behavior of PBT/PET blends obviously, as observed from DSC results. By means of SEM observation of the impact fracture surface morphology, and the discussion of the micro-crosslink reaction process between the epoxide-containing elastomers and PBT/PET matrix, the toughening mechanism was proposed to be taken into account the shear yielding of PBT/PET matrix and cavitation of elastomer particles.

  12. Posidonia oceanica as a Renewable Lignocellulosic Biomass for the Synthesis of Cellulose Acetate and Glycidyl Methacrylate Grafted Cellulose

    Directory of Open Access Journals (Sweden)

    Elena Vismara

    2013-05-01

    Full Text Available High-grade cellulose (97% α-cellulose content of 48% crystallinity index was extracted from the renewable marine biomass waste Posidonia oceanica using H2O2 and organic peracids following an environmentally friendly and chlorine-free process. This cellulose appeared as a new high-grade cellulose of waste origin quite similar to the high-grade cellulose extracted from more noble starting materials like wood and cotton linters. The benefits of α-cellulose recovery from P. oceanica were enhanced by its transformation into cellulose acetate CA and cellulose derivative GMA-C. Fully acetylated CA was prepared by conventional acetylation method and easily transformed into a transparent film. GMA-C with a molar substitution (MS of 0.72 was produced by quenching Fenton’s reagent (H2O2/FeSO4 generated cellulose radicals with GMA. GMA grafting endowed high-grade cellulose from Posidonia with adsorption capability. GMA-C removes β-naphthol from water with an efficiency of 47%, as measured by UV-Vis spectroscopy. After hydrolysis of the glycidyl group to glycerol group, the modified GMA-C was able to remove p-nitrophenol from water with an efficiency of 92%, as measured by UV-Vis spectroscopy. α-cellulose and GMA-Cs from Posidonia waste can be considered as new materials of potential industrial and environmental interest.

  13. Surface treatment of poly(ethylene terephthalate) by gamma-ray induced graft copolymerization of methyl acrylate and its toughening effect on poly(ethylene terephthalate)/elastomer blend

    International Nuclear Information System (INIS)

    Ma, Liang; Wang, Mozhen; Ge, Xuewu

    2013-01-01

    To improve the compatibility between ethylene-methyl acrylate-glycidyl methacrylate random terpolymer (E-MA-GMA) elastomer and poly(ethylene terephthalate) (PET), thereby enhance the toughening effect of E-MA-GMA on PET, γ-radiation-induced graft copolymerization technique was used to graft methyl acrylate (MA) monomer onto PET. The produced PET-g-PMA copolymer can be used as a self-compatibilizer in PET/E-MA-GMA blend since the copolymer contains the same segments, respectively, with PET and E-MA-GMA. The impact strength of PET/E-MA-GMA blend increased nearly by 30% in the presence of less than 0.1 wt% PET-g-PMA compared with that of the neat PET/elastomer blend, without loss of the tensile strength of the blends. This work proposed a potential application of radiation-induced grafting copolymerization technique on the in-situ compatibilization of PET/elastomer blends so as to improve the integral mechanical properties of PET based engineering plastic. - Highlights: • PMA was grafted onto PET resins by γ-ray radiation-induced copolymerization. • The obtained PET-g-PMA can improve the compatibility between PET and E-MA-GMA. • A small amount of PET-g-PMA can enhance the impact strength of PET/E-MA-GMA blend

  14. Peripheral Blood CD64 Levels Decrease in Crohn’s Disease following Granulocyte and Monocyte Adsorptive Apheresis

    Directory of Open Access Journals (Sweden)

    Toshimi Chiba

    2011-12-01

    Full Text Available Granulocyte and monocyte adsorptive apheresis (GMA is reportedly useful as induction therapy for Crohn’s disease (CD. However, the effects of GMA on CD64 have not been well characterized. We report here our assessment of CD64 expression on neutrophils before and after treatment with GMA in two patients with CD. The severity of CD was assessed with the CD activity index (CDAI. The duration of each GMA session was 60 min at a flow rate of 30 ml/min as per protocol. CD64 expression on neutrophils was measured by analyzing whole blood with a FACScan flow cytometer. In case 1, CD64 levels after each session of GMA tended to decrease compared to pretreatment levels, whereas in case 2, CD64 levels dropped significantly after treatment. The CDAI decreased after GMA in both cases 1 and 2. A significant correlation was noted between CDAI scores and CD64 levels in both cases. In conclusion, GMA reduced blood CD64 levels, which would be an important factor for the decrease of CDAI scores.

  15. Studies on the effect of compatibilizers on mechanical, thermal and flow properties of polycarbonate/poly (butylene terephthalate) blends

    Science.gov (United States)

    Kumar, Ravindra; Kar, Kamal K.; Kumar, Vijai

    2018-01-01

    Bisphenol-A polycarbonate (PC) and poly(butylene terephthalate) (PBT) were melt blended with ethylene-n-butylacrylate-glycidylmethacrylate terpolymer (E-BA-GMA) at various proportions in order to study the effects of compatibilizers on mechanical, thermal and flow properties of blends. Furthermore, on the basis of this study, PC and PBT were melt-blended at 60/40 proportion with three different compatibilizers viz., ethylene-n-butylacrylate copolymer (E-BA), E-BA-GMA and random copolymer of ethylene and glycidylmethacrylate (E-GMA) at 3 phr loading in a co-rotating twin screw extruder. Tensile, flexural and impact tests were carried out on injection molded samples of PC/PBT blends. The notched izod impact strength increases enormously (˜2-3 times) on addition of any one of the three compatibilizers, and elongation at break (%) also improves tremendously (3, 5 and 4 times) on incorporation of E-BA, E-BA-GMA and E-GMA copolymer, respectively while other mechanical properties decreases slightly (3%-8%) on addition of any one of these compatibilizers. The heat deflection temperature (HDT) raises ˜8 °C-9 °C on addition of either E-BA-GMA or E-GMA, while E-BA shows a negative effect on HDT. The melt flow index diminishes significantly (˜5%-20%) on incorporation of these compatibilizers. The morphology studies via scanning electron microscopy of these four blends were carried out to confirm the mechanical results.

  16. Clinical Evaluation of an Acrylic Pontic ’Adhesively’ Bonded to Uncut Abutment Teeth: 18 Month Results

    Science.gov (United States)

    1974-12-23

    in greater detail by a dental manufacturerI0 advocates the use of a composite Bis -GMA resin+ to "ad- hesively" bond an acrylic pontic directly to...interface between the pontic and Bis -GMA resin used to cement the pontic to the natural teeth. This consistent mode of failure suggested that an...examination of the failed "bridges" showed that delamination occurred at the interface between the pontic and Bis -GMA resin used to cement the pontic to the

  17. Altered ion transport in normal human bronchial epithelial cells following exposure to chemically distinct metal welding fume particles

    Energy Technology Data Exchange (ETDEWEB)

    Fedan, Jeffrey S., E-mail: jsf2@cdc.gov; Thompson, Janet A.; Meighan, Terence G.; Zeidler-Erdely, Patti C.; Antonini, James M.

    2017-07-01

    Welding fume inhalation causes pulmonary toxicity, including susceptibility to infection. We hypothesized that airway epithelial ion transport is a target of fume toxicity, and investigated the effects of fume particulates from manual metal arc-stainless steel (MMA-SS) and gas metal arc-mild steel (GMA-MS) on ion transport in normal human bronchial epithelium (NHBE) cultured in air-interface. MMA-SS particles, more soluble than GMA-MS particles, contain Cr, Ni, Fe and Mn; GMA-MS particles contain Fe and Mn. MMA-SS or GMA-MS particles (0.0167–166.7 μg/cm{sup 2}) were applied apically to NHBEs. After 18 h transepithelial potential difference (V{sub t}), resistance (R{sub t}), and short circuit current (I{sub sc}) were measured. Particle effects on Na{sup +} and Cl¯ channels and the Na{sup +},K{sup +},2Cl¯-cotransporter were evaluated using amiloride (apical), 5-nitro-2-[(3-phenylpropyl)amino]benzoic acid (NPPB, apical), and bumetanide (basolateral), respectively. MMA-SS (0.0167–16.7 μg/cm{sup 2}) increased basal V{sub t}. Only 16.7 μg/cm{sup 2} GMA-MS increased basal V{sub t} significantly. MMA-SS or GMA-MS exposure potentiated I{sub sc} responses (decreases) to amiloride and bumetanide, while not affecting those to NPPB, GMA-MS to a lesser degree than MMA-SS. Variable effects on R{sub t} were observed in response to amiloride, and bumetanide. Generally, MMA-SS was more potent in altering responses to amiloride and bumetanide than GMA-MS. Hyperpolarization occurred in the absence of LDH release, but decreases in V{sub t}, R{sub t}, and I{sub sc} at higher fume particulate doses accompanied LDH release, to a greater extent for MMA-SS. Thus, Na{sup +} transport and Na{sup +},K{sup +},2Cl¯-cotransport are affected by fume exposure; MMA-MS is more potent than GMA-MS. Enhanced Na{sup +} absorption and decreased airway surface liquid could compromise defenses against infection. - Highlights: • Welding fume particle toxicity was investigated in human bronchial

  18. Determinación de la profundidad de curado y propiedades mecánicas de composites dentales fotopolimerizables experimentales

    OpenAIRE

    Veranes-Pantoja, Yaimarilis; Autran-Mateu, Fernando; Álvarez-Brito, Rubén; Gil-Mur, Francisco Javier

    2005-01-01

    En el presente trabajo se estudian la resistencia a la compresión, módulo en compresión, resistencia a la compresión diametral, dureza, desgaste y profundidad de curado de seis formulaciones de composites dentales fotopolimerizables. Los composites fueron preparados usando como matrices combinaciones de Bis-GMA/DMATEEG, Bis-GMA/MPS, Bis-GMA/DMATEEG/MPS. Como relleno se utilizó cuarzo del yacimiento "El Cacahual" y la combinación de cuarzo/aerosil 200. La resina VenusTM Heraus Kulzer fue utili...

  19. Cockle Field Caging Experiment Data (2014)

    Data.gov (United States)

    U.S. Environmental Protection Agency — To determine whether differences in cockle density or qualitative burial depth observed during the 2014 field survey were affected by green macroalgal (GMA) mats, we...

  20. Het belang van krimp en krimpspanning: effecten tijdens de verharding van composieten

    NARCIS (Netherlands)

    Kleverlaan, C.J.; Jongsma, L.A.

    2015-01-01

    De basis van de meeste tandheelkundige composieten bestaat uit monomeren zoals bisfenol-A diglycidylether methacrylaat (Bis-GMA) en tri-ethyleenglycoldimethacrylaat (TEGDMA), gecombineerd met vuldeeltjes van verschillende grootte en samenstelling. Tijdens het verharden met de lamp worden de

  1. GLYCOL METHACRYLATE EMBEDDING OF ALGINATE-POLYLYSINE MICROENCAPSULATED PANCREATIC-ISLETS

    NARCIS (Netherlands)

    FRITSCHY, WM; GERRITS, PO; WOLTERS, GHJ; PASMA, A; VANSCHILFGAARDE, R

    A method for processing and embedding alginate-polylysine microencapsulated pancreatic tissue in glycol methacrylate resin (GMA) is described. Fixation in 4% phosphate buffered formaldehyde, processing in ascending concentrations of glycol methacrylate monomer and embedding in Technovit 7100 results

  2. 聚合物微球固载的N-羟基邻苯二甲酰亚胺在分子氧氧化苯甲醇反应过程中的催化特性%Catalytic characteristics of N-hydroxyphthalimide immobilized on polymer microspheres in oxidation of benzyl alcohol by molecular oxygen

    Institute of Scientific and Technical Information of China (English)

    杨晓林; 黄建龙; 高保娇; 门吉英

    2015-01-01

    以甲基丙烯酸缩水甘油酯(GMA)和甲基丙烯酸甲酯(MMA)的交联共聚微球 GMA/MMA 为基质,经过几步大分子反应在微球表面合成与固载了 N-羟基邻苯二甲酰亚胺(NHPI),形成固载有 NHPI 的聚合物微球GMA/MMA-NHPI。将 GMA/MMA-NHPI 与 Co(OAc)2组成共催化体系,用于分子氧氧化苯甲醇的反应过程。研究结果表明,GMA/MMA-NHPI与Co(OAc)2所构成的共催化体系在温和条件(65℃和常压氧气)下可有效地实现苯甲醇的分子氧氧化过程,将其深度氧化为苯甲酸,显示出较好的催化活性和高的选择性(苯甲酸的选择性为96%)。主催化剂GMA/MMA-NHPI固载的NHPI与助催化剂Co(OAc)2适宜的摩尔比为20:1;主催化剂所含NHPI的摩尔分数为底物的10%时催化剂的用量比较适宜。固体催化剂GMA/MMA-NHPI还具有良好的再循环使用性能。%Crosslinked polymeric microspheres GMA/MMA of glycidyl methacrylate (GMA) and methyl methacrylate (MMA) were prepared, and then N-hydroxyphthalimide (NHPI) was synthesized and immobilized on GMA/MMA microspheres through several polymer reaction steps, resulting in the functionalized microspheres GMA/MMA-NHPI. The solid catalyst GMA/MMA-NHPI in combination with Co(OAc)2 was used in aerobic oxidation of benzyl alcohol. Experimental results showed that the composite catalyst consisting of GMA/MMA-NHPI and Co(OAc)2 could effectively catalyze aerobic oxidation of benzyl alcohol by molecular oxygen under mild conditions (65℃ and normal pressure). Benzyl alcohol was deeply oxidized to benzoic acid. Although benzyl alcohol conversion rate was not very high, catalytic activity was satisfactory and benzoic acid selectivity was as high as 96%. The appropriate molar ratio of immobilized NHPI on GMA/MMA-NHPI microspheres to Co(OAc)2 was 20:1, and the appropriate amount of GMA/MMA-NHPI was 10% (mol) of the substrate. The solid catalyst GMA/MMA-NHPI microspheres showed good recycling and reusing

  3. Research of Jiles-Atherton Dynamic Model in Giant Magnetostrictive Actuator

    Directory of Open Access Journals (Sweden)

    Yongguang Liu

    2016-01-01

    Full Text Available Due to the existence of multicoupled nonlinear factors in the giant magnetostrictive actuator (GMA, building precise mathematical model is highly important to study GMA’s characteristics and control strategies. Minor hysteresis loops near the bias magnetic field would be often applied because of its relatively good linearity. Load, friction, and disc spring stiffness seriously affect the output characteristics of the GMA in high frequency. Therefore, the current-displacement dynamic minor loops mathematical model coupling of electric-magnetic-machine is established according to Jiles-Atherton (J-A dynamic model of hysteresis material, GMA structural dynamic equation, Ampere loop circuit law, and nonlinear piezomagnetic equation and demonstrates its correctness and effectiveness in the experiments. Finally, some laws are achieved between key structural parameters and output characteristics of GMA, which provides important theoretical foundation for structural design.

  4. Cockle/Green Macroalgae Field Survey Data (2014)

    Data.gov (United States)

    U.S. Environmental Protection Agency — To quantify any spatial or temporal variability in cockle densities with respect to in situ GMA biomass in Yaquina Bay, OR, we conducted field surveys during...

  5. A Computer Program to Model Passive Acoustic Antisubmarine Search Using Monte Carlo Simulation Techniques.

    Science.gov (United States)

    1983-09-01

    duplicate a continuous function on a digital computer, and thus the machine representatic- of the GMA is only a close approximation of the continuous...error process. Thus, the manner in which the GMA process is digitally replicated has an effect on the results of the simulation. The parameterization of...Information Center 2 Cameron Station Alexandria, Virginia 22314 2. Libary , Code 0142 2 Naval Postgraduate School Monterey, California 93943 3. Professor

  6. Considering space weather forces interaction on human health: the equilibrium paradigm in clinical cosmobiology - is it equal?

    Science.gov (United States)

    Stoupel, Eliyahu

    2015-03-01

    We are constantly affected by changes in space weather. The principal "players" are solar activity (SA), geomagnetic activity (GMA) and antagonistic to them, cosmic ray activity (CRA) and high energy proton flux. CRA is measured by neutron activity on the earth's surface in imp/min. SA and GMA are linked and serve as a shield for the earth from CRA. For a long time SA and GMA were the main areas of studies. The aim of this study was to compare some effects of the mentioned forces and discuss the temporal distribution of both groups of space weather, in relation to their effects on humans. The time distribution of GMA storms (daily) was compared with quiet (low) GMA, with higher CRA (neutron activity). Space weather data were obtained from the USA, Russia and Finland. A total of 4383 days were analyzed in the years 2000-2012. A total of 71 days (1.62%) of geomagnetic storms (GS) and 2753 days (63.8%) of quiet (I0) GMA were registered. A second study was provided including the years 1983-2007 (9131 days); here 3800 days (41.62%) were quiet GMA days and 400 storm days (4.38%). According to publications in the medical literature, many phenomena are connected with the extremes of space weather. Despite a great number of publications and the significant role of GS, it is a relatively rare event and most medical emergencies and deaths occur on days of low GMA, accompanied by higher CRA (neutron activity). High neutron activity deserves more attention when analyzing space effects on human health and their mechanism of action.

  7. A meta-analysis of the relationship between general mental ability and nontask performance.

    Science.gov (United States)

    Gonzalez-Mulé, Erik; Mount, Michael K; Oh, In-Sue

    2014-11-01

    Although one of the most well-established research findings in industrial-organizational psychology is that general mental ability (GMA) is a strong and generalizable predictor of job performance, this meta-analytically derived conclusion is based largely on measures of task or overall performance. The primary purpose of this study is to address a void in the research literature by conducting a meta-analysis to determine the direction and magnitude of the correlation of GMA with 2 dimensions of nontask performance: counterproductive work behaviors (CWB) and organizational citizenship behaviors (OCB). Overall, the results show that the true-score correlation between GMA and CWB is essentially 0 (-.02, k = 35), although rating source of CWB moderates this relationship. The true-score correlation between GMA and OCB is positive but modest in magnitude (.23, k = 43). The 2nd purpose of this study is to conduct meta-analytic relative weight analyses to determine the relative importance of GMA and the five-factor model (FFM) of personality traits in predicting nontask and task performance criteria. Results indicate that, collectively, the FFM traits are substantially more important for CWB than GMA, that the FFM traits are roughly equal in importance to GMA for OCB, and that GMA is substantially more important for task and overall job performance than the FFM traits. Implications of these findings for the development of optimal selection systems and the development of comprehensive theories of job performance are discussed along with study limitation and future research directions. (PsycINFO Database Record (c) 2014 APA, all rights reserved).

  8. Corrosion Behavior of Arc Weld and Friction Stir Weld in Al 6061-T6 Alloys

    International Nuclear Information System (INIS)

    Yoon, Byoung Hyun; Kim, Heung Ju; Chang, Woong Seong; Kweon, Young Gak

    2006-01-01

    For the evaluation of corrosion resistance of Al 6061-T6 Alloy, Tafel method and immersion test was performed with Friction Stir Weld(FSW) and Gas Metal Arc Weld(GMAW). The Tafel and immersion test results indicated that GMA weld was severely attacked compared with those of friction stir weld. It may be mainly due to the galvanic corrosion mechanism act on the GMA weld

  9. Influence of Glycidyl Methacrylate Grafting on the Mechanical, Water Absorption, and Thermal Properties of Recycled High-Density Polyethylene/Rubber Seed Shell Particle Composites

    Directory of Open Access Journals (Sweden)

    Kaimeng Xu

    2016-01-01

    Full Text Available Rubber seed shell (RSS was modified by grafting treatment using glycidyl methacrylate (GMA at various concentrations. The RSS was then used to reinforce high-density polyethylene (HDPE. The effects of modification on the mechanical, water absorption, and thermal properties of the RSS/HDPE composites were studied using a mechanical testing instrument, weighing method, Vicat softening temperature (VST testing, thermogravimetry, and dynamic mechanical analysis. The results showed that the GMA grafting produced an improvement in the flexural and tensile properties of the composites. The water absorption rate of the composites also had an obvious decrease. While a slight increase in VST was found, the various concentrations of GMA showed no improvement in VST. GMA modification also could elevate the thermal stability of the composites at the initial decomposition stage. The optimum grafting concentration of GMA (2.5% led to the lowest thermal weight loss (37.07% and 26.56% during the first and second decomposition stages. The E’ values of the composites had a significant increase with the addition of GMA. There were two peaks of tan δ for the untreated samples, but the modified samples exhibited a shift in the transition peak at higher temperatures; moreover, the second peak disappeared.

  10. A Theory of Sex Differences in Technical Aptitude and Some Supporting Evidence.

    Science.gov (United States)

    Schmidt, Frank L

    2011-11-01

    In this article, I present a theory that explains the origin of sex differences in technical aptitudes. The theory takes as proven that there are no sex differences in general mental ability (GMA), and it postulates that sex differences in technical aptitude (TA) stem from differences in experience in technical areas, which is in turn based on sex differences in technical interests. Using a large data set, I tested and found support for four predictions made by this theory: (a) the construct level correlation between technical aptitude and GMA is larger for females than males, (b) the observed and true score variability of technical aptitude is greater among males than females, (c) at every level of GMA females have lower levels of technical aptitude, and (d) technical aptitude measures used as estimates of GMA for decision purposes would result in underestimation of GMA levels for girls and women. Given that GMA carries the weight of prediction of job performance, the support found for this last prediction suggests that, for many jobs, technical aptitude tests may underpredict the job performance of female applicants and employees. Future research should examine this question. © Association for Psychological Science 2011.

  11. Serum galactomannan screening for diagnosis of invasive pulmonary aspergillosis in children after stem cell transplantation or with high-risk leukemia.

    Science.gov (United States)

    Gefen, Aharon; Zaidman, Irina; Shachor-Meyouhas, Yael; Avidor, Israela; Hakim, Fahed; Weyl Ben-Arush, Myriam; Kassis, Imad

    2015-03-01

    Both transplanted and leukemia patients are at high risk (HR) for invasive pulmonary aspergillosis (IPA). Methods for rapid diagnosis are crucial. Our objective was to investigate the impact of serial serum galactomannan assay (GMA) screening on IPA diagnosis in children. Between January 2010 and December 2011, all children following stem cell transplantation (SCT) or with HR leukemia were prospectively included. Serum samples for GMA were taken once-twice weekly. Results >.5 were considered positive. Patients suspected of having IPA were stratified as possible, probable, and definite. Forty-six children (median age, 8 years) were included, 38 after SCT (32 allogeneic), 8 with HR leukemia. A total of 510 samples were taken; screening period was 1-6 months for 34 patients. GMA was negative in 28 patients, all but one without suspicion of IPA. Eighteen patients had positive GMA: while four (22%) were upgraded to probable IPA, fourteen (78%) were considered as false positives (FP), some associated with piperacillin-tazobactam treatment. GMA sensitivity and specificity were 0.8 and 0.66, respectively; positive- and negative-predictive values (PPV, NPV) were 0.22 and 0.96, respectively. GMA may have a role in evaluating HR children for IPA. Both NPV and FP rates are high. The cost benefit of early detection versus over-diagnosis should be further studied.

  12. Modification of flax fibres by radiation induced emulsion graft copolymerization of glycidyl methacrylate

    International Nuclear Information System (INIS)

    Moawia, Rihab Musaad; Nasef, Mohamed Mahmoud; Mohamed, Nor Hasimah; Ripin, Adnan

    2016-01-01

    Flax fibres were modified by radiation induced graft copolymerization of glycidyl methacrylate (GMA) by pre-irradiation method in an emulsion medium. The effect of reaction parameters on the degree of grafting (DOG) such as concentration of bleaching agent, absorbed dose, monomer concentration, temperature and reaction time were investigated. The DOG was found to be dependent on the investigated parameters. The incorporation of poly(GMA) grafts in the bleached flax fibres was confirmed by Fourier transform infrared spectroscopy (FTIR) and scanning electron microscopy (SEM). The structural and mechanical changes were evaluated by X-ray diffraction (XRD) and mechanical tester, respectively. The results revealed that reacting bleached flax fibres irradiated with 20 kGy with 5% GMA emulsion containing 0.5% polyoxyethylene-sorbitan monolaurate (Tween 20) surfactant at 40 °C for 1 h led to a maximum DOG of 148%. The grafted fibres showed sufficient mechanical strength and hydrophobicity which make them promising precursors for development of adsorbents after appropriate chemical treatments. - Highlights: • Flax fibers were modified by radiation induced emulsion grafting of GMA. • Bleaching with 0.7 wt% Na-chlorite was essential for achieving high DOGs. • Effect of reaction parameters on the degree of grafting were established. • The incorporation of poly-GMA grafts was proved by SEM, FTIR and XRD. • The obtained poly-GMA grafted flax fibers have potential for adsorbent making.

  13. Incorporation of metal-organic framework HKUST-1 into porous polymer monolithic capillary columns to enhance the chromatographic separation of small molecules.

    Science.gov (United States)

    Yang, Shengchao; Ye, Fanggui; Lv, Qinghui; Zhang, Cong; Shen, Shufen; Zhao, Shulin

    2014-09-19

    Metal-organic framework (MOF) HKUST-1 nanoparticles have been incorporated into poly(glycidyl methacrylate-co-ethylene dimethacrylate) (HKUST-1-poly(GMA-co-EDMA)) monoliths to afford stationary phases with enhanced chromatographic performance of small molecules in the reversed phase capillary liquid chromatography. The effect of HKUST-1 nanoparticles in the polymerization mixture on the performance of the monolithic column was explored in detail. While the bare poly(GMA-co-EDMA) monolith exhibited poor resolution (RsHKUST-1 nanoparticles to the polymerization mixture provide high increased resolution (Rs≥1.3) and high efficiency ranged from 16,300 to 44,300plates/m. Chromatographic performance of HKUST-1-poly(GMA-co-EDMA) monolith was demonstrated by separation of various analytes including polycyclic aromatic hydrocarbons, ethylbenzene and styrene, phenols and aromatic acids using a binary polar mobile phase (CH3CN/H2O). The HKUST-1-poly(GMA-co-EDMA) monolith displayed enhanced hydrophobic and π-π interaction characteristics in the reversed phase separation of test analytes compared to the bare poly(GMA-co-EDMA) monolith. The experiment results showed that HKUST-1-poly(GMA-co-EDMA) monoliths are an alternative to enhance the chromatographic separation of small molecules. Copyright © 2014 Elsevier B.V. All rights reserved.

  14. Obtaining information ultra-fast as-built in areas of high radiation to support decisions in maintenance; Obtencion ultra-rapida de informacion AS-BUILT en zonas de alta radiacion para el apoyo a la toma de decisiones en operaciones de mantenimiento

    Energy Technology Data Exchange (ETDEWEB)

    Sarti Fernandez, F.

    2010-07-01

    One of the problems that arise when studying, planning and assessing a particular maintenance operation has to be performed in high radiation areas, is the determination of the level of reliability of information starting from the one available. For the past several years have been used in nuclear power plants worldwide acquisition systems called 3D laser scanner models.

  15. Test programme `Solgaarden`, Kolding. 1. Solar cell system located in an urban renewal district. 2. Prefabricated, built-in elevators for an older, occupied block of flats; Forsoegsprogram Solgaarden, Kolding. 1. Solcelleanlaeg i et byfornyelsesomraade. 2. Praefabrikerede elevatorer til indbygning i en beboet aeldre etageejendom

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-07-01

    The aim was to promote the use of photovoltaic power systems in Denmark by setting up such a system for preliminary performance testing in a district undergoing urban renewal in the Danish town of Kolding in Jutland. This area, and the renewal initiatives taken, are described in addition to the photovoltaic units positioned on the roof and on the balconies of an older apartment building in the area. The brief descriptive texts are illustrated with a considerable number of diagrams and photographs. (AB)

  16. Space weather and human deaths distribution: 25 years' observation (Lithuania, 1989-2013).

    Science.gov (United States)

    Stoupel, Eliyahu G; Petrauskiene, Jadvyga; Kalediene, Ramune; Sauliune, Skirmante; Abramson, Evgeny; Shochat, Tzippy

    2015-09-01

    Human health is affected by space weather component [solar (SA), geomagnetic (GMA), cosmic ray (CRA) - neutrons, space proton flux] activity levels. The aim of this study was to check possible links between timing of human (both genders) monthly deaths distribution and space weather activity. Human deaths distribution in the Republic of Lithuania from 1989 to 2013 (25 years, i.e., 300 consecutive months) was studied, which included 1,050,503 deaths (549,764 male, 500,739 female). Pearson correlation coefficients (r) and their probabilities (p) were obtained for years: months 1-12, sunspot number, smoothed sunspot number, solar flux (2800 MGH, 10.7 cm), adjusted solar flux for SA; A, C indices of GMA; neutron activity at the earth's surface (imp/min) for CRA. The cosmophysical data were obtained from space science institutions in the USA, Russia and Finland. The mentioned physical parameters were compared with the total number of deaths, deaths from ischemic heart disease (n=376,074), stroke (n=132,020), non-cardiovascular causes (n=542,409), accidents (n=98,805), traffic accidents (n=21,261), oncology (n=193,017), diabetes mellitus (n=6631) and suicide (n=33,072). Space factors were interrelated as follows for the considered period: CRA was inversely related to SA and GMA, CRA/SA (r=-0.86, p>0.0001), CRA/GMA (r=-0.70, pweather component activity. Extreme levels of activities of both groups (SA, GMA, and opposite CRA - neutron) are related to some health risks. In the considered period, there were relatively few GMA storms and low GMA was dominating, accompanied by higher CRA (neutron) activity. The ways of action of the components of space weather on the human body need additional studies. There is a special need for the prevention of rising cerebral vascular accidents and oncology malignancies as the causes of death.

  17. Altered ion transport in normal human bronchial epithelial cells following exposure to chemically distinct metal welding fume particles.

    Science.gov (United States)

    Fedan, Jeffrey S; Thompson, Janet A; Meighan, Terence G; Zeidler-Erdely, Patti C; Antonini, James M

    2017-07-01

    Welding fume inhalation causes pulmonary toxicity, including susceptibility to infection. We hypothesized that airway epithelial ion transport is a target of fume toxicity, and investigated the effects of fume particulates from manual metal arc-stainless steel (MMA-SS) and gas metal arc-mild steel (GMA-MS) on ion transport in normal human bronchial epithelium (NHBE) cultured in air-interface. MMA-SS particles, more soluble than GMA-MS particles, contain Cr, Ni, Fe and Mn; GMA-MS particles contain Fe and Mn. MMA-SS or GMA-MS particles (0.0167-166.7μg/cm 2 ) were applied apically to NHBEs. After 18h transepithelial potential difference (V t ), resistance (R t ), and short circuit current (I sc ) were measured. Particle effects on Na + and Cl¯ channels and the Na + ,K + ,2Cl¯-cotransporter were evaluated using amiloride (apical), 5-nitro-2-[(3-phenylpropyl)amino]benzoic acid (NPPB, apical), and bumetanide (basolateral), respectively. MMA-SS (0.0167-16.7μg/cm 2 ) increased basal V t . Only 16.7μg/cm 2 GMA-MS increased basal V t significantly. MMA-SS or GMA-MS exposure potentiated I sc responses (decreases) to amiloride and bumetanide, while not affecting those to NPPB, GMA-MS to a lesser degree than MMA-SS. Variable effects on R t were observed in response to amiloride, and bumetanide. Generally, MMA-SS was more potent in altering responses to amiloride and bumetanide than GMA-MS. Hyperpolarization occurred in the absence of LDH release, but decreases in V t , R t , and I sc at higher fume particulate doses accompanied LDH release, to a greater extent for MMA-SS. Thus, Na + transport and Na + ,K + ,2Cl¯-cotransport are affected by fume exposure; MMA-MS is more potent than GMA-MS. Enhanced Na + absorption and decreased airway surface liquid could compromise defenses against infection. Published by Elsevier Inc.

  18. γ-Glutamylmethylamide Is an Essential Intermediate in the Metabolism of Methylamine by Methylocella silvestris▿

    Science.gov (United States)

    Chen, Yin; Scanlan, Julie; Song, Lijiang; Crombie, Andrew; Rahman, M. Tanvir; Schäfer, Hendrik; Murrell, J. Colin

    2010-01-01

    Methylocella silvestris BL2, a facultative methane utilizer, can grow on monomethylamine (MMA) as a sole carbon and nitrogen source. No activity of MMA dehydrogenase was detectable. Instead, this bacterium utilizes a methylated amino acid pathway (γ-glutamylmethylamide [GMA] and N-methylglutamate [NMG]) for MMA metabolism. The activities of the two key enzymes in this pathway, GMA synthetase and NMG dehydrogenase, were found when the bacterium was grown on MMA. GMA was detected by high-performance liquid chromatography-mass spectrometry only when the bacterium was grown on MMA but not when it was grown on methanol. Proteomic analysis of soluble and membrane fractions of the proteome from MMA- and methanol-grown cultures revealed that an eight-gene cluster (Msil2632 to Msil2639) was induced by MMA and cotranscribed as an operon, as shown by reverse transcription-PCR. GMA-dissimilating enzyme activity was also detected when it was grown on MMA. Formaldehyde and ammonium production from GMA was dependent on glutamate but not on α-ketoglutarate. Marker exchange mutagenesis of a putative GMAS gene homologue (gmas, Msil2635) within this eight-gene cluster, with a kanamycin gene cassette, abolished growth of M. silvestris on MMA as either a sole carbon or a sole nitrogen source. Overall, our results suggest that gmas is essential in MMA metabolism by M. silvestris. PMID:20472738

  19. {gamma}-Glutamylmethylamide is an essential intermediate in the metabolism of methylamine by Methylocella silvestris.

    Science.gov (United States)

    Chen, Yin; Scanlan, Julie; Song, Lijiang; Crombie, Andrew; Rahman, M Tanvir; Schäfer, Hendrik; Murrell, J Colin

    2010-07-01

    Methylocella silvestris BL2, a facultative methane utilizer, can grow on monomethylamine (MMA) as a sole carbon and nitrogen source. No activity of MMA dehydrogenase was detectable. Instead, this bacterium utilizes a methylated amino acid pathway (gamma-glutamylmethylamide [GMA] and N-methylglutamate [NMG]) for MMA metabolism. The activities of the two key enzymes in this pathway, GMA synthetase and NMG dehydrogenase, were found when the bacterium was grown on MMA. GMA was detected by high-performance liquid chromatography-mass spectrometry only when the bacterium was grown on MMA but not when it was grown on methanol. Proteomic analysis of soluble and membrane fractions of the proteome from MMA- and methanol-grown cultures revealed that an eight-gene cluster (Msil2632 to Msil2639) was induced by MMA and cotranscribed as an operon, as shown by reverse transcription-PCR. GMA-dissimilating enzyme activity was also detected when it was grown on MMA. Formaldehyde and ammonium production from GMA was dependent on glutamate but not on alpha-ketoglutarate. Marker exchange mutagenesis of a putative GMAS gene homologue (gmas, Msil2635) within this eight-gene cluster, with a kanamycin gene cassette, abolished growth of M. silvestris on MMA as either a sole carbon or a sole nitrogen source. Overall, our results suggest that gmas is essential in MMA metabolism by M. silvestris.

  20. The influence of individual and team cognitive ability on operators' task and safety performance: a multilevel field study in nuclear power plants.

    Directory of Open Access Journals (Sweden)

    Jingyu Zhang

    Full Text Available While much research has investigated the predictors of operators' performance such as personality, attitudes and motivation in high-risk industries, its cognitive antecedents and boundary conditions have not been fully investigated. Based on a multilevel investigation of 312 nuclear power plant main control room operators from 50 shift teams, the present study investigated how general mental ability (GMA at both individual and team level can influence task and safety performance. At the individual level, operators' GMA was predictive of their task and safety performance and this trend became more significant as they accumulated more experience. At the team level, we found team GMA had positive influences on all three performance criteria. However, we also found a "big-fish-little-pond" effect insofar as team GMA had a relatively smaller effect and inhibited the contribution of individual GMA to workers' extra-role behaviors (safety participation compared to its clear beneficial influence on in-role behaviors (task performance and safety compliance. The possible mechanisms related to learning and social comparison processes are discussed.

  1. The influence of individual and team cognitive ability on operators' task and safety performance: a multilevel field study in nuclear power plants.

    Science.gov (United States)

    Zhang, Jingyu; Li, Yongjuan; Wu, Changxu

    2013-01-01

    While much research has investigated the predictors of operators' performance such as personality, attitudes and motivation in high-risk industries, its cognitive antecedents and boundary conditions have not been fully investigated. Based on a multilevel investigation of 312 nuclear power plant main control room operators from 50 shift teams, the present study investigated how general mental ability (GMA) at both individual and team level can influence task and safety performance. At the individual level, operators' GMA was predictive of their task and safety performance and this trend became more significant as they accumulated more experience. At the team level, we found team GMA had positive influences on all three performance criteria. However, we also found a "big-fish-little-pond" effect insofar as team GMA had a relatively smaller effect and inhibited the contribution of individual GMA to workers' extra-role behaviors (safety participation) compared to its clear beneficial influence on in-role behaviors (task performance and safety compliance). The possible mechanisms related to learning and social comparison processes are discussed.

  2. Iminodiacetic acid functionalised organopolymer monoliths: application to the separation of metal cations by capillary high-performance chelation ion chromatography.

    Science.gov (United States)

    Moyna, Áine; Connolly, Damian; Nesterenko, Ekaterina; Nesterenko, Pavel N; Paull, Brett

    2013-03-01

    Lauryl methacrylate-co-ethylene dimethacrylate monoliths were polymerised within fused silica capillaries and subsequently photo-grafted with varying amounts of glycidyl methacrylate (GMA). The grafted monoliths were then further modified with iminodiacetic acid (IDA), resulting in a range of chelating ion-exchange monoliths of increasing capacity. The IDA functional groups were attached via ring opening of the epoxy group on the poly(GMA) structure. Increasing the amount of attached poly(GMA), via photo-grafting with increasing concentrations of GMA, from 15 to 35%, resulted in a proportional and controlled increase in the complexation capacity of the chelating monoliths. Scanning capacitively coupled contactless conductivity detection (sC(4)D) was used to characterise and verify homogenous distribution of the chelating ligand along the length of the capillaries non-invasively. Chelation ion chromatographic separations of selected transition and heavy metals were carried out, with retention factor data proportional to the concentration of grafted poly(GMA). Average peak efficiencies of close to 5,000 N/m were achieved, with the isocratic separation of Na, Mg(II), Mn(II), Co(II), Cd(II) and Zn(II) possible on a 250-mm-long monolith. Multiple monolithic columns produced to the same recipes gave RSD data for retention factors of ions). The monolithic chelating ion-exchanger was applied to the separation of alkaline earth and transition metal ions spiked in natural and potable waters.

  3. Computer-based video analysis identifies infants with absence of fidgety movements.

    Science.gov (United States)

    Støen, Ragnhild; Songstad, Nils Thomas; Silberg, Inger Elisabeth; Fjørtoft, Toril; Jensenius, Alexander Refsum; Adde, Lars

    2017-10-01

    BackgroundAbsence of fidgety movements (FMs) at 3 months' corrected age is a strong predictor of cerebral palsy (CP) in high-risk infants. This study evaluates the association between computer-based video analysis and the temporal organization of FMs assessed with the General Movement Assessment (GMA).MethodsInfants were eligible for this prospective cohort study if referred to a high-risk follow-up program in a participating hospital. Video recordings taken at 10-15 weeks post term age were used for GMA and computer-based analysis. The variation of the spatial center of motion, derived from differences between subsequent video frames, was used for quantitative analysis.ResultsOf 241 recordings from 150 infants, 48 (24.1%) were classified with absence of FMs or sporadic FMs using the GMA. The variation of the spatial center of motion (C SD ) during a recording was significantly lower in infants with normal (0.320; 95% confidence interval (CI) 0.309, 0.330) vs. absence of or sporadic (0.380; 95% CI 0.361, 0.398) FMs (P<0.001). A triage model with C SD thresholds chosen for sensitivity of 90% and specificity of 80% gave a 40% referral rate for GMA.ConclusionQuantitative video analysis during the FMs' period can be used to triage infants at high risk of CP to early intervention or observational GMA.

  4. Syntheses of amine-type adsorbents with emulsion graft polymerization of glycidyl methacrylate

    International Nuclear Information System (INIS)

    Seko, N.; Bang, L.T.; Tamada, M.

    2007-01-01

    Glycidyl methacrylate (GMA) which was precursor monomer for the synthesis of metal ion adsorbent was emulsified by surfactant of Tween 20 (Tw-20). The emulsion of 5% GMA in the water was stable for 48 h at Tw-20 concentration of 0.5%. Graft polymerization of GMA on polyethylene fiber was carried out in the emulsion state at various pre-irradiation doses. Degree of grafting (Dg) reached 103%, 301% and 348% for 1 h grafting at 40 deg. C with pre-irradiation of 10, 30 and 40 kGy, respectively. But the Dg was depressed when the pre-irradiation dose was over 50 kGy since cross-linking occurred simultaneously in the trunk polymer. Dg decreased with increment of Tw-20 concentration in emulsion of 5% GMA at pre-irradiation of 40 kGy. The three kinds of amine-type adsorbents were synthesized by reacting diethylenetriamine (DETA), triethylenetetramine (TETA) and ethylenediamine (EDA) with GMA-grafted polyethylene fiber. The synthesized EDA-type adsorbent had the highest selectivity against U ion and the distribution coefficient was 2.0 x 10 6

  5. Supertoughened renewable PLA reactive multiphase blends system: phase morphology and performance.

    Science.gov (United States)

    Zhang, Kunyu; Nagarajan, Vidhya; Misra, Manjusri; Mohanty, Amar K

    2014-08-13

    Multiphase blends of poly(lactic acid) (PLA), ethylene-methyl acrylate-glycidyl methacrylate (EMA-GMA) terpolymer, and a series of renewable poly(ether-b-amide) elastomeric copolymer (PEBA) were fabricated through reactive melt blending in an effort to improve the toughness of the PLA. Supertoughened PLA blend showing impact strength of ∼500 J/m with partial break impact behavior was achieved at an optimized blending ratio of 70 wt % PLA, 20 wt % EMA-GMA, and 10 wt % PEBA. Miscibility and thermal behavior of the binary blends PLA/PEBA and PLA/EMA-GMA, and the multiphase blends were also investigated through differential scanning calorimetric (DSC) and dynamic mechanical analysis (DMA). Phase morphology and fracture surface morphology of the blends were studied through scanning electron microscopy (SEM) and atomic force microscopy (AFM) to understand the strong corelation between the morphology and its significant effect on imparting tremendous improvement in toughness. A unique "multiple stacked structure" with partial encapsulation of EMA-GMA and PEBA minor phases was observed for the PLA/EMA-GMA/PEBA (70/20/10) revealing the importance of particular blend composition in enhancing the toughness. Toughening mechanism behind the supertoughened PLA blends have been established by studying the impact fractured surface morphology at different zones of fracture. Synergistic effect of good interfacial adhesion and interfacial cavitations followed by massive shear yielding of the matrix was believed to contribute to the enormous toughening effect observed in these multiphase blends.

  6. Mechano-responsive hydrogels crosslinked by reactive block copolymer micelles

    Science.gov (United States)

    Xiao, Longxi

    Hydrogels are crosslinked polymeric networks that can swell in water without dissolution. Owing to their structural similarity to the native extracelluar matrices, hydrogels have been widely used in biomedical applications. Synthetic hydrogels have been designed to respond to various stimuli, but mechanical signals have not incorporated into hydrogel matrices. Because most tissues in the body are subjected to various types of mechanical forces, and cells within these tissues have sophisticated mechano-transduction machinery, this thesis is focused on developing hydrogel materials with built-in mechano-sensing mechanisms for use as tissue engineering scaffolds or drug release devices. Self-assembled block copolymer micelles (BCMs) with reactive handles were employed as the nanoscopic crosslinkers for the construction of covalently crosslinked networks. BCMs were assembled from amphiphilic diblock copolymers of poly(n-butyl acrylate) and poly(acrylic acid) partially modified with acrylate. Radical polymerization of acrylamide in the presence of micellar crosslinkers gave rise to elastomeric hydrogels whose mechanical properties can be tuned by varying the BCM composition and concentration. TEM imaging revealed that the covalently integrated BCMs underwent strain-dependent reversible deformation. A model hydrophobic drug, pyrene, loaded into the core of BCMs prior to the hydrogel formation, was dynamically released in response to externally applied mechanical forces, through force-induced reversible micelle deformation and the penetration of water molecules into the micelle core. The mechano-responsive hydrogel has been studied for tissue repair and regeneration purposes. Glycidyl methacrylate (GMA)-modified hyaluronic acid (HA) was photochemically crosslinked in the presence of dexamethasone (DEX)-loaded crosslinkable BCMs. The resultant HA gels (HAxBCM) contain covalently integrated micellar compartments with DEX being sequestered in the hydrophobic core. Compared

  7. Thin-film type Li-ion battery, using a polyethylene separator grafted with glycidyl methacrylate

    International Nuclear Information System (INIS)

    Ko, J.M.; Min, B.G.; Kim, D.-W.; Ryu, K.S.; Kim, K.M.; Lee, Y.G.; Chang, S.H.

    2004-01-01

    For the improvement of organic electrolyte holding ability, the hydrophobic surface of a porous polyethylene (PE)-membrane separator was modified by grafting a hydrophilic monomer, glycidyl methacrylate (GMA), PE-g-GMA, by using electron beam technology, and applied to a thin film type Li-ion battery to elucidate the effect of a surface modification of a PE membrane separator on the cyclic life of Li-ion batteries. The Li-ion battery using the PE-g-GMA membrane separator showed a better cycle life than that of the unmodified PE membrane separator, indicating that the surface hydrophilicity of the PE membrane separator improved the electrolyte holding capability between the electrodes in the Li-ion cell and prevented the electrolyte leakage

  8. Bias Magnetic Field of Stack Giant Magnetostrictive Actuator: Design, Analysis, and Optimization

    Directory of Open Access Journals (Sweden)

    Zhaoshu Yang

    2016-01-01

    Full Text Available Many novel applications using giant magnetostrictive actuators (GMA require their actuators output bidirectional strokes to be large enough to drive the load. In these cases, the sophisticated method to form such a sufficient bias field with minimum power and bulk consumption should be considered in the principal stage of GMA design. This paper concerns the methodology of bias field design for a specific GMA with stack PMs and GMMs (SGMA: both loop and field models for its bias field are established; the optimization method for given SGMA structure is outlined; a prototype is fabricated to verify the theory. Simulation and test results indicate that the bias field could be exerted more easily using SGMA structure; the modeling and optimization methodology for SGMA is valid in practical design.

  9. Efficacy and safety of granulocyte, monocyte/macrophage adsorptive in pediatric ulcerative colitis

    DEFF Research Database (Denmark)

    Ruuska, Tarja; Küster, Peter; Grahnquist, Lena

    2016-01-01

    AIM: To investigate efficacy and safety for granulocyte, monocyte apheresis in a population of pediatric patients with ulcerative colitis. METHODS: The ADAPT study was a prospective, open-label, multicenter study in pediatric patients with moderate, active ulcerative colitis with pediatric...... ulcerative colitis activity index (PUCAI) of 35-64. Patients received one weekly apheresis with Adacolumn(®) granulocyte, monocyte/macrophage adsorptive (GMA) apheresis over 5 consecutive weeks, optionally followed by up to 3 additional apheresis treatments over 3 consecutive weeks. The primary endpoint...... mg daily on average from Baseline to week 12. CONCLUSION: Adacolumn(®) GMA apheresis treatment was effective in pediatric patients with moderate active Ulcerative Colitis. No new safety signals were reported. The present data contribute to considering GMA apheresis as a therapeutic option...

  10. Study on grafting glycidyl methacrylate onto HDPE membranes by pre-irradiation graft copolymerization

    International Nuclear Information System (INIS)

    Tong Long; Zu Jianhua; Liu Xinwen; Sun Guisheng; Yu Chunhui

    2006-01-01

    Glycidyl methacrylate (GMA) was grafted onto HDPE membranes by pre-irradiation method with 1.8 MeV E-beam and a kind of membranes having reactive epoxy groups was successfully synthesized. Effects of monomer concentration, reaction temperature and time and irradiation dose on the grafting yield were studied. Composition, thermo-property and surface morphology of the grafted membranes were studied by FTIR, DSC and Tapping-mode AFM, respectively. The FTIR measurements proved the synthesized copolymer is HDPE-g-GMA. The DSC results indicated the grafted HDPE's melting temperature (T m ) and heat of fusion (ΔH f ( HDPE) ) which was reduced with increasing grafting yield. The AFM images indicated that surface of the HDPE-g-GMA membranes was rougher than the virgin HDPE. (authors)

  11. AFM study of the morphologic change of HDPE surface photografted with glycidyl methacrylate.

    Science.gov (United States)

    Wang, Huiliang; Han, Jianmei

    2009-05-01

    The UV-induced grafting of glycidyl methacrylate (GMA) onto high-density polyethylene (HDPE) and the atomic force microscopy (AFM) study of the morphologic change of the grafted surface are reported. The grafting was carried out in GMA acetone solutions with different monomer concentrations. Grafting was much faster in a solution with a higher monomer concentration. FTIR analyses proved that GMA had been successfully grafted onto HDPE. The morphologies of grafted HDPE surfaces changed with UV irradiation time. The monomer concentration had a significant effect on the morphologies of the grafted HDPE surfaces. The HDPE surface grafted in a solution with a higher monomer concentration was much rougher than that grafted in a solution with a lower monomer concentration. The growth models of the grafted granules or clusters are also proposed.

  12. Effect of compatibilizer on impact and morphological analysis of recycled HDPE/PET blends

    Energy Technology Data Exchange (ETDEWEB)

    Salleh, Mohd Nazry [School of Applied Physics, Faculty of Science and Technology, Universiti Kebangsaan Malaysia, 43600 Bangi, Selangor, Malaysia and School of Materials Engineering, Universiti Malaysia Perlis, 02600 Jejawi, Perlis (Malaysia); Ahmad, Sahrim; Ghani, Mohd Hafizuddin Ab; Chen, Ruey Shan [School of Applied Physics, Faculty of Science and Technology, Universiti Kebangsaan Malaysia, 43600 Bangi, Selangor (Malaysia)

    2013-11-27

    Blends based on recycled high density polyethylene (rHDPE) and recycled polyethylene terephthalate (rPET) were prepared using a corotating twin screw extruder. PET and HDPE are incompatible polymers and their blends showed poor properties. Compatibilization is a step to obtain blends with good mechanical properties and in this work, ethylene glycidyl methacrylate copolymer (E-GMA) was used as a compatibilizing agent. The effect of blends based on rHDPE and rPET with and without a compatibilizer, E-GMA were examined. From the studies clearly showed that the addition of 5% E-GMA increased the impact strength. SEM analysis of rHDPE/rPET blends confirmed the morphological interaction and improved interfacial bonding between two phases.

  13. Motor-Driven Giant Magnetostrictive Actuator

    DEFF Research Database (Denmark)

    Zhang, Lihui; Xia, Yongming; Lu, Kaiyuan

    2015-01-01

    A typical giant magnetostrictive actuator (GMA) expands a magnetostrictive rod to generate strain by varying the current in the coil that surrounds the magnetostrictive rod. The heat generated by the current deteriorates the GMA performance. In particular, a constant current in the coil is required....... The magnetic field in the iron-gallium alloy (Galfenol), which is a type of magnetostrictive material, is periodically altered by rotating the permanent magnets instead of varying the coil current in the traditional GMA. The proposed MDGMA not only achieves continuous adjustment of the output strain, but can...... also maintain a constant output strain without consuming any power. In addition, the coil-free design releases the new MDGMA from the heat generated by the excitation coil, which allows the MDGMA to work more stably....

  14. Bisphenol A in dental sealants and its estrogen like effect

    Directory of Open Access Journals (Sweden)

    Manu Rathee

    2012-01-01

    Full Text Available Bisphenol A or BPA-based epoxy resins are widely used in the manufacture of commercial products, including dental resins, polycarbonate plastics, and the inner coating of food cans. BPA is a precursor to the resin monomer Bis-GMA. During the manufacturing process of Bis-GMA dental sealants, Bisphenol A (BPA might be present as an impurity or as a degradation product of Bis-DMA through esterases present in saliva. Leaching of these monomers from resins can occur during the initial setting period and in conjunction with fluid sorption and desorption over time and this chemical leach from dental sealants may be bioactive. Researchers found an estrogenic effect with BPA, Bis-DMA, and Bis-GMA because BPA lacks structural specificity as a natural ligand to the estrogen receptor. It generated considerable concern regarding the safety of dental resin materials. This review focuses on the BPA in dental sealants and its estrogen-like effect.

  15. Inhalation of gas metal arc-stainless steel welding fume promotes lung tumorigenesis in A/J mice.

    Science.gov (United States)

    Falcone, Lauryn M; Erdely, Aaron; Meighan, Terence G; Battelli, Lori A; Salmen, Rebecca; McKinney, Walter; Stone, Samuel; Cumpston, Amy; Cumpston, Jared; Andrews, Ronnee N; Kashon, Michael; Antonini, James M; Zeidler-Erdely, Patti C

    2017-08-01

    Epidemiologic studies suggest an increased risk of lung cancer with exposure to welding fumes, but controlled animal studies are needed to support this association. Oropharyngeal aspiration of collected "aged" gas metal arc-stainless steel (GMA-SS) welding fume has been shown by our laboratory to promote lung tumor formation in vivo using a two-stage initiation-promotion model. Our objective in this study was to determine whether inhalation of freshly generated GMA-SS welding fume also acts as a lung tumor promoter in lung tumor-susceptible mice. Male A/J mice received intraperitoneal (IP) injections of corn oil or the chemical initiator 3-methylcholanthrene (MCA; 10 µg/g) and 1 week later were exposed by whole-body inhalation to air or GMA-SS welding aerosols for 4 h/d × 4 d/w × 9 w at a target concentration of 40 mg/m 3 . Lung nodules were enumerated at 30 weeks post-initiation. GMA-SS fume significantly promoted lung tumor multiplicity in A/J mice initiated with MCA (16.11 ± 1.18) compared to MCA/air-exposed mice (7.93 ± 0.82). Histopathological analysis found that the increased number of lung nodules in the MCA/GMA-SS group were hyperplasias and adenomas, which was consistent with developing lung tumorigenesis. Metal deposition analysis in the lung revealed a lower deposited dose, approximately fivefold compared to our previous aspiration study, still elicited a significant lung tumorigenic response. In conclusion, this study demonstrates that inhaling GMA-SS welding fume promotes lung tumorigenesis in vivo which is consistent with the epidemiologic studies that show welders may be at an increased risk for lung cancer.

  16. Rheological and mechanical properties of polyamide 6 modified by electron-beam initiated mediation process

    International Nuclear Information System (INIS)

    Shin, Boo Young; Kim, Jae Hong

    2015-01-01

    Polyamide (PA6) has been modified by electron-beam initiated mediator process to improve drawbacks of PA6. Glycidyl methacrylate (GMA) was chosen as a reactive mediator for modification process of PA6. The mixture of the PA6 and GMA was prepared by using a twin-screw extruder, and then the mixture was exposed to electron-beam irradiation at various doses at room temperature. The modified PA6 were characterized by observing rheological and mechanical properties and compared virgin PA6. Thermal properties, water absorption, and gel fraction were also investigated. Tight gel was not found even when PA6 was irradiated at 200 kGy. Complex viscosity and storage modulus of PA6 were remarkably increased by electron-beam irradiation with medium of GMA. Maximum increase in complex viscosity was 75 times higher than virgin PA6 at 0.1 rad/s when it was irradiated at 200 kGy with the GMA. Mechanical properties were also improved without scarifying of processability. The reaction mechanisms for the mediation process with the reactive mediator of GMA were estimated to elucidate the cause of significantly enhanced rheological and mechanical properties without loss of thermoplasticity. - Highlights: • PA6 was modified by the electron-beam initiated mediation process. • Maximum increase in complex viscosity of modified PA6 was 75 times higher than virgin PA6 at 0.1 rad/s. • Mechanical properties were improved without scarifying of processability. • The GMA as a mediator played a key role in the electron-beam initiated mediation process

  17. Fibrous polymer grafted magnetic chitosan beads with strong poly(cation-exchange) groups for single step purification of lysozyme.

    Science.gov (United States)

    Bayramoglu, Gulay; Tekinay, Turgay; Ozalp, V Cengiz; Arica, M Yakup

    2015-05-15

    Lysozyme is an important polypetide used in medical and food applications. We report a novel magnetic strong cation exchange beads for efficient purification of lysozyme from chicken egg white. Magnetic chitosan (MCHT) beads were synthesized via phase inversion method, and then grafted with poly(glycidyl methacrylate) (p(GMA)) via the surface-initiated atom transfer radical polymerization (SI-ATRP). Epoxy groups of the grafted polymer, were modified into strong cation-exchange groups (i.e., sulfonate groups) in the presence of sodium sulfite. The MCTH and MCTH-g-p(GMA)-SO3H beads were characterized by ATR-FTIR, SEM, and VSM. The sulphonate groups content of the modified MCTH-g-p(GMA)-4 beads was found to be 0.53mmolg(-1) of beads by the potentiometric titration method. The MCTH-g-p(GMA)-SO3H beads were first used as an ion-exchange support for adsorption of lysozyme from aqueous solution. The influence of different experimental parameters such as pH, contact time, and temperature on the adsorption process was evaluated. The maximum adsorption capacity was found to be 208.7mgg(-1) beads. Adsorption of lysozyme on the MCTH-g-p(GMA)-SO3H beads fitted to Langmuir isotherm model and followed the pseudo second-order kinetic. More than 93% of the adsorbed lysozyme was desorbed using Na2CO3 solution (pH 11.0). The purity of the lysozyme was checked by HPLC and SDS gel electrophoresis. In addition, the MCTH-g-p(GMA)-SO3H beads prepared in this work showed promising potential for separation of various anionic molecules. Copyright © 2015 Elsevier B.V. All rights reserved.

  18. Addition of Granulocyte/Monocyte Apheresis to Oral Prednisone for Steroid-dependent Ulcerative Colitis: A Randomized Multicentre Clinical Trial.

    Science.gov (United States)

    Domènech, Eugeni; Panés, Julián; Hinojosa, Joaquín; Annese, Vito; Magro, Fernando; Sturniolo, Giacomo Carlo; Bossa, Fabrizio; Fernández, Francisco; González-Conde, Benito; García-Sánchez, Valle; Dignass, Axel; Herrera, José Manuel; Cabriada, José Luis; Guardiola, Jordi; Vecchi, Maurizio; Portela, Francisco; Ginard, Daniel

    2018-05-25

    Steroid-dependency occurs in up to 30% of patients with ulcerative colitis [UC]. In this setting, few drugs have demonstrated efficacy in inducing steroid-free remission. The aim of this study was to evaluate the efficacy and safety of adding granulocyte/monocyte apheresis [GMA] to oral prednisone in patients with steroid-dependent UC. This was a randomized, multicentre, open trial comparing 7 weekly sessions of GMA plus oral prednisone [40 mg/day and tapering] with prednisone alone, in patients with active, steroid-dependent UC [Mayo score 4-10 and inability to withdraw corticosteroids in 3 months or relapse within the first 3 months after discontinuation]. Patients were stratified by concomitant use of thiopurines at inclusion. A 9-week tapering schedule of prednisone was pre-established in both study groups. The primary endpoint was steroid-free remission [defined as a total Mayo score ≤2, with no subscore >1] at Week 24, with no re-introduction of corticosteroids. In all 123 patients were included [63 GMA group, 62 prednisone alone]. In the intention-to-treat analysis, steroid-free remission at Week 24 was achieved in 13% (95% confidence interval [CI] 6-24) in the GMA group and 7% [95% CI 2-16] in the control group [p = 0.11]. In the GMA group, time to relapse was significantly longer (hazard ratio [HR] 1.7 [1.16-2.48], P = 0.005) and steroid-related adverse events were significantly lower [6% vs 20%, P < 0.05]. In a randomized trial, the addition of 7 weekly sessions of GMA to a conventional course of oral prednisone did not increase the proportion of steroid-free remissions in patients with active steroid-dependent UC, though it delayed clinical relapse.

  19. Production of sorption-active polypropylene fibers by radiation-induced grafting of glycidyl methacrylate as a precursor monomer

    International Nuclear Information System (INIS)

    Bondar, Yu.V.; Kim, H.J.; Lim, Y.J.

    2006-01-01

    The design and development of sorption-active natural and synthetic polymer fibers and textile materials is of great scientific and practical interest. The advantages of that type of polymeric adsorbents, as their highly developed specific surface, excellent ion-exchange and adsorption parameters and ease of their use especially under continuous conditions, allow them to find a great application in the chemical, biomedical, ecological and industrial fields. To obtain functional polymer materials with the desired performance, the non-active polymer surface have to be modified. Among different innovative techniques used for the introduction of graft chains, the radiation-chemical method of initiation has some economical and ecological preferences over others. It allows to introduce into inert polymeric matrix chains of a monomer already containing a desirable functional group, or to graft chains of a precursor-monomer and subsequently its chemical modification to form required functional groups. At present an epoxy-group containing monomer, glycidyl methacrylate (GMA), is successfully used as a precursor-monomer for production of polymeric adsorbents of variety applications on the base of membranes, films, fibers and fabrics. Two types of sorption-active polypropylene fiber carrying strong-acid sulfonate groups and amino groups have been synthesized by radiation-induced graft polymerization of GMA, with subsequent chemical modification of the epoxy groups of poly-GMA graft chains. The effect of various polymerization parameters on the GMA grafting degree was investigated in detail. The epoxy ring-opening of poly-GMA graft chains with introduction of strong-acid sulfonate groups was carried out with sodium hydrogen sulfite in water-dimethylformamide solution at 70 deg C. The main peculiarities of the sulfonation reaction in depending on the reaction time and GMA grafting degree have been investigated. Amine groups were incorporated by treatment of the GMA

  20. A multidimensional continued fraction and some of its statistical properties

    International Nuclear Information System (INIS)

    Baldwin, P.R.

    1992-01-01

    The problem of simultaneously approximating a vector of irrational numbers with rationals is analyzed in a geometrical setting using notions of dynamical systems theory. The author discusses here a (vectorial) multidimensional continued-fraction algorithm (MCFA) of additive type, the generalized mediant algorithm (GMA), and gives a geometrical interpretation to it. He calculates the invariant measure of the GMA shift as well as its Kolmogorov-Sinai (KS) entropy for arbitrary number of irrationals. The KS entropy is related to the growth rate of denominators of the Euclidean algorithm. This is the first analytical calculation of the growth rate of denominators for any MCFA

  1. Study and Optimization on graft polymerization under normal pressure and air atmospheric conditions, and its application to metal adsorbent

    Science.gov (United States)

    Ueki, Yuji; Chandra Dafader, Nirmal; Hoshina, Hiroyuki; Seko, Noriaki; Tamada, Masao

    2012-07-01

    Radiation-induced graft polymerization of glycidyl methacrylate (GMA) onto non-woven polyethylene (NWPE) fabric was achieved under normal pressure and air atmospheric conditions, without using unique apparatus such as glass ampoules or vacuum lines. To attain graft polymerization under normal pressure and air atmospheric conditions, the effects of the pre-irradiation dose, pre-irradiation atmosphere, pre-irradiation temperature, de-aeration of GMA-emulsion, grafting atmosphere in a reactor, and dissolved oxygen (DO) concentration in GMA-emulsion on the degree of grafting (Dg) were investigated in detail. It was found that the DO concentration had the strongest influence, the pre-irradiation dose, de-aeration of emulsion and grafting atmosphere had a relatively strong impact, and the pre-irradiation atmosphere and pre-irradiation temperature had the least effect on Dg. The optimum DO concentration before grafting was 2.0 mg/L or less. When a polyethylene bottle was used as a reactor instead of a glass ampoule, graft polymerization under normal pressure and air atmospheric conditions could be achieved under the following conditions; the pre-irradiation dose was more than 50 kGy, the volume ratio of GMA-emulsion to air was 50:1 or less, and the DO concentration in GMA-emulsion during grafting was below 2.0 mg/L. Under these grafting conditions, Dg was controlled within a range of up to 362%. The prepared GMA-grafted NWPE (GMA-g-NWPE) fabric was modified with a phosphoric acid to obtain an adsorbent for heavy metal ions. In the column-mode adsorption tests of Pb(II), the adsorption performance of the produced phosphorylated GMA-g-NWPE fabric (fibrous metal adsorbent) was not essentially dependent on the flow rate of the feed. The breakthrough points of 200, 500, and 1000 h-1 in space velocity were 483, 477 and 462 bed volumes, and the breakthrough capacities of the three flow rates were 1.16, 1.15 and 1.16 mmol-Pb(II)/g-adsorbent.

  2. Composite resin as an implant material in bone. Histologic, radiologic, microradiologic and oxytetracycline fluorescence examination of rats

    Energy Technology Data Exchange (ETDEWEB)

    Vainio, J; Rokkanen, P [Tampere Univ. (Finland). Inst. of Clinical Sciences; Central Hospital, Tampere (Finland))

    1978-01-01

    The potential of a bis-GMA composite resin as implant material in bone is evaluated. The material is claimed to have mechanical and physical properties superior to those of the bone cements used today. A groove made in the cortex of the tibia in 18 rats was filled with bis-GMA, while a similar was left empty in the contralateral tibia. The reaction of the bone to this material was evaluated by histologic, radiologic, microradiograph and OTC-fluorescence methods. The material was well tolerated by the bone; after 1,3 and 6 weeks no reaction to the material was observed.

  3. New CO2 adsorbent containing aminated poly(glycidyl methacrylate) grafted onto irradiated PE-PP nonwoven sheet

    Science.gov (United States)

    Mahmoud Nasef, Mohamed; Abbasi, Ali; Ting, T. M.

    2014-10-01

    A new CO2 adsorbent containing triethylamine (TEA) was prepared by radiation induced grafting of glycidyl methacrylate (GMA) onto polyethylene coated polypropylene (PE-PP) non-woven sheet followed by amination reaction. The degree of grafting (DOG%) was controlled by variation of monomer concentration and absorbed dose. The incorporation of aminated poly(GMA) was investigated by Fourier transform infrared (FTIR) and scanning electron microscope (SEM). The adsorbent with DOG of 350% and amination yield of 60% exhibited CO2 adsorption capacity of 4.52 mol/kg at ambient temperature and pressure.

  4. The distribution of nanoclay particles at the interface and their influence on the microstructure development and rheological properties of reactively processed biodegradable polylactide/poly(butylene succinate) blend nanocomposites

    CSIR Research Space (South Africa)

    Salehiyan, Reza

    2017-08-01

    Full Text Available . Nonlinear coefficient from FT-rheology was found to be more pronounced in case of blends filled with C30B, indicating better dispersion of C30B compare with BET which was in agreement with the SAXS results. Keywords: reactively compatibilized clay... reduced significantly upon C30B addition. Kumar et al. [11] found that Cloisite®20A (C20A) can intercalate and exfoliate into the PLA/PBAT matrices when GMA was used; which indicates that GMA can facilitate the exfoliation of clay particles into the blend...

  5. Adherence to the Food and Agricultural Organization guidelines on trypanocide usage among cattle farmers in Itezhi tezhi, Central Zambia.

    Science.gov (United States)

    Mbewe, Njelembo J; Sitali, Lungowe; Namangala, Boniface; Michelo, Charles

    2015-04-15

    Trypanocides will continue to play an important role in the control of tsetse fly transmitted trypanosomosis now and in the near future. The drugs are mostly administered by farmers without any veterinary supervision leading to misuse and under dosing of medication, and these could be factors that promote trypanocidal drug resistance (TDR) development. In order to delay or prevent TDR, the Food and Agriculture Organization (FAO) recommended guidelines on trypanocide use. It is not known if these recommended guidelines are adhered to in Itezhi tezhi district of Zambia. A survey was undertaken to examine how socio-economic and environmental factors were associated with adherence to the recommended guidelines on trypanocide use in Itezhi tezhi, Central Zambia. Ninety farmers who use trypanocides were interviewed using a questionnaire to collect their socio-economic characteristics (age, education in years, cattle herd size, competence on trypanocide use and their access to extension on trypanocide use) and trypanocide usage practices while crush pens which they use were stratified according to location, whether in the Game Management Area (GMA) (Mutenda, Itumbi, Kapulwe and Banachoongo) or non-GMA (Iyanda, New Ngoma and Shinampamba) as an environmental factor. Associations and measures of associations to adherence of FAO guidelines were determined. The results showed that 25.6% of the farmers adhered to guidelines by FAO on trypanocide use and that none of the socio-economic factors under investigation were significantly associated with it. Further the farmers that used crush pens that were in the GMA had an 80% reduction in the likelihood of adhering to the FAO guidelines on trypanocide use than those that used crush pens in the non-GMA (AOR 0.20, 95% CI: 0.05-0.81, P=0.02). There was low adherence to the recommended FAO guidelines on trypanocide use and it was associated with the location of the crush pen whether in the GMA or not, as an environmental factor. With

  6. Growth of MCF-7 breast cancer cells and efficacy of anti-angiogenic agents in a hydroxyethyl chitosan/glycidyl methacrylate hydrogel.

    Science.gov (United States)

    Wang, Hejing; Qian, Junmin; Zhang, Yaping; Xu, Weijun; Xiao, Juxiang; Suo, Aili

    2017-01-01

    Breast cancer negatively affects women's health worldwide. The tumour microenvironment plays a critical role in tumour initiation, proliferation, and metastasis. Cancer cells are traditionally grown in two-dimensional (2D) cultures as monolayers on a flat solid surface lacking cell-cell and cell-matrix interactions. These experimental conditions deviate from the clinical situation. Improved experimental systems that can mimic the in vivo situation are required to discover new therapies, particularly for anti-angiogenic agents that mainly target intercellular factors and play an essential role in treating some cancers. Chitosan can be modified to construct three-dimensional (3D) tumour models. Here, we report an in vitro 3D tumour model using a hydroxyethyl chitosan/glycidyl methacrylate (HECS-GMA) hydrogel produced by a series of chitosan modifications. Parameters relating to cell morphology, viability, proliferation, and migration were analysed using breast cancer MCF-7 cells. In a xenograft model, secretion of angiogenesis-related growth factors and the anti-angiogenic efficacy of Endostar and Bevacizumab in cells grown in HECS-GMA hydrogels were assessed by immunohistochemistry. Hydroxyethyl chitosan/glycidyl methacrylate hydrogels had a highly porous microstructure, mechanical properties, swelling ratio, and morphology consistent with a 3D tumour model. Compared with a 2D monolayer culture, breast cancer MCF-7 cells residing in the HECS-GMA hydrogels grew as tumour-like clusters in a 3D formation. In a xenograft model, MCF-7 cells cultured in the HECS-GMA hydrogels had increased secretion of angiogenesis-related growth factors. Recombinant human endostatin (Endostar), but not Bevacizumab (Avastin), was an effective anti-angiogenic agent in HECS-GMA hydrogels. The HECS-GMA hydrogel provided a 3D tumour model that mimicked the in vivo cancer microenvironment and supported the growth of MCF7 cells better than traditional tissue culture plates. The HECS-GMA

  7. Narrow groove gas metal-arc welding of aluminum

    International Nuclear Information System (INIS)

    Armstrong, R.E.

    1975-01-01

    The Gas Metal-Arc (GMA) welding process is explained and the equipment used described with an analysis of power supply function and the action of the arc, followed by discussion of general applications and problems. GMA braze welding of beryllium is then described, as is the development of a special high purity filler wire and a narrow deep groove joint design for improved weld strength in beryllium. This joint design and the special wire are applied in making high strength welds in high strength aluminum for special applications. High speed motion pictures of the welding operation are shown to illustrate the talk. (auth)

  8. Comparative Profiling of microRNA Expression in Soybean Seeds from Genetically Modified Plants and their Near-Isogenic Parental Lines

    Science.gov (United States)

    Wang, Yong; Lan, Qingkuo; Zhao, Xin; Xu, Wentao; Li, Feiwu; Wang, Qinying; Chen, Rui

    2016-01-01

    MicroRNAs (miRNAs) have been widely demonstrated to play fundamental roles in gene regulation in most eukaryotes. To date, there has been no study describing the miRNA composition in genetically modified organisms (GMOs). In this study, small RNAs from dry seeds of two GM soybean lines and their parental cultivars were investigated using deep sequencing technology and bioinformatic approaches. As a result, several differentially expressed gma-miRNAs were found between the GM and non-GM soybeans. Meanwhile, more differentially expressed gma-miRNAs were identified between distantly relatednon-GM soybeans, indicating that the miRNA components of soybean seeds varied among different soybean lines, including the GM and non-GM soybeans, and the extent of difference might be related to their genetic relationship. Additionally, fourteen novel gma-miRNA candidates were predicted in soybean seeds including a potential bidirectionally transcribed miRNA family with two genomic loci (gma-miR-N1). Our findings firstly provided useful data for miRNA composition in edible GM crops and also provided valuable information for soybean miRNA research. PMID:27214227

  9. Preparation and Performance of Amphiphilic Random Copolymer Noncovalently Modified MWCNTs/Epoxy Composite

    Directory of Open Access Journals (Sweden)

    MA Qiang

    2016-09-01

    Full Text Available An amphiphilic random copolymer of polyglycidyl methacrylate-co-N-vinyl carbazole P(GMA-co-NVC was synthesized by free radical polymerization and was used to noncovalently modify multi-walled carbon nanotubes (MWCNTs. The obtained P(GMA-co-NVC/MWCNTs was mixed with epoxy resin and used to reinforce epoxy resin. Polymer modified carbon nanotubes/epoxy resin composites were prepared by a casting molding method. Tensile test, electrical resistivity test and differential scanning calorimeter(DSC analysis were used to study the effect of polymer modified carbon nanotubes on the mechanical, electrical, and thermal properties of epoxy resin. The results show that the epoxy composite reinforced with P(GMA-co-NVC/MWCNTs shows a remarkable enhancement in both tensile strength and elongation at break compared to either the pure epoxy or the pristine MWCNTs/epoxy composites. In addition, the electrical conductivity of epoxy is significantly improved and the volume resistivity decreases from 1014Ω·m to 106Ω·m with 0.25% mass fraction loading of P(GMA-co-NVC/MWCNTs. Moreover, glass transition temperature of the epoxy composite also increases from 144℃ to 149℃.

  10. In vivo genotoxicity assessment of acrylamide and glycidyl methacrylate.

    Science.gov (United States)

    Dobrovolsky, Vasily N; Pacheco-Martinez, M Monserrat; McDaniel, L Patrice; Pearce, Mason G; Ding, Wei

    2016-01-01

    Acrylamide (ACR) and glycidyl methacrylate (GMA) are structurally related compounds used for making polymers with various properties. Both chemicals can be present in food either as a byproduct of processing or a constituent of packaging. We performed a comprehensive evaluation of ACR and GMA genotoxicity in Fisher 344 rats using repeated gavage administrations. Clastogenicity was measured by scoring micronucleated (MN) erythrocytes from peripheral blood, DNA damage in liver, bone marrow and kidneys was measured using the Comet assay, and gene mutation was measured using the red blood cell (RBC) and reticulocyte Pig-a assay. A limited histopathology evaluation was performed in order to determine levels of cytotoxicity. Doses of up to 20 mg/kg/day of ACR and up to 250 mg/kg/day of GMA were used. ACR treatment resulted in DNA damage in the liver, but not in the bone marrow. While ACR was not a clastogen, it was a weak (equivocal) mutagen in the cells of bone marrow. GMA caused DNA damage in the cells of bone marrow, liver and kidney, and induced MN reticulocytes and Pig-a mutant RBCs in a dose-dependent manner. Collectively, our data suggest that both compounds are in vivo genotoxins, but the genotoxicity of ACR is tissue specific. Published by Elsevier Ltd.

  11. Local Ecological Knowledge and Community- based Management ...

    African Journals Online (AJOL)

    knowledge has been used in the management of wildlife resources in the two areas. ... Union for Conservation of Nature (IUCN), the United Nations Environment ..... In general, it is believed that cutting down trees will disturb the pattern of rainfall. ... determine and monitor animal distribution in the Luangwa GMA and the ...

  12. pH-responsive diblock copolymers with two different fluorescent labels for simultaneous monitoring of micellar self-assembly and degree of protonation

    DEFF Research Database (Denmark)

    Madsen, Jeppe; Madden, George; Themistou, Efrosyni

    2018-01-01

    methacrylate [PyMA] is statistically copolymerized with glycerolmonomethacrylate (GMA) to introduce a suitable fluorescent label. The chain-ends of the PDPA block are labelled with cresylviolet perchlorate [CV] by exploiting the spin trap properties of this dye molecule. Below pH 6, fluorescence from both...

  13. Fusion Nodes: The Next Step in Combating the Global Terrorist Threat

    Science.gov (United States)

    2011-12-01

    Answer,” Organizational Dynamics, Winter 1979: 429. 151 Richard L. Daft , Organization Theory and Design, 9th Edition (Mason, OH: Thompson: South...Morning America, 9 June 2006. Accessed 29 September 2011, http://abcnews.go.com/GMA/Terrorism/story?id=2056386&page=1. Daft , Richard L

  14. Sense and sensibility: The role of cognitive and emotional intelligence in negotiation

    NARCIS (Netherlands)

    Schlegel, K.; Mehu, M.; Peer, J.M. van; Scherer, K.R.

    2018-01-01

    This study tested whether EI (conceptualized as a performance-based ability) predicted economic and relational outcomes in an employee-recruiter negotiation above general mental ability (GMA) and whether a novel measure of emotion recognition ability (ERA; a central component of EI) predicted these

  15. Synthesis of acrylic prepolymer

    International Nuclear Information System (INIS)

    Hussin bin Mohd Nor; Dahlan bin Haji Mohd; Mohamad Hilmi bin Mahmood.

    1988-04-01

    An acrylic prepolymer was synthesized from glycidyl methacrylate (GMA), butyl methacrylate (BMA), methyl methacrylate (MMA) and acrylic acid (AA). Butyl acetate (BAc), benzoyl peroxide (BzO), 4-methoxyphenol (MPh) and triethylamine (TEA) were used as solvent, initiator, inhibitor and catalyst respectively. Observations of the synthesis leading to the formation of acrylic prepolymer are described. (author)

  16. Southern images - RGP gmap | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available 01-003 Description of data contents Parents Southern hybridization image files. Data file File name: rgp_gma...p File size: 37.3 MB Simple search URL - Data acquisition method Southern hybridization... Data analysis method For genotype segregation in F2 plants, Southern hybridization was performed with

  17. Control of drug releasing from biodegradable polymer drug delivery system by gamma-ray irradiation

    International Nuclear Information System (INIS)

    Yoshioka, Sumie; Aso, Yukio; Kojima, Shigeo

    1999-01-01

    In order to introduce the drug to the target organ, we developed a gel to control the drug releasing velocity by response to change of temperature by means of γ-ray irradiation to gelatin-GMA modified dextran mixture aqueous solution. A certain level of molecular weight of drug is necessary. The response to the temperature (change of drug releasing velocity) was affected by the concentration of gelatin and the modification rate of GMA. The Higuchi equation was applied to the releasing of β-galactosidase from gelatin-dextran gel and the releasing velocity was calculated. The releasing velocity decreased with increasing GMA modification rate at 37degC and 15degC. The releasing velocity of β-galactosidase decreased with increasing the concentration of gelatin at 15degC, but the velocity increased with increasing the concentration at 37degC. These results indicated that the good drug releasing conditions are obtained by controlling the GMA modification rate and the concentration of gelatin. (S.Y.)

  18. Effect Sizes for Growth-Modeling Analysis for Controlled Clinical Trials in the Same Metric as for Classical Analysis

    Science.gov (United States)

    Feingold, Alan

    2009-01-01

    The use of growth-modeling analysis (GMA)--including hierarchical linear models, latent growth models, and general estimating equations--to evaluate interventions in psychology, psychiatry, and prevention science has grown rapidly over the last decade. However, an effect size associated with the difference between the trajectories of the…

  19. Comparison of implant cast accuracy of multiple implant impression technique with different splinting materials: An in vitro study

    Directory of Open Access Journals (Sweden)

    Sunantha Selvaraj

    2016-01-01

    Conclusion: The master cast obtained by both the splinting material exhibits no difference from the reference model. So bis-GMA can be used, which is easy to handle, less time consuming, less technique sensitive, rigid, and readily available material in clinics.

  20. Effects of feeding blends of grains naturally contaminated with Fusarium mycotoxins on performance and metabolism of laying hens.

    Science.gov (United States)

    Chowdhury, S R; Smith, T K

    2004-11-01

    An experiment was conducted to evaluate the effects of feeding laying hens grains naturally contaminated with a combination of Fusarium mycotoxins. Parameters measured included performance, organ weights, and plasma chemistry. One hundred and forty-four, 45-wk-old laying hens were fed diets including: (1) control, (2) contaminated grains, and (3) contaminated grains + 0.2% polymeric glucomannan mycotoxin adsorbent (GMA) for a 12-wk period. The feeding of contaminated grains decreased feed consumption compared with controls in the first 4 wk. Feed consumption increased, however, from 4 to 8 wk and from 8 to 12 wk. The efficiency of feed utilization (feed consumption/egg mass) decreased compared with controls in the periods from 4 to 8 and from 8 to 12 wk when birds were fed contaminated grains. Supplementation with GMA decreased feed consumption and increased the efficiency of feed utilization in the period from 8 to 12 wk. Egg production and egg mass decreased in wk 4 and 8 compared with controls when contaminated grains were fed, whereas egg and eggshell weights decreased in the fourth wk. Plasma uric acid concentrations increased throughout the experiment and relative kidney weights increased at the end of the experiment compared with controls when birds were fed contaminated grains. The feeding of GMA prevented the elevation in uric acid concentrations and relative kidney weights. It was concluded that layer performance and metabolism were adversely affected by chronic feeding of a combination of Fusarium mycotoxins, and that GMA prevented many of these effects.

  1. Influence of solar and geomagnetic activity in Gymnodinium catenatum (Dinophyceae) cultures.

    Science.gov (United States)

    Vale, Paulo

    2017-01-01

    Laboratory cultures of the paralytic shellfish poisoning producing microalga Gymnodinium catenatum were subjected to a hypo-osmotic shock and changes in cell concentration were observed in two separate experiments of 8 and 24 hours duration, respectively. The increase in geomagnetic activity (GMA), radio and X-ray fluxes and solar X-ray flares were negatively correlated with cell numbers. Cell losses were observed in the short experiment, but not in the longest one. GMA action was related to the course of the experimental period, while electromagnetic radiation (EMR) was only significantly related when the previous hours before the experiments were considered. The differential action windows might be indicative of two differential disruptive mechanisms: EMR might act on DNA synthesis and mitosis phases of the cell cycle (taking place in the dark period) and GMA might be more disruptive at the end of mytosis or cytokinesis phases taking place in the light period. Formation of long chains (> 4 cells/chain) was reduced with salinity and with temperatures above 27ºC but increased with EMR and GMA, particularly when grown at the highest temperatures recorded during the study period (≥28ºC).

  2. CRCHD Integrated Networks

    Science.gov (United States)

    INB supports two network-based programs—the National Outreach Network (NON) and the Geographic Management of Cancer Health Disparities Program (GMaP)—as well as advising on women’s health and sexual and gender minority opportunities within and across the NCI.

  3. Influence of compatibilizer and/or montmorillonite addition on the mechanical properties and morphology of PP/recycled PET blends

    International Nuclear Information System (INIS)

    Silva, Murilo S.; Souza, Adriana M.C.

    2011-01-01

    In this work, the mechanical properties and morphology PP/recycled PET blends with addition of P(E-co-MA-co-GMA) copolymer and/or montmorillonite clay (MMT) was investigated. The blends were obtained by extrusion and their morphology was observed by scanning electron microscopy. The mechanical properties were evaluated by tensile and impact tests. Thin films of nanocomposites were characterized by x-ray diffraction (XRD). The addition of P (E-co-MA-co-GMA) or MMT clay separately promoted a decrease of the dispersed phase size. XRD analysis indicated that there was incorporation of polymer in clay galleries. The addition of clay in PP / PET blend resulted in an increase of apparent elastic modulus, impact resistance and HDT and a decrease of tensile strength and elongation at break. The addition of P (E-co-MA-co-GMA) resulted in an increased impact strength and reduction of other properties. There were no significant changes on mechanical properties when the clay and P (E-co-MA-co-GMA) are added simultaneously. (author)

  4. Mass Atrocity Prevention and Response Options (MAPRO): A Policy Planning Handbook

    Science.gov (United States)

    2012-03-01

    human and associated with animals , insects, or infectious diseases. They may also be portrayed as a mortal enemy, a drain on or traitors to the na- tion...the hu- manity of victims, the cruelty of perpetrators, and the apathy of bystanders. They can call attention to 100 GMA situations in ways that may

  5. Liquid Metal Oscillation and Arc Behaviour during Welding

    NARCIS (Netherlands)

    Yudodibroto, B.Y.B.

    2010-01-01

    The purpose of this research is to obtain insight into the oscillation behaviour of the liquid metal and the arc behaviour during GMA welding. Observations of the weld pool and the arc were undertaken by visual means using a high-speed video and by analysis of the voltage. To deal with the complex

  6. Effects of feeding blends of grains naturally contaminated with Fusarium mycotoxins on small intestinal morphology of turkeys.

    Science.gov (United States)

    Girish, C K; Smith, T K

    2008-06-01

    An experiment was conducted to investigate the effects of feeding grains naturally contaminated with Fusarium mycotoxins on morphometric indices of duodenum, jejunum, and ileum in turkeys. The possible preventative effect of a polymeric glucomannan mycotoxin adsorbent (GMA) was also determined. Three hundred 1-d-old male turkey poults were fed wheat, corn, and soybean meal-based starter (0 to 3 wk), grower (4 to 6 wk), developer (7 to 9 wk), and finisher (10 to 12 wk) diets formulated with control grains, contaminated grains, and contaminated grains + 0.2% GMA. Morphometric indices were measured at the end of each growth phase and included villus height (VH), crypt depth, villus width, thicknesses of submucosa and muscularis, villus-to-crypt ratio, and apparent villus surface area (AVSA). At the end of the starter phase, feedborne mycotoxins significantly decreased the VH in the duodenum, and supplementation of the contaminated diet with GMA prevented this effect. The feeding of contaminated grains also reduced (P effects in jejunum and ileum. No effects of diets were seen on morphometric variables at the end of the developer and finisher phases. It was concluded that consumption of grains naturally contaminated with Fusarium mycotoxins results in adverse effects on intestinal morphology during early growth phases of turkeys, and GMA can prevent many of these effects.

  7. Effects of feedborne fusarium mycotoxins on brain regional neurochemistry of turkeys.

    Science.gov (United States)

    Girish, C K; MacDonald, E J; Scheinin, M; Smith, T K

    2008-07-01

    An experiment was conducted to investigate the effects of feeding grains naturally contaminated with Fusarium mycotoxins on brain regional neurochemistry of turkeys. The possible preventative effect of a poly-meric glucomannan mycotoxin adsorbent (GMA) was also determined. Forty-five 1-d-old male turkey poults were fed wheat-, corn-, and soybean meal-based diets up to wk 6, formulated with control grains, contaminated grains, or contaminated grains + 0.2% GMA. Deoxynivalenol was the major contaminant, and the concentrations were 2.2 and 3.3 mg/kg of feed during starter and grower phases, respectively. Concentrations of brain monoamine neurotransmitters and metabolites were measured in discrete regions of the brain including the pons, hypothalamus, and cortex by HPLC with electrochemical detection. Neurotransmitters and metabolites analyzed included norepinephrine, dopamine, 3,4-dihydroxyphenylacetic acid, serotonin (5-hydroxytryptamine, 5-HT), and 5-hydroxyindoleacetic acid (5-HIAA). The concentration of 5-HIAA and the 5-HIAA:5-HT-ratio were significantly decreased in pons after feeding contaminated grains. Dietary supplementation with GMA prevented these effects. In the pons, a significant positive correlation (r = 0.52, P effects on the concentrations of neurotransmitters and metabolites in hypothalamus and cortex. It was concluded that consumption of grains naturally contaminated with Fusarium mycotoxins adversely altered the pons serotonergic system of turkeys. Supplementation with GMA partially inhibited these effects.

  8. Comparative Profiling of microRNA Expression in Soybean Seeds from Genetically Modified Plants and their Near-Isogenic Parental Lines.

    Science.gov (United States)

    Wang, Yong; Lan, Qingkuo; Zhao, Xin; Xu, Wentao; Li, Feiwu; Wang, Qinying; Chen, Rui

    2016-01-01

    MicroRNAs (miRNAs) have been widely demonstrated to play fundamental roles in gene regulation in most eukaryotes. To date, there has been no study describing the miRNA composition in genetically modified organisms (GMOs). In this study, small RNAs from dry seeds of two GM soybean lines and their parental cultivars were investigated using deep sequencing technology and bioinformatic approaches. As a result, several differentially expressed gma-miRNAs were found between the GM and non-GM soybeans. Meanwhile, more differentially expressed gma-miRNAs were identified between distantly relatednon-GM soybeans, indicating that the miRNA components of soybean seeds varied among different soybean lines, including the GM and non-GM soybeans, and the extent of difference might be related to their genetic relationship. Additionally, fourteen novel gma-miRNA candidates were predicted in soybean seeds including a potential bidirectionally transcribed miRNA family with two genomic loci (gma-miR-N1). Our findings firstly provided useful data for miRNA composition in edible GM crops and also provided valuable information for soybean miRNA research.

  9. Predicting factors influencing crop raiding by elephants in the ...

    African Journals Online (AJOL)

    Nyirenda et al.

    By developing predictive models of binary logistic regression and employing questionnaire surveys, we .... Lupande Game Management Area (GMA), covering an area of 4 840 km2 constitutes the ...... Temporal trends in elephant ... the modern conservation paradigm: Can agricultural communities co- exist with elephant?

  10. Comparative Profiling of microRNA Expression in Soybean Seeds from Genetically Modified Plants and their Near-Isogenic Parental Lines.

    Directory of Open Access Journals (Sweden)

    Yong Wang

    Full Text Available MicroRNAs (miRNAs have been widely demonstrated to play fundamental roles in gene regulation in most eukaryotes. To date, there has been no study describing the miRNA composition in genetically modified organisms (GMOs. In this study, small RNAs from dry seeds of two GM soybean lines and their parental cultivars were investigated using deep sequencing technology and bioinformatic approaches. As a result, several differentially expressed gma-miRNAs were found between the GM and non-GM soybeans. Meanwhile, more differentially expressed gma-miRNAs were identified between distantly relatednon-GM soybeans, indicating that the miRNA components of soybean seeds varied among different soybean lines, including the GM and non-GM soybeans, and the extent of difference might be related to their genetic relationship. Additionally, fourteen novel gma-miRNA candidates were predicted in soybean seeds including a potential bidirectionally transcribed miRNA family with two genomic loci (gma-miR-N1. Our findings firstly provided useful data for miRNA composition in edible GM crops and also provided valuable information for soybean miRNA research.

  11. Synthesis, characterization and in vitro cytotoxicity analysis of a novel cellulose based drug carrier for the controlled delivery of 5-fluorouracil, an anticancer drug

    Science.gov (United States)

    Anirudhan, Thayyath S.; Nima, Jayachandran; Divya, Peethambaran L.

    2015-11-01

    The present investigation concerns the development and evaluation of a novel drug delivery system, aminated-glycidylmethacrylate grafted cellulose-grafted polymethacrylic acid-succinyl cyclodextrin (Cell-g-(GMA/en)-PMA-SCD) for the controlled release of 5-Fluorouracil, an anticancer drug. The prepared drug carrier was characterized by FT-IR, XRD and SEM techniques. Binding kinetics and isotherm studies of 5-FU onto Cell-g-(GMA/en)-PMA-SCD were found to follow pseudo-second-order and Langmuir model respectively. Maximum binding capacity of drug carrier was found to be 149.09 mg g-1 at 37 °C. Swelling studies, in vitro release kinetics, drug loading efficiency and encapsulation efficiency of Cell-g-(GMA/en)-PMA-SCD were studied. The release kinetics was analyzed using Ritger-Peppas equation at pH 7.4. Cytotoxicity analysis on MCF-7 (human breast carcinoma) cells indicated that the drug carrier shows sustained and controlled release of drug to the target site. Hence, it is evident from this investigation that Cell-g-(GMA/en)-PMA-SCD could be a promising carrier for 5-FU.

  12. Liquid‐to‐solid ratio control as an advanced process control solution for continuous twin‐screw wet granulation

    DEFF Research Database (Denmark)

    Nicolaï, Niels; Leersnyder, Fien De; Copot, Dana

    2018-01-01

    for the dynamic behavior of the granule liquid‐to‐solid ratio (w) at the end of the granulation unit of a commercial ConsiGmaTM‐25 production line. Near‐infrared spectroscopy was used to monitor the granule composition in‐line. The outcome for both the tracking and regulator problem using either conventional...

  13. Isolation of microbial DNA by newly designed magnetic particles

    Czech Academy of Sciences Publication Activity Database

    Rittich, B.; Španová, A.; Horák, Daniel; Beneš, Milan J.; Klesnilová, L.; Petrová, K.; Rybnikář, A.

    2006-01-01

    Roč. 52, č. 2 (2006), s. 143-148 ISSN 0927-7765 R&D Projects: GA ČR GA203/05/2256; GA MZe 1G57037 Institutional research plan: CEZ:AV0Z40500505 Keywords : magnetic particles * P(HEMA-co-GMA) * cobalt ferrite Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.789, year: 2006

  14. Adhesion of resin composites to biomaterials in dentistry : an evaluation of surface conditioning methods

    NARCIS (Netherlands)

    Özcan, Mutlu

    2003-01-01

    Since previous investigations revealed that most clinical failures in adhesively luted ceramic restorations initiate from the cementation or internal surfaces, the study presented in Chapter II evaluated the effect of three different surface conditioning methods on the bond strength of a Bis-GMA

  15. When Intelligence is (Dys)Functional for Achieving Sales Performance

    NARCIS (Netherlands)

    W.J.M.I. Verbeke (Willem); F.D. Belschak (Frank); A.B. Bakker (Arnold); H.M.S. Dietz (Bart)

    2008-01-01

    textabstractUsing two different samples of salespeople, the authors investigate how a combination of general mental ability (GMA) and specific skills and capabilities (social competence and thinking styles) allows salespeople to reach their sales goals. The study finds evidence for an interaction

  16. Studies of properties of rubber wood with impregnation of polymer

    Indian Academy of Sciences (India)

    Impregnation of rubber wood has been carried out under different conditions by using styrene as grafting monomer and glycidyl methacrylate (GMA) as crosslinker. Properties such as dimensional stability, water absorption, hardness, tensile strength, flexural strength, etc of the impregnated wood have been checked and ...

  17. Effect of Temperature on Granulocyte and Monocyte Adsorption to Cellulose Acetate Beads.

    Science.gov (United States)

    Nishise, Shoichi; Takeda, Yuji; Abe, Yasuhiko; Sasaki, Yu; Nara, Hidetoshi; Asao, Hironobu; Ueno, Yoshiyuki

    2017-06-01

    Granulocyte and monocyte (GM) adsorptive apheresis (GMA) is an effective therapy for inflammatory disorders including inflammatory bowel disease (IBD). During GMA, the blood of a patient with IBD passes through a column to contact cellulose acetate (CA) beads at a temperature below body temperature, likely close to room temperature. Here we investigated the effect of temperature on GM adsorption to CA beads in vitro. We incubated peripheral blood with and without CA beads at 5°C, 25°C, 37°C, and 43°C and calculated the ratios of adsorbed GMs. The ratios of adsorbed GMs increased as the temperature was raised. Additionally, we measured complement activation fragment concentrations. C3a and C5a concentrations also increased as the temperature was raised, and C5a concentrations had a positive correlation with the ratios of adsorbed GMs. These results suggest that warming the column during GMA might increase GM adsorption to CA beads, thereby enhancing the clinical efficacy of GMA. © 2017 International Society for Apheresis, Japanese Society for Apheresis, and Japanese Society for Dialysis Therapy.

  18. Tailored Training in Vehicle Maintenance Courses

    Science.gov (United States)

    2014-07-01

    1998) and that the predictive power of GMA often swamps that of specific (i.e., more narrow) tests ( Thorndike , 1985). 15...Command. Thorndike , R. L. (1985). The central role of general ability in prediction. Multivariate Behavioral Research, 20, 241-254. VanLehn, K

  19. Purification of yeast alcohol dehydrogenase by using immobilized metal affinity cryogels

    Energy Technology Data Exchange (ETDEWEB)

    Akduman, Begüm [Chemistry Department, Adnan Menderes University, Aydın (Turkey); Uygun, Murat [Koçarlı Vocational and Training School, Adnan Menderes University, Aydın (Turkey); Uygun, Deniz Aktaş, E-mail: daktas@adu.edu.tr [Chemistry Department, Adnan Menderes University, Aydın (Turkey); Akgöl, Sinan [Biochemistry Department, Ege University, İzmir (Turkey); Denizli, Adil [Chemistry Department, Hacettepe University, Ankara (Turkey)

    2013-12-01

    In this study, poly(2-hydroxyethyl methacrylate–glycidylmethacrylate) [poly(HEMA–GMA)] cryogels were prepared by radical cryocopolymerization of HEMA with GMA as a functional comonomer and N,N′-methylene-bisacrylamide (MBAAm) as a crosslinker. Iminodiacetic acid (IDA) functional groups were attached via ring opening of the epoxy group on the poly(HEMA–GMA) cryogels and then Zn(II) ions were chelated with these structures. Characterization of cryogels was performed by FTIR, SEM, EDX and swelling studies. These cryogels have interconnected pores of 30–50 μm size. The equilibrium swelling degree of Zn(II) chelated poly(HEMA–GMA)-IDA cryogels was approximately 600%. Zn(II) chelated poly(HEMA–GMA)-IDA cryogels were used in the adsorption of alcohol dehydrogenase from aqueous solutions and adsorption was performed in continuous system. The effects of pH, alcohol dehydrogenase concentration, temperature, and flow rate on adsorption were investigated. The maximum amount of alcohol dehydrogenase adsorption was determined to be 9.94 mg/g cryogel at 1.0 mg/mL alcohol dehydrogenase concentration and in acetate buffer at pH 5.0 with a flow rate of 0.5 mL/min. Desorption of adsorbed alcohol dehydrogenase was carried out by using 1.0 M NaCI at pH 8.0 phosphate buffer and desorption yield was found to be 93.5%. Additionally, these cryogels were used for purification of alcohol dehydrogenase from yeast with a single-step. The purity of desorbed alcohol dehydrogenase was shown by silver-stained SDS–PAGE. This purification process can successfully be used for the purification of alcohol dehydrogenase from unclarified yeast homogenates and this work is the first report about the usage of the cryogels for purification of alcohol dehydrogenase. - Highlights: • Poly(HEMA–GMA) cryogels were synthesized by radical cryocopolymerization technique. • Prepared cryogels were functionalized with IDA, then Zn(II) ions were chelated to the cryogel. • Zn(II) chelated poly(HEMA–GMA

  20. Purification of yeast alcohol dehydrogenase by using immobilized metal affinity cryogels

    International Nuclear Information System (INIS)

    Akduman, Begüm; Uygun, Murat; Uygun, Deniz Aktaş; Akgöl, Sinan; Denizli, Adil

    2013-01-01

    In this study, poly(2-hydroxyethyl methacrylate–glycidylmethacrylate) [poly(HEMA–GMA)] cryogels were prepared by radical cryocopolymerization of HEMA with GMA as a functional comonomer and N,N′-methylene-bisacrylamide (MBAAm) as a crosslinker. Iminodiacetic acid (IDA) functional groups were attached via ring opening of the epoxy group on the poly(HEMA–GMA) cryogels and then Zn(II) ions were chelated with these structures. Characterization of cryogels was performed by FTIR, SEM, EDX and swelling studies. These cryogels have interconnected pores of 30–50 μm size. The equilibrium swelling degree of Zn(II) chelated poly(HEMA–GMA)-IDA cryogels was approximately 600%. Zn(II) chelated poly(HEMA–GMA)-IDA cryogels were used in the adsorption of alcohol dehydrogenase from aqueous solutions and adsorption was performed in continuous system. The effects of pH, alcohol dehydrogenase concentration, temperature, and flow rate on adsorption were investigated. The maximum amount of alcohol dehydrogenase adsorption was determined to be 9.94 mg/g cryogel at 1.0 mg/mL alcohol dehydrogenase concentration and in acetate buffer at pH 5.0 with a flow rate of 0.5 mL/min. Desorption of adsorbed alcohol dehydrogenase was carried out by using 1.0 M NaCI at pH 8.0 phosphate buffer and desorption yield was found to be 93.5%. Additionally, these cryogels were used for purification of alcohol dehydrogenase from yeast with a single-step. The purity of desorbed alcohol dehydrogenase was shown by silver-stained SDS–PAGE. This purification process can successfully be used for the purification of alcohol dehydrogenase from unclarified yeast homogenates and this work is the first report about the usage of the cryogels for purification of alcohol dehydrogenase. - Highlights: • Poly(HEMA–GMA) cryogels were synthesized by radical cryocopolymerization technique. • Prepared cryogels were functionalized with IDA, then Zn(II) ions were chelated to the cryogel. • Zn(II) chelated poly(HEMA–GMA

  1. Cage and linear structured polysiloxane/epoxy hybrids for coatings: Surface property and film permeability.

    Science.gov (United States)

    Ma, Yanli; He, Ling; Jia, Mengjun; Zhao, Lingru; Zuo, Yanyan; Hu, Pingan

    2017-08-15

    Three polysiloxane/epoxy hybrids obtained by evolving cage- or linear-structured polysiloxane into poly glycidyl methacrylate (PGMA) matrix are compared used as coatings. One is the cage-structured hybrid of P(GMA/MA-POSS) copolymer obtained by GMA and methacrylisobutyl polyhedral oligomeric silsesquioxane (MA-POSS) via free radical polymerization, the other two are PGMA/NH 2 -POSS and PGMA/NH 2 -PDMS hybrids by cage-structured aminopropyllsobutyl POSS (NH 2 -POSS) or linear-structured diamino terminated poly(dimethylsiloxane) (NH 2 -PDMS) to cure PGMA. The effect of MA-POSS, NH 2 -POSS and NH 2 -PDMS on polysiloxane/epoxy hybrid films is characterized according to their surface morphology, transparency, permeability, adhesive strength and thermo-mechanical properties. Due to caged POSS tending to agglomerate onto the film surface, P(GMA/MA-POSS) and PGMA/NH 2 -POSS films exhibit much more heterogeneous surfaces than PGMA/NH 2 -PDMS film, but the well-compatibility between epoxy matrix and MA-POSS has provided P(GMA/MA-POSS) film with much higher transmittance (98%) than PGMA/NH 2 -POSS film (24%), PGMA/NH 2 -PDMS film (27%) and traditional epoxy resin film (5%). The introduction of polysiloxane into epoxy matrix is confirmed to create hybrids with strong adhesive strength (526-1113N) and high thermos-stability (T g =262-282°C), especially the cage-structured P(GMA/MA-POSS) hybrid (1113N and 282°C), but the flexible PDMS improves PGMA/NH 2 -PDMS hybrid with much higher storage modulus (519MPa) than PGMA/NH 2 -POSS (271MPa), which suggests that PDMS is advantage in improving the film stiffness than POSS cages. However, cage-structured P(GMA/MA-POSS) and PGMA/NH 2 -POSS indicate higher permeability than PGMA/NH 2 -PDMS and traditional epoxy resin. Comparatively, the cage-structured P(GMA/MA-POSS) hybrid is the best coating in transparency, permeability, adhesive strength and thermostability, but linear-structured PGMA/NH 2 -PDMS hybrid behaviors the best coating in

  2. Variation in GMC Association Properties across the Bars, Spiral Arms, Inter-arms, and Circumnuclear Region of M100 (NGC 4321) Extracted from ALMA Observations

    Energy Technology Data Exchange (ETDEWEB)

    Pan, Hsi-An [Academia Sinica, Institute of Astronomy and Astrophysics (ASIAA), P.O. Box 23-141, Taipei 10617, Taiwan (China); Kuno, Nario, E-mail: hapan@asiaa.sinica.edu.tw [Faculty of Pure and Applied Sciences, University of Tsukuba, 1-1-1 Tennoudai, Tsukuba, Ibaraki 350-8577 (Japan)

    2017-04-20

    We study the physical properties of giant molecular cloud associations (GMAs) in M100 (NGC 4321) using the ALMA Science Verification feathered (12 m+ACA) data in {sup 12}CO (1–0). To examine the environmental dependence of their properties, GMAs are classified based on their locations in various environments as circumnuclear ring (CNR), bar, spiral, and inter-arm GMAs. The CNR GMAs are massive and compact, while the inter-arm GMAs are diffuse, with low surface density. GMA mass and size are strongly correlated, as suggested by Larson. However, the diverse power-law index of the relation implies that the GMA properties are not uniform among the environments. The CNR and bar GMAs show higher velocity dispersion than those in other environments. We find little evidence for a correlation between GMA velocity dispersion and size, which indicates that the GMAs are in diverse dynamical states. Indeed, the virial parameter of the GMAs spans nearly two orders of magnitude. Only the spiral GMAs are generally self-gravitating. Star formation activity decreases in order over the CNR, spiral, bar, and inter-arm GMAs. The diverse GMA and star formation properties in different environments lead to variations in the Kennicutt–Schmidt relation. A combination of multiple mechanisms or gas phase change is necessary to explain the observed slopes. Comparisons of GMA properties acquired with the use of the 12 m array observations with those from the feathered data are also presented. The results show that the missing flux and extended emission cannot be neglected for the study of environmental dependence.

  3. Effect of carbon nanotube reinforcement on the properties of the recycled poly(ethylene terephthalate)/poly(ethylene naphthalate) (r-PET/PEN) blends containing functional elastomers

    International Nuclear Information System (INIS)

    Yesil, Sertan

    2013-01-01

    Highlights: • Mechanical properties of r-PET improved with addition of PEN, elastomers and CNT. • Elastomer size and dispersion played important role in the variation of properties. • Selective localization of CNT affected the mechanical and electrical properties. • E-EA-MAH based samples had higher mechanical properties than E-MA-GMA based ones. - Abstract: In this study, the mechanical, thermomechanical, thermal, electrical properties and the morphology of the composites, based on blends of recycled poly(ethylene terephthalate) (r-PET) and poly(ethylene naphthalate) (PEN) that were mixed with functional elastomers and multi walled carbon nanotube (CNT) were investigated. Two types of functional elastomers; terpolymer of ethylene–ethyl acrylate–maleic anhydride (E-EA-MAH) and terpolymer of ethylene–methyl acrylate–glycidyl methacrylate (E-MA-GMA), were used to ensure the miscibility between PET and PEN during the preparation of the blends and composites. All composite and blend samples were extruded by using a laboratory scale twin screw microcompounder. Test samples were prepared via laboratory scale injection molding machine. According to the results of the thermomechanical tests, usage of both elastomers enhanced the miscibility between r-PET and PEN. Morphological analyses showed that the blends and composites which contain E-EA-MAH exhibited better elastomer phase dispersion with smaller domain sizes when compared with the samples with E-MA-GMA. Samples prepared with E-EA-MAH had better mechanical properties than the ones containing E-MA-GMA due to the better elastomer phase dispersion. Moreover, addition of CNT also improved the mechanical properties of the samples for both elastomer types. In contrast to mechanical test results, samples prepared with E-MA-GMA had higher electrical conductivity values when compared with those of the ones containing E-EA-MAH due to the differences in the selective distribution of CNT particles between the

  4. Controlled protein adsorption on PMOXA/PAA based coatings by thermally induced immobilization

    Science.gov (United States)

    Mumtaz, Fatima; Chen, Chaoshi; Zhu, Haikun; Pan, Chao; Wang, Yanmei

    2018-05-01

    In this work, poly(2-methyl-2-oxazoline-random-glycidyl methacrylate) (PMOXA-r-GMA) and poly(acrylic acid)-block-poly(glycidyl methacrylate) (PAA-b-PGMA) copolymers were synthesized via cationic ring-opening polymerization (CROP) of 2-methyl-2-oxazoline (MOXA) and reversible addition-fragmentation chain transfer (RAFT) polymerization of acrylic acid (AA) followed by their random and block copolymerization with glycidyl methacrylate (GMA), respectively, and then characterized carefully. PMOXA/PAA based coatings were then prepared by simply spin coating the mixture of PMOXA-r-GMA and PAA-b-PGMA copolymer solutions onto silicon/glass substrates followed by annealing at 110 °C. The coatings were rigorously characterized by using X-ray photoelectron spectroscopy (XPS), the static water contact angle (WCA) test, ellipsometry and atomic force microscopy (AFM). The results demonstrated that the coating based mixed PMOXA/PAA brushes with desired surface composition could be attained by simply maintaining their percentage in the mixture of PMOXA-r-GMA and PAA-b-PGMA copolymer solutions. Finally, the switchable behavior of PMOXA/PAA based coatings toward bovine serum albumin (BSA) adsorption was investigated by fluorescein isothiocyanate-labelled BSA (FITC-BSA) assay and quartz crystal microbalance with dissipation monitoring (QCM-D), which indicated that the coating based mixed PMOXA/PAA brushes could control BSA adsorption/desorption from very low to high amount (>90% desorption) through adjusting the composition of PMOXA-r-GMA and PAA-b-PGMA solution used in preparing PMOXA/PAA based coatings upon pH and ionic strength change. Furthermore, PMOXA/PAA based coatings displayed efficient repeatability of reversible BSA adsorption/desorption cycles.

  5. Long-term follow-up with Granulocyte and Monocyte Apheresis re-treatment in patients with chronically active inflammatory bowel disease

    Directory of Open Access Journals (Sweden)

    Karlsson Mats

    2010-07-01

    Full Text Available Abstract Background Patients with IBD and chronic inflammation refractory to conventional therapy often demonstrate higher risk of serious complications. Combinations of immunosuppression and biological treatment as well as surgical intervention are often used in this patient group. Hence, there is need for additional treatment options. In this observational study, focused on re-treatment and long-term results, Granulocyte/Monocyte Adsorption (GMA, Adacolumn® treatment has been investigated to study efficacy, safety and quality of life in IBD-patients with chronic activity. Methods Fifteen patients with ulcerative colitis and 25 patients with Crohn's disease, both groups with chronically active inflammation refractory to conventional medication were included in this observational study. The patients received 5-10 GMA sessions, and the clinical activity was assessed at baseline, after each completed course, and at week 10 and 20 by disease activity index, endoscopy and quality of life evaluation. Relapsed patients were re-treated by GMA in this follow-up study up to 58 months. Results Clinical response was seen in 85% and complete remission in 65% of the patients. Ten patients in the UC-group (66% and 16 patients in the CD-group (64% maintained clinical and endoscopic remission for an average of 14 months. Fourteen patients who relapsed after showing initial remission were re-treated with GMA and 13 (93% went into a second remission. Following further relapses, all of seven patients were successfully re-treated for the third time, all of three patients for the fourth time and one for a fifth time. Conclusions IBD-patients with chronic inflammation despite conventional therapy seem to benefit from GMA. Re-treatment of relapsing remission patients seems to be effective.

  6. Effects of feeding blends of grains naturally contaminated with Fusarium mycotoxins on performance, hematology, metabolism, and immunocompetence of turkeys.

    Science.gov (United States)

    Girish, C K; Smith, T K; Boermans, H J; Karrow, N A

    2008-03-01

    An experiment was conducted to investigate the effects of feeding blends of grains naturally contaminated with Fusarium mycotoxins on performance, hematology, metabolism, and immunological parameters of turkeys. The efficacy of polymeric glucomannan mycotoxin adsorbent (GMA) in preventing these adverse effects was also evaluated. Three hundred 1-d-old male turkey poults were fed wheat-, corn-, and soybean meal-based starter (0 to 3 wk), grower (4 to 6 wk), developer (7 to 9 wk), and finisher (10 to 12 wk) diets formulated with uncontaminated grains, contaminated grains, and contaminated grains + 0.2% GMA. Feeding contaminated grains significantly decreased BW gains during the grower and developer phases, and GMA supplementation prevented these effects. There was no effect of diet, however, on feed intake or feed efficiency. The feeding of contaminated grains reduced total lymphocyte counts at wk 3 (P effect. Feeding contaminated grains significantly increased the percentage of CD4(+) lymphocyte populations during wk 6; however, there was no change in the percentage of CD8(+) and B-lymphocyte populations. Contact hypersensitivity to dinitrochlorobenzene, which is a CD8(+) T cell-mediated delayed-type hypersensitivity response, was significantly decreased after 24 and 72 h by feedborne mycotoxins compared with controls. Supplementation of the contaminated diet with GMA prevented the decrease in response after 24 h. Secondary antibody (IgG titer) response against SRBC antigens (CD4(+) T cell-dependent) was significantly decreased after feeding contaminated grains compared with controls. It was concluded that turkey performance and some blood and immunological parameters were adversely affected by feedborne Fusarium mycotoxins, and GMA prevented many of these effects.

  7. [Application of electrogastrography in pediatrics. Part II. The incidence of disturbed gastric myoelectrical activity in children suffering from recurrent abdominal pain].

    Science.gov (United States)

    Maliszewska, Iwona; Krusiec-Swidergoł, Beata; Kasicka-Jonderko, Anna; Jonderko, Krzysztof; Błońska-Fajfrowska, Barbara

    2007-01-01

    The study was devoted to determine the incidence of an abnormal gastric myoelectrical activity (GMA) in children suffering from recurrent abdominal pain. Surface electrogastrograms were taken in the interdigestive state and after a meal stimulation in 187 children referred to the laboratory with the diagnosis of recurrent abdominal pain. The cohort comprised the following subgroups: age 6-11 years (33 boys and 36 girls), age 12-18 years (28 boys and 90 girls). Continuous variables characterizing quantitatively an electrogastrogram were recoded into categorical data sets, which were used further for construction of an arbitrary scale reflecting disturbances of an electrogastrographic recording: score 0--normal, score 1-2, 3-4, and 5-6 corresponding to a light, moderate, and severe disturbance of the GMA. Abnormal electrogastrograms were found in just over a half of the examined children (54.5%). Nevertheless, light abnormalities (score 1-2) were predominant--42.8% of the whole cohort. Moderate abnormalities were revealed in almost every eight patient (11.8%), whereas no case of severely disturbed GMA was disclosed. On the other hand as much as 45.5% children did not exhibit any abnormality of the electrogastrogram. No statistically significant differences were found when the frequency distributions of particular degrees of the GMA disturbance were compared among groups of different age and gender. A disclosure that an abnormal electrogastrogram is encountered in just over a half of the patients and the predominance of light disturbances within this group, implies that disturbed GMA is neither an inherent nor a pathognomonic pathological finding of the clinical picture of recurrent abdominal pain in children.

  8. Steady-state global optimization of metabolic non-linear dynamic models through recasting into power-law canonical models.

    Science.gov (United States)

    Pozo, Carlos; Marín-Sanguino, Alberto; Alves, Rui; Guillén-Gosálbez, Gonzalo; Jiménez, Laureano; Sorribas, Albert

    2011-08-25

    Design of newly engineered microbial strains for biotechnological purposes would greatly benefit from the development of realistic mathematical models for the processes to be optimized. Such models can then be analyzed and, with the development and application of appropriate optimization techniques, one could identify the modifications that need to be made to the organism in order to achieve the desired biotechnological goal. As appropriate models to perform such an analysis are necessarily non-linear and typically non-convex, finding their global optimum is a challenging task. Canonical modeling techniques, such as Generalized Mass Action (GMA) models based on the power-law formalism, offer a possible solution to this problem because they have a mathematical structure that enables the development of specific algorithms for global optimization. Based on the GMA canonical representation, we have developed in previous works a highly efficient optimization algorithm and a set of related strategies for understanding the evolution of adaptive responses in cellular metabolism. Here, we explore the possibility of recasting kinetic non-linear models into an equivalent GMA model, so that global optimization on the recast GMA model can be performed. With this technique, optimization is greatly facilitated and the results are transposable to the original non-linear problem. This procedure is straightforward for a particular class of non-linear models known as Saturable and Cooperative (SC) models that extend the power-law formalism to deal with saturation and cooperativity. Our results show that recasting non-linear kinetic models into GMA models is indeed an appropriate strategy that helps overcoming some of the numerical difficulties that arise during the global optimization task.

  9. Steady-state global optimization of metabolic non-linear dynamic models through recasting into power-law canonical models

    Directory of Open Access Journals (Sweden)

    Sorribas Albert

    2011-08-01

    Full Text Available Abstract Background Design of newly engineered microbial strains for biotechnological purposes would greatly benefit from the development of realistic mathematical models for the processes to be optimized. Such models can then be analyzed and, with the development and application of appropriate optimization techniques, one could identify the modifications that need to be made to the organism in order to achieve the desired biotechnological goal. As appropriate models to perform such an analysis are necessarily non-linear and typically non-convex, finding their global optimum is a challenging task. Canonical modeling techniques, such as Generalized Mass Action (GMA models based on the power-law formalism, offer a possible solution to this problem because they have a mathematical structure that enables the development of specific algorithms for global optimization. Results Based on the GMA canonical representation, we have developed in previous works a highly efficient optimization algorithm and a set of related strategies for understanding the evolution of adaptive responses in cellular metabolism. Here, we explore the possibility of recasting kinetic non-linear models into an equivalent GMA model, so that global optimization on the recast GMA model can be performed. With this technique, optimization is greatly facilitated and the results are transposable to the original non-linear problem. This procedure is straightforward for a particular class of non-linear models known as Saturable and Cooperative (SC models that extend the power-law formalism to deal with saturation and cooperativity. Conclusions Our results show that recasting non-linear kinetic models into GMA models is indeed an appropriate strategy that helps overcoming some of the numerical difficulties that arise during the global optimization task.

  10. Contact allergy to epoxy (meth)acrylates.

    Science.gov (United States)

    Aalto-Korte, Kristiina; Jungewelter, Soile; Henriks-Eckerman, Maj-Len; Kuuliala, Outi; Jolanki, Riitta

    2009-07-01

    Contact allergy to epoxy (meth)acrylates, 2,2-bis[4-(2-hydroxy-3-methacryloxypropoxy) phenyl]propane (bis-GMA), 2,2-bis[4-(2-hydroxy-3-acryloxypropoxy)phenyl]-propane (bis-GA), 2,2-bis[4-(methacryl-oxyethoxy)phenyl] propane (bis-EMA), 2,2-bis[4-(methacryloxy)phenyl]-propane (bis-MA), and glycidyl methacrylate (GMA) is often manifested together with contact allergy to diglycidyl ether of bisphenol A (DGEBA) epoxy resin. To analyse patterns of concomitant allergic reactions to the five epoxy (meth)acrylates in relation to exposure. We reviewed the 1994-2008 patch test files at the Finnish Institute of Occupational Health (FIOH) for reactions to the five epoxy (meth)acrylates, and examined the patients' medical records for exposure. Twenty-four patients had an allergic reaction to at least one of the studied epoxy (meth)acrylates, but specific exposure was found only in five patients: two bis-GMA allergies from dental products, two bis-GA allergies from UV-curable printing inks, and one bis-GA allergy from an anaerobic glue. Only 25% of the patients were negative to DGEBA epoxy resin. The great majority of allergic patch test reactions to bis-GMA, bis-GA, GMA and bis-EMA were not associated with specific exposure, and cross-allergy to DGEBA epoxy resin remained a probable explanation. However, independent reactions to bis-GA indicated specific exposure. Anaerobic sealants may induce sensitization not only to aliphatic (meth)acrylates but also to aromatic bis-GA.

  11. Morphological and mechanical properties of polyamide 6/linear low density polyethylene blend compatibilized by electron-beam initiated mediation process

    International Nuclear Information System (INIS)

    Shin, Boo Young; Han, Do Hung

    2014-01-01

    The aim of this study was to compatibilize immiscible polyamide 6 (PA6)/linear low density polyethylene (LLDPE) blend by using electron-beam initiated mediation process. Glycidyl methacrylate (GMA) was chosen as a mediator for cross-copolymerization at the interface between PA6 and LLDPE. The exposure process was carried out to initiate cross-copolymerization by the medium of GMA at the interface between PA and LLDPE. The mixture of the PA6/LLDPE/GMA was prepared by using a twin-screw extruder, and then the mixture was exposed to electron-beam radiation at various doses at room temperature. To investigate the results of this compatibilization strategy, the morphological and mechanical properties of the blend were analyzed. Morphology study revealed that the diameters of the dispersion particles decreased and the interfacial adhesion increased with respect to irradiation doses. The elongation at break of the blends increases significantly with increasing irradiation dose up to 100 kGy while the tensile strength and the modulus increased nonlinearly with increasing irradiation dose. The reaction mechanisms of the mediation process with the GMA mediator at the interface between PA6 and LLDPE were estimated. - Highlights: • PA6/LLDPE blend was compatibilized by the electron-beam initiated mediation process. • Interfacial adhesion was significantly enhanced by the radiation initiated cross-copolymerization. • The elongation at break of blend irradiated at 100 kGy was 4 times higher than PA6. • The GMA as a mediator played a key role in the electron-beam initiated mediation process

  12. Optimization of biotechnological systems through geometric programming

    Directory of Open Access Journals (Sweden)

    Torres Nestor V

    2007-09-01

    Full Text Available Abstract Background In the past, tasks of model based yield optimization in metabolic engineering were either approached with stoichiometric models or with structured nonlinear models such as S-systems or linear-logarithmic representations. These models stand out among most others, because they allow the optimization task to be converted into a linear program, for which efficient solution methods are widely available. For pathway models not in one of these formats, an Indirect Optimization Method (IOM was developed where the original model is sequentially represented as an S-system model, optimized in this format with linear programming methods, reinterpreted in the initial model form, and further optimized as necessary. Results A new method is proposed for this task. We show here that the model format of a Generalized Mass Action (GMA system may be optimized very efficiently with techniques of geometric programming. We briefly review the basics of GMA systems and of geometric programming, demonstrate how the latter may be applied to the former, and illustrate the combined method with a didactic problem and two examples based on models of real systems. The first is a relatively small yet representative model of the anaerobic fermentation pathway in S. cerevisiae, while the second describes the dynamics of the tryptophan operon in E. coli. Both models have previously been used for benchmarking purposes, thus facilitating comparisons with the proposed new method. In these comparisons, the geometric programming method was found to be equal or better than the earlier methods in terms of successful identification of optima and efficiency. Conclusion GMA systems are of importance, because they contain stoichiometric, mass action and S-systems as special cases, along with many other models. Furthermore, it was previously shown that algebraic equivalence transformations of variables are sufficient to convert virtually any types of dynamical models into

  13. Blood troponin levels in acute cardiac events depends on space weather activity components (a correlative study).

    Science.gov (United States)

    Stoupel, Eliiyahu; Radishauskas, Richardas; Bernotiene, Gailute; Tamoshiunas, Abdonas; Virvichiute, Daiva

    2018-02-05

    Many biological processes are influenced by space weather activity components such as solar activity (SA), geomagnetic activity (GMA) and cosmic ray activity (CRA). Examples are total mortality, acute myocardial infarction (AMI), stroke (cerebrovascular accident), sudden cardiac death, some congenital maladies (congenital heart disease and Down syndrome), many events in neonatology, ophtalmology, blood pressure regulation, blood coagulation, inflammation, etc. The aim of this study was to check if the level of blood troponins (Tns) - markers of myocardial damage and recognized components of modern description of AMI - is connected with the mentioned space weather parameters. Patients admitted to a 3000-bed tertiary university hospital in Kaunas, Lithuania, with suspected AMI were the object of the study. Data for the time between 2008 and 2013 - 72 consecutive months - were studied. Of the patients, 1896 (1398 male, 498 female) had elevated troponin I (Tn I) or troponin T (Tn T, sensitive Tn) levels. Normal values were 0.00-0.03 ng/mL for Tn I and 0.00-14.00 ng/mL for Tn T. Monthly means and standard deviation of Tn I and Tn T were compared with monthly markers of SA, GMA and CRA. Pearson correlation coefficients and their probabilities were established (in addition to the consecutive graphs of both comparing physical and biological data). The cosmophysical data came from space service institutions in the United States, Russia and Finland. AMI was diagnosed in 1188 patients (62.66%), and intermediate coronary syndrome in 698 patients (36.81%). There were significant links of the Tn blood levels with four SA indices and CRA (neutron activity in imp/min); there was no significant correlation with GMA indices Ap and Cp (p=0.27 and p=0.235). Tn T levels significantly correlated with the GMA indices and not with the SA and CRA levels (Ap: r=0.77, p=0.0021; Cp: r=0.729, p=0.0047). First, the monthly level of blood Tn I in ACS is significantly correlated with the indices

  14. Response of the mouse lung transcriptome to welding fume: effects of stainless and mild steel fumes on lung gene expression in A/J and C57BL/6J mice

    Directory of Open Access Journals (Sweden)

    Antonini James M

    2010-06-01

    Full Text Available Abstract Background Debate exists as to whether welding fume is carcinogenic, but epidemiological evidence suggests that welders are an at risk population for the development of lung cancer. Recently, we found that exposure to welding fume caused an acutely greater and prolonged lung inflammatory response in lung tumor susceptible A/J versus resistant C57BL/6J (B6 mice and a trend for increased tumor incidence after stainless steel (SS fume exposure. Here, our objective was to examine potential strain-dependent differences in the regulation and resolution of the lung inflammatory response induced by carcinogenic (Cr and Ni abundant or non-carcinogenic (iron abundant metal-containing welding fumes at the transcriptome level. Methods Mice were exposed four times by pharyngeal aspiration to 5 mg/kg iron abundant gas metal arc-mild steel (GMA-MS, Cr and Ni abundant GMA-SS fume or vehicle and were euthanized 4 and 16 weeks after the last exposure. Whole lung microarray using Illumina Mouse Ref-8 expression beadchips was done. Results Overall, we found that tumor susceptibility was associated with a more marked transcriptional response to both GMA-MS and -SS welding fumes. Also, Ingenuity Pathway Analysis revealed that gene regulation and expression in the top molecular networks differed between the strains at both time points post-exposure. Interestingly, a common finding between the strains was that GMA-MS fume exposure altered behavioral gene networks. In contrast, GMA-SS fume exposure chronically upregulated chemotactic and immunomodulatory genes such as CCL3, CCL4, CXCL2, and MMP12 in the A/J strain. In the GMA-SS-exposed B6 mouse, genes that initially downregulated cellular movement, hematological system development/function and immune response were involved at both time points post-exposure. However, at 16 weeks, a transcriptional switch to an upregulation for neutrophil chemotactic genes was found and included genes such as S100A8, S100A9 and

  15. Cell death effects of resin-based dental material compounds and mercurials in human gingival fibroblasts

    Energy Technology Data Exchange (ETDEWEB)

    Reichl, Franz-Xaver [Walther-Straub-Institute of Pharmacology and Toxicology, Munich (Germany); Ludwig-Maximilians-University, Department of Operative Dentistry and Periodontology, Munich (Germany); Esters, Magali; Simon, Sabine; Seiss, Mario [Walther-Straub-Institute of Pharmacology and Toxicology, Munich (Germany); Kehe, Kai [Bundeswehr Institute of Pharmacology and Toxicology, Munich (Germany); Kleinsasser, Norbert [University of Regensburg, Head and Neck Surgery, Department of Otolaryngology, Regensburg (Germany); Folwaczny, Matthias; Glas, Juergen; Hickel, Reinhard [Ludwig-Maximilians-University, Department of Operative Dentistry and Periodontology, Munich (Germany)

    2006-06-15

    In order to test the hypothesis that released dental restorative materials can reach toxic levels in human oral tissues, the cytotoxicities of the resin-based dental (co)monomers hydroxyethylmethacrylate (HEMA), triethyleneglycoldimethacrylate (TEGDMA), urethanedimethacrylate (UDMA), and bisglycidylmethacrylate (BisGMA) compared with methyl mercury chloride (MeHgCl) and the amalgam component mercuric chloride (HgCl{sub 2}) were investigated on human gingival fibroblasts (HGF) using two different test systems: (1) the modified XTT-test and (2) the modified H 33342 staining assay. The HGF were exposed to various concentrations of the test-substances in all test systems for 24 h. All tested (co)monomers and mercury compounds significantly (P<0.05) decreased the formazan formation in the XTT-test. EC{sub 50} values in the XTT assay were obtained as half-maximum-effect concentrations from fitted curves. Following EC{sub 50} values were found (mean [mmol/l]; s.e.m. in parentheses; n=12; * significantly different to HEMA): HEMA 11.530 (0.600); TEGDMA* 3.460 (0.200); UDMA* 0.106 (0.005); BisGMA* 0.087 (0.001); HgCl{sub 2}* 0.013 (0.001); MeHgCl* 0.005 (0.001). Following relative toxicities were found: HEMA 1; TEGDMA 3; UDMA 109; BisGMA 133; HgCl{sub 2} 887; MeHgCl 2306. A significant (P<0.05) increase of the toxicity of (co)monomers and mercurials was found in the XTT-test in the following order: HEMA < TEGDMA < UDMA < BisGMA < HgCl{sub 2} < MeHgCl. TEGDMA and MeHgCl induced mainly apoptotic cell death. HEMA, UDMA, BisGMA, and HgCl{sub 2} induced mainly necrotic cell death. The results of this study indicate that resin composite components have a lower toxicity than mercury from amalgam in HGF. HEMA, BisGMA, UDMA, and HgCl{sub 2} induced mainly necrosis, but it is rather unlikely that eluted substances (solely) can reach concentrations, which might induce necrotic cell death in the human physiological situation, indicating that other (additional) factors may be involved in

  16. Justification for recommended uncertainties

    International Nuclear Information System (INIS)

    Pronyaev, V.G.; Badikov, S.A.; Carlson, A.D.

    2007-01-01

    The uncertainties obtained in an earlier standards evaluation were considered to be unrealistically low by experts of the US Cross Section Evaluation Working Group (CSEWG). Therefore, the CSEWG Standards Subcommittee replaced the covariance matrices of evaluated uncertainties by expanded percentage errors that were assigned to the data over wide energy groups. There are a number of reasons that might lead to low uncertainties of the evaluated data: Underestimation of the correlations existing between the results of different measurements; The presence of unrecognized systematic uncertainties in the experimental data can lead to biases in the evaluated data as well as to underestimations of the resulting uncertainties; Uncertainties for correlated data cannot only be characterized by percentage uncertainties or variances. Covariances between evaluated value at 0.2 MeV and other points obtained in model (RAC R matrix and PADE2 analytical expansion) and non-model (GMA) fits of the 6 Li(n,t) TEST1 data and the correlation coefficients are presented and covariances between the evaluated value at 0.045 MeV and other points (along the line or column of the matrix) as obtained in EDA and RAC R matrix fits of the data available for reactions that pass through the formation of the 7 Li system are discussed. The GMA fit with the GMA database is shown for comparison. The following diagrams are discussed: Percentage uncertainties of the evaluated cross section for the 6 Li(n,t) reaction and the for the 235 U(n,f) reaction; estimation given by CSEWG experts; GMA result with full GMA database, including experimental data for the 6 Li(n,t), 6 Li(n,n) and 6 Li(n,total) reactions; uncertainties in the GMA combined fit for the standards; EDA and RAC R matrix results, respectively. Uncertainties of absolute and 252 Cf fission spectrum averaged cross section measurements, and deviations between measured and evaluated values for 235 U(n,f) cross-sections in the neutron energy range 1

  17. Short vegetal-fiber reinforced HDPE—A study of electron-beam radiation treatment effects on mechanical and morphological properties

    International Nuclear Information System (INIS)

    Ferreira, Maiara S.; Sartori, Mariana N.; Oliveira, Rene R.; Guven, Olgun; Moura, Esperidiana A.B.

    2014-01-01

    Graphical abstract: - Highlights: • HDPE reinforced with short piassava fiber composites were prepared by melt-mixing processing. • Glycidyl methacrylate (GMA) was tested as a radiation cross-linking agent. • The materials were irradiated with 100 and 200 kGy using a 1.5 MeV electron beam accelerator, at room temperature in presence of air. • The better interfacial adhesion between fiber and HDPE matrix was observed for composites with GMA addition irradiated with radiation dose of 200 kGy. - Abstract: The effects of electron-beam radiation treatment on fiber-matrix adhesion and mechanical properties of short piassava fibers reinforced high density polyethylene (HDPE) matrix were studied. Glycidyl methacrylate (GMA) was added at 2.5% and 5.0% (on piassava fiber wt) as a cross-linking agent and the effects upon the properties of the resulting composites treated by electron-beam radiation were also examined. HDPE reinforced with short piassava fiber composites was prepared by melt-mixing processing, using a twin screw extruder machine. The materials were irradiated with 100 and 200 kGy using a 1.5 MeV electron beam accelerator, at room temperature in presence of air. Material samples were submitted to mechanical and thermo-mechanical tests and SEM analyses. Correlation between properties was discussed. The comparison of mechanical and thermo-mechanical properties of the composites showed that electron-beam radiation treatment produced a significant improvement in mechanical properties, when compared with the non-irradiated composite sample and neat HDPE. Scanning electron microscopy (SEM) studies of the composite failure surfaces indicated that there was an improved adhesion between fiber and matrix. Examination of the failure surfaces indicated dependence of the interfacial adhesion upon the radiation dose and GMA content. Better interfacial adhesion between fiber and HDPE matrix was observed for composites with 5.0% GMA addition and treated with electron

  18. Short vegetal-fiber reinforced HDPE—A study of electron-beam radiation treatment effects on mechanical and morphological properties

    Energy Technology Data Exchange (ETDEWEB)

    Ferreira, Maiara S.; Sartori, Mariana N.; Oliveira, Rene R. [Nuclear and Energy Research Institute, IPEN-CNEN/SP, Av. Prof. Lineu Prestes 2242, zip code 05508-000 São Paulo, SP (Brazil); Guven, Olgun [Hacettepe University, Department of Chemistry, Polymer Chemistry Division, Beytepe, zip code 06800 Ankara (Turkey); Moura, Esperidiana A.B., E-mail: eabmoura@ipen.br [Nuclear and Energy Research Institute, IPEN-CNEN/SP, Av. Prof. Lineu Prestes 2242, zip code 05508-000 São Paulo, SP (Brazil)

    2014-08-15

    Graphical abstract: - Highlights: • HDPE reinforced with short piassava fiber composites were prepared by melt-mixing processing. • Glycidyl methacrylate (GMA) was tested as a radiation cross-linking agent. • The materials were irradiated with 100 and 200 kGy using a 1.5 MeV electron beam accelerator, at room temperature in presence of air. • The better interfacial adhesion between fiber and HDPE matrix was observed for composites with GMA addition irradiated with radiation dose of 200 kGy. - Abstract: The effects of electron-beam radiation treatment on fiber-matrix adhesion and mechanical properties of short piassava fibers reinforced high density polyethylene (HDPE) matrix were studied. Glycidyl methacrylate (GMA) was added at 2.5% and 5.0% (on piassava fiber wt) as a cross-linking agent and the effects upon the properties of the resulting composites treated by electron-beam radiation were also examined. HDPE reinforced with short piassava fiber composites was prepared by melt-mixing processing, using a twin screw extruder machine. The materials were irradiated with 100 and 200 kGy using a 1.5 MeV electron beam accelerator, at room temperature in presence of air. Material samples were submitted to mechanical and thermo-mechanical tests and SEM analyses. Correlation between properties was discussed. The comparison of mechanical and thermo-mechanical properties of the composites showed that electron-beam radiation treatment produced a significant improvement in mechanical properties, when compared with the non-irradiated composite sample and neat HDPE. Scanning electron microscopy (SEM) studies of the composite failure surfaces indicated that there was an improved adhesion between fiber and matrix. Examination of the failure surfaces indicated dependence of the interfacial adhesion upon the radiation dose and GMA content. Better interfacial adhesion between fiber and HDPE matrix was observed for composites with 5.0% GMA addition and treated with electron

  19. 1999 Annual report

    International Nuclear Information System (INIS)

    2000-01-01

    In 1999, GMA executed a major shift in its business strategy and operations by selling its geophysical and geological software assets and by entering into broad based technology markets with potential sales growth in North America and internationally. The decision to diversify the company's client base followed the slowdown in the oil and gas industry in 1998 and 1999, forcing many of the company's clients to cut budgets in order to survive. The new business strategy enables GMA to concentrate on delivering software and service solutions across a wide-range of non-cyclical industries, giving the company greater access to growth markets, less susceptibility to industry down cycles and increased applications of research and development results. To give effect to the new strategy, GMA in 1999 acquired 100 per cent of a high volume virtual data management company (NRI Online Inc), 100 per cent of a newspaper circulation management software company (NTI Newspaper Technologies Inc). GMA also acquired the remaining outstanding shares of a private Alberta company which developed petrophysical software for the oil and gas industry. Through NRI's Computerized On-Line Interactive Network (COIN) GMA, to be renamed Netdriven Solutions Inc., intends to enter the Canadian oil and gas seismic data niche market by providing storage and management of large volume data sets in an on-line network environment, with high speed fibre optic communications links. Current NRI clients include Talisman Energy, Mobil Oil, Anderson Exploration, Suncor Energy , and others. The long-term goal is to expand NRI's oil and gas client base from Calgary to other national and international oil and gas regions. GMA had revenues from its combined operation in Canada, the USA and Europe of $ 5.7 million in 1999, derived from a combination of geophysical and geological software sales, maintenance contracts and geophysical consulting services. Revenues from software sale alone are down, due to the cutbacks

  20. Il lavoro penitenziario: la dimensione umana del carcere e della città che lo accoglie. L’esperienza della cooperativa sociale Rio Terà dei Pensieri/Le travail carcéral : la dimension humaine de la prison et de la ville qui l'abrite. L'expérience de la coopérative sociale Rio Terà dei Pensieri/Prison inmates work: the human dimension of the prison and the town where prison is built in. The experience of social cooperative Rio Terà dei Pensieri

    Directory of Open Access Journals (Sweden)

    Valentina Ferrara

    2013-12-01

    Full Text Available Il lavoro approfondisce, nella parte teorica, le tematiche relative alla pena detentiva, analizzando la tradizione sociologica sull’argomento e confrontandola con le contingenze attuali, ponendo specifica attenzione al «problema» dell’immigrazione; traccia in seguito il quadro normativo relativo al lavoro in carcere e, contestualmente, alle cooperative sociali, quale cornice entro cui presentare i dati afferenti alla parte empirica. La ricerca di approccio quantitativo ha analizzato i dati dei dipendenti della Cooperativa al fine di rilevare la porzione di posti di lavoro garantiti dalla stessa rispetto al totale dei detenuti della Regione Veneto e della città di Venezia; la ricerca di approccio qualitativo ha indagato l’impatto delle attività della Cooperativa all’interno del carcere (osservazione, trattamento, misure alternative e al suo esterno (percezione dei cittadini rispetto agli istituti penitenziari. La première partie de cet article s’attache à analyser certains aspects de la détention à travers la littérature sociologique et accordant une attention particulière aux « problèmes » d’immigration. Ensuite, l’auteur examine les lois sur l’emploi en milieu carcéral et, parallèlement, les coopératives sociales. Dans la deuxième partie, l’auteur prend en considération les données provenant d’une étude quantitative menée parmi les salariés de la coopérative Rio Terà dei Pensier dans le but d’estimer le pourcentage d’emplois assuré par cette coopérative par rapport au nombre total de détenus en Région de Vénétie et dans la ville de Venise. De plus, en ce qui concerne la partie qualitative de cette recherche, l’auteur se penche sur l’impact des activités menées par cette coopérative tant en prison (traitement et réinsertion des délinquants, mesures alternatives à la détention qu’à l’extérieur (les perceptions qui ont les citoyens de la prison. The first part of this article seeks to analyse the topics related to detention through sociological literature and paying particular attention to immigration “problems”. Then, the author outlines the situation about prison law jobs and, at the same time, social cooperatives. In the second part, the author examines data coming from the quantitative research conducted among employees of the cooperative Rio Terà dei Pensieri in order to estimate the percentage of jobs guaranteed by this cooperative compared to the total number of prisoners of Veneto Region and Venice. Moreover, regarding the qualitative part of this research, the author looks into the impact of activities carried out by this cooperative both inside (treatment and rehabilitation of offenders, alternative measures programs, and outside prison (citizens’ perceptions of prisons.

  1. Liberating Composition from Language Dictatorship

    NARCIS (Netherlands)

    Bergmans, Lodewijk; Bockisch, Christoph; Aksit, Mehmet

    Historically, programming languages have been—although benevolent—dictators: fixing a lot of semantics into built-in language constructs. Over the years, (some) programming languages have freed the programmers from restrictions to use only built-in libraries, built-in data types, or built-in type

  2. Characterization of gas metal arc welded hot rolled DP600 steel

    Energy Technology Data Exchange (ETDEWEB)

    Mukherjee, K.; Ramazani, A.; Yang, L.; Prahl, U.; Bleck, W. [RWTH Aachen University, Institute for Ferrous Metallurgy (IEHK) (Germany); Reisgen, U.; Schleser, M.; Abdurakhmanov, A. [RWTH Aachen University, Welding and Joining Institute (ISF) (Germany)

    2011-12-15

    Dual-phase (DP) steels are suitable candidates for automotive applications due to their high strength and ductility. These advanced mechanical properties result from the special microstructure of the DP steel with 5{proportional_to}20% martensite phase in a soft ferrite matrix. However, during welding, which is an important process in automotive industry, this special microstructure is destroyed. In this research the characterization of Gas Metal Arc (GMA) welded joining zones was performed by optical microscopy and hardness mapping. Tensile tests were also performed keeping the welded portion in the gauge length. Scanning Electron Microscopy (SEM) was used for the fracture investigation. From the characterization and tensile tests, the soften zones were found, which are caused by the tempered martensite and larger ferrite grain size than that in base metal. Furthermore, GMA welding make a large Heat Affected Zone (HAZ). (Copyright copyright 2011 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  3. Comparing Efficacy of Instructional Approaches to Develop Environmental Awareness Among School Students

    Directory of Open Access Journals (Sweden)

    Doris D’Souza

    2014-12-01

    Full Text Available This study aims to compare efficacy of self-learning, audiovisual, and fun activity instructional approaches among school students of Patna, the capital city of Bihar state of India, to develop environmental awareness. The study participants include 144 randomly selected students (72 girls and 72 boys from eight different schools of Patna. During a weeklong environmental awareness program, students were instructed using above three approaches of instruction. Data have been analyzed by using linear regression. Regression was carried out to eliminate the effect of general mental ability (GMA scores. The results suggest about overall superiority of fun activity approach over other approaches tested in the present study. However, awareness gain has been significant among the students with high GMA when instructed through audiovisual approach.

  4. Characterization and equalization of the AC responses of the corrector magnets for the APS local orbit feedback system

    Energy Technology Data Exchange (ETDEWEB)

    Doose, C.; Kim, S.H.

    1997-08-01

    Local feedback for the APS storage ring uses local bumps to control the position and angle of the positron beam through each x-ray source point. Induced eddy currents in the aluminum vacuum chamber dominate the AC characteristics of the corrector magnetic fields. Small differences in the geometries at each magnet location change the eddy current effects and result in bump closure errors which must be reduced in order to minimize the coupling between each of the many local loops and the global control loop. By a combination of flux-damping coils, flux-shielding copper sheets, and a set of steel laminations for end-flux clamping, the differences of the eddy current effects between two corrector magnets were reduced from 0.18 Gm/A to 0.035 Gm/A in the frequency span of 0.1-100 Hz.

  5. Controlled release of potassium chloride from radiation-polymerized copolymer matrices

    International Nuclear Information System (INIS)

    Yoshida, Masaru; Kumakura, Minoru; Kaetsu, Isao

    1979-01-01

    Release behavior of potassium chloride (KCl) from the flat circular copolymer composites, obtained by radiation-induced polymerization at low temperatures, was studied. The release rate agreed with the first-order kinetics based on the Noyes-Whitney equation in relation to the swelling of the composites. Release profiles of KCl from copolymer composites was affected by monomer composition between hydroxyethyl acrylate (HEA) and polyfunctional glass-forming monomers such as 2-hydroxyethyl methacrylate (HEMA), diethylene glycol dimethacrylate (DGDA), and trimethylolpropane trimethacrylate (TMPT) owing to change of swelling property of copolymers. The release rate decreased at HEA-poor composition in any system. In the case of hydrophobic comonomer system such as glycidyl methacrylate (GMA) and DGDA, release profile of KCl showed a minimum at 50% GMA-50% DGDA monomer composition. (author)

  6. Observation of damage process in RC beams under cucle bending by acoustic emission

    International Nuclear Information System (INIS)

    Shigeishi, Mitsuhiro; Ohtsu, Masayasu; Tsuji, Nobuyuki; Yasuoka, Daisuke

    1997-01-01

    Reinforced concrete (RC) structures are generally applied to construction of buildings and bridges, and are imposed on cyclic loading incessantly. It is considered that detected acoustic emission (AE) waveforms are associated with the damage degree and the fracture mechanisms of RC structures. Therefor, the cyclic bending tests are applied to damaged RC beam specimens. To evaluate the interior of the damaged RC beams, the AE source kinematics are determined by 'SiGMA' procedure for AE moment tensor analysis. By using 'SiGMA' procedure, AE source kinematics, such as source locations, crack types, crack orientations and crack motions, can be identified. The results show the applicability to observation of the fracture process under cyclic bending load and evaluation the degree of damage of RC beam.

  7. New membranes obtained by grafted irradiated PVDF foils

    International Nuclear Information System (INIS)

    Mazzei, R.; García Bermúdez, G.; Camporotondi, D.E.; Arbeitman, C.

    2012-01-01

    The present work describes a new method to produce membranes of poly(Acrylic-acid-Xmonomer) using the grafting procedure. PVDF foils irradiated with Ar + beam with energies between 30 and 150 keV were employed as substratum. Different combinations of monomers in water solutions were used: acrylic acid (AAc); acrylic acid–glycidyl methacrylate (AAc–GMA); acrylic acid–styrene (AAc–S), acrylic acid-N-isopropyl acrylamide (AAc–NIPAAm) and acrylic acid-N-isopropyl acrylamide–glycidyl methacrylate (AAc-NIPAAm–GMA). A large percentage of grafting results for specific values of: ion fluence and energy, AAc and sulfuric acid concentration, and different substrata PVDF polymorphous (alpha or beta). At a particular time of the grafting process, the poly(AAc-Xmonomer) membranes detach from the substratum and continue their grafting in the solution. This method is useful to produce increased replicated membranes of the irradiated original surface.

  8. Flexural behaviour of post-cured composites at oral-simulating temperatures.

    Science.gov (United States)

    Ho, C T; Vijayaraghavan, T V; Lee, S Y; Tsai, A; Huang, H M; Pan, L C

    2001-07-01

    Post-curing treatments have been known to improve the mechanical stability of visible light-cured composites. After individual post-curing treatment, the flexural strength (FS) of four commercial direct/indirect placement composite materials which differ greatly in composition [oligocarbonate dimethacrylate (OCDMA)-based Conquest C & B (CQT), Bisphenol-A glycidyl dimethacrylate (BisGMA)-based Charisma, urethane dimethacrylate (UDMA)-based Concept (CCT), and BisGMA/UDMA-based Dentacolor] was evaluated under water in the temperature range of 12-50 degrees C. A control series was tested in air at room temperature (25 +/- 1 degrees C). Data were analysed using ANOVA and Duncan's test. Flexural strengths overall decreased (20-40%, P OCDMA-based materials. Post-cured composites can be significantly affected by exposure to oral environments. Different composition determines the degree of influence.

  9. A study of ethanol production of yeast cells immobilized with polymer carrier produced by radiation polymerization

    International Nuclear Information System (INIS)

    Lu Zhaoxin; Fujimura, Takashi

    1993-01-01

    Polymer carriers, poly(hydroxyethyl acrylate(HEA)-methoxy polyethylene glycol methylacrylate (M-23G)) and poly(hydroxyethyl acrylate(HEA)-glycidyl methylacrylate (GMA)) used for the immobilization of yeast cells were prepared by radiation polymerization at low temperature. Yeast cells were immobilized through adhesion and multiplication of yeast cells. The ethanol productivity of immobilized yeast cells with these carriers was related to the monomer composition of polymers and the optimum monomer composition was 20%:10% in poly(HEA-M-23G) and 17%:6% in poly(HEA-GMA). In this case, the ethanol productivity of immobilized yeast cells was about 4 times that of cells in free system. The relationship between the activity of immobilized yeast cells and the water content of the polymer carrier were also discussed. (author)

  10. STUDY OF COATINGS OBTAINED FROM ALLOY Fe-Mn-C-B-Si-Ni-Cr

    Directory of Open Access Journals (Sweden)

    Mychajło Paszeczko

    2016-09-01

    Full Text Available Tribological behaviour of coatings obtained from eutectic alloy Fe-Mn-C-B-Si-Ni-Cr was studied. The coatings were obtained by the method of gas metal arc welding (GMA with use of powder wire. GMA welding method is widely used for the regeneration of machine parts. Eutectic Fe-Mn-C-B-Si-Ni-Cr alloys can be used to obtain high quality coatings resistant to wear and corrosion. Pin-on-disk dry sliding wear tests at sliding speeds 0.4 m/s and under load 10 MPa were conducted for pin specimens. During friction a typical tribological behavior was observed. The mechanism of wear was mechanical-chemical.

  11. Camas drenantes bajo las líneas de drenaje de la zona metropolitana de Guadalajara (ZMG

    Directory of Open Access Journals (Sweden)

    Carlos Alejandro Vázquez Ortiz

    2013-10-01

    Full Text Available This paper presented a modified construction procedure for interior drainage lines and municipal network. One of the problems that affect the roads and buildings of the GMA is the failure of this structure due to tunnels in the ground support. This is caused by water leaks in the drains lines due to the water pressure flow that came from the soil piping due to the saturation of the ground support and consequently decreasing the resistance. In this paper it has been proposed the inclusion of a drainage bed, composed of a layer of pumitic sand, which could compromise the main GMA. This material develops high permeability and good resistance if it is compacted. Also, it has been included the installation of grids at certain distance to avoid the loss of fine particles due to piping. Moreover, a polyethylene layer has been added to the drainage bed, which prevents water leaking thought the ground support.

  12. Grafting of glycidyl methacrylate/styrene onto polyvinyldine fluoride membranes for proton exchange fuel cell

    International Nuclear Information System (INIS)

    Abdel-Hady, E.E.; El-Toony, M.M.; Abdel-Hamed, M.O.

    2013-01-01

    Simultaneous gamma irradiation was used effectively for grafting facilitation of glycidyl methacrylate (GMA) and styrene (Sty) onto polyvinylidine fluoride (PVDF). Grafting percent was 122 when monomers ratio are 30% Sty and 70% GMA at 20 KGy gamma irradiation dose. Characterization of the membrane was performed using FT-IR, ion exchange capacity (IEC), water uptake. Mechanical behavior such as tensile strength was studied while morphological structure of the membrane was carried out by scan electron microscope (SEM). The membrane with degree of grafting 122% showed higher IEC (1.2 m mol/cm) than those of Nafion membrane with corresponding proton conductivity of 5.7 × 10 −2 S/cm similar to it. Operating the fuel cell unit showed higher voltage of the prepared membranes than that of Nafion 211. The prepared membranes stability for 300 h work approved their applicability from the cost benefit point of view

  13. Development of a Plasma Streaming System for the Mirror Fusion Test Facility

    International Nuclear Information System (INIS)

    Holdsworth, T.; Clark, R.N.; McCotter, R.E.; Rossow, T.L.; Cruz, G.E.

    1979-01-01

    The Plasma Streaming System (PSS) is an essential portion of the Mirror Fusion Test Facility (MFTF), scheduled for completion in October 1981. The PSS will develop a plasma density of at least 2 x 10 12 particles/cm 3 at the MFTF magnet centerline by injecting particles along the field lines. The plasma will have a midplane plasma radius as large as 40 cm with variable plasma particle energy and beam geometry. Minimum amounts of impurities will be injected, with emphasis on minimizing high Z materials. Each of the 60 PSS units will consist of a gun magnet assembly (GMA) and a power supply. Each GMA consists of a plasma streaming gun, a pulse magnet that provides variable beam shaping, and a fast reaction pulse gas valve

  14. Studies on novel radiopaque methyl methacrylate: glycidyl methacrylate based polymer for biomedical applications.

    Science.gov (United States)

    Dawlee, S; Jayakrishnan, A; Jayabalan, M

    2009-12-01

    A new class of radiopaque copolymer using methyl methacrylate (MMA) and glycidyl methacrylate (GMA) monomers was synthesized and characterized. The copolymer was made radiopaque by the epoxide ring opening of GMA using the catalyst o-phenylenediamine and the subsequent covalent attachment of elemental iodine. The copolymer was characterized by Fourier transform infrared (FTIR) spectra, energy dispersive X-ray analysis using environmental scanning electron microscope (EDAX), thermogravimetric analysis (TGA), and differential scanning calorimetry (DSC). X-ray visibility of the copolymer was checked by X-radiography. Blood compatibility and cytotoxicity of the newly synthesized copolymer were also evaluated. The iodinated copolymer was thermally stable, blood compatible, non-cytotoxic, and highly radiopaque. The presence of bulky iodine group created a new copolymer with modified properties for potential use in biomedical applications.

  15. Separation of PCR-ready DNA from dairy products using magnetic hydrophilic microspheres and poly(ethylene glycol)-NaCl water solutions

    Energy Technology Data Exchange (ETDEWEB)

    Rittich, Bohuslav [Masaryk University, Faculty of Science, Institute of Experimental Biology, Tvrdeho 14, CZ-611 37 Brno (Czech Republic); Brno University of Technology, Faculty of Chemistry, Institute of Food Science and Biotechnology, Purkynova 464/118, CZ-612 00 Brno (Czech Republic)], E-mail: rittich@sci.muni.cz; Spanova, Alena [Masaryk University, Faculty of Science, Institute of Experimental Biology, Tvrdeho 14, CZ-611 37 Brno (Czech Republic); Brno University of Technology, Faculty of Chemistry, Institute of Food Science and Biotechnology, Purkynova 464/118, CZ-612 00 Brno (Czech Republic); Salek, Petr [Brno University of Technology, Faculty of Chemistry, Institute of Food Science and Biotechnology, Purkynova 464/118, CZ-612 00 Brno (Czech Republic); Nemcova, Petra [Masaryk University, Faculty of Science, Institute of Experimental Biology, Tvrdeho 14, CZ-611 37 Brno (Czech Republic); Trachtova, Stepanka [Brno University of Technology, Faculty of Chemistry, Institute of Food Science and Biotechnology, Purkynova 464/118, CZ-612 00 Brno (Czech Republic); Horak, Daniel [Institute of Macromolecular Chemistry, Academy of Sciences of the Czech Republic, Heyrovsky Sq. 2, CZ-162 06 Prague (Czech Republic)

    2009-05-15

    Carboxyl group-containing magnetic nonporous poly(2-hydroxyethyl methacrylate-co-glycidyl methacrylate) (P(HEMA-co-GMA)) and magnetic glass microspheres were used for the isolation of bacterial DNA. P(HEMA-co-GMA) microspheres were prepared by the dispersion polymerization in toluene/2-methylpropan-1-ol mixture in the presence of magnetite nanoparticles obtained by coprecipitation of Fe(II) and Fe(III) salts with ammonium hydroxide. Carboxyl groups were then introduced by oxidation of the microspheres with potassium permanganate. The most extensive DNA recovery was achieved at PEG 6000 concentrations of 12% or 16% and 2 M NaCl. The method proposed was used for bacterial DNA isolation from different dairy products containing Bifidobacterium and Lactobacillus cells. The presence of target DNA and the quality of isolated DNA were checked by polymerase chain reaction (PCR) amplification with specific primers.

  16. New membranes obtained by grafted irradiated PVDF foils

    Energy Technology Data Exchange (ETDEWEB)

    Mazzei, R. [Unidad de Actividades Tecnologicas y Agropecuarias, Laboratorio de Polimeros, Comision Nacional de Energia Atomica, Buenos Aires (Argentina); Universidad Tecnologica Nacional Facultad Regional, Buenos Aires (Argentina); Garcia Bermudez, G. [Gerencia de Investigacion y Aplicaciones, Laboratorio Tandar, Comision Nacional de Energia Atomica, Buenos Aires (Argentina); Escuela de Ciencia y Tecnologia, Universidad Nacional de General San Martin, Buenos Aires (Argentina); Consejo Nacional de Investigaciones Cientificas y Tecnicas, Buenos Aires (Argentina); Camporotondi, D.E., E-mail: camporotondi@cae.cnea.gov.ar [Unidad de Actividades Tecnologicas y Agropecuarias, Laboratorio de Polimeros, Comision Nacional de Energia Atomica, Buenos Aires (Argentina); Arbeitman, C. [Gerencia de Investigacion y Aplicaciones, Laboratorio Tandar, Comision Nacional de Energia Atomica, Buenos Aires (Argentina); Consejo Nacional de Investigaciones Cientificas y Tecnicas, Buenos Aires (Argentina); and others

    2012-09-15

    The present work describes a new method to produce membranes of poly(Acrylic-acid-Xmonomer) using the grafting procedure. PVDF foils irradiated with Ar{sup +} beam with energies between 30 and 150 keV were employed as substratum. Different combinations of monomers in water solutions were used: acrylic acid (AAc); acrylic acid-glycidyl methacrylate (AAc-GMA); acrylic acid-styrene (AAc-S), acrylic acid-N-isopropyl acrylamide (AAc-NIPAAm) and acrylic acid-N-isopropyl acrylamide-glycidyl methacrylate (AAc-NIPAAm-GMA). A large percentage of grafting results for specific values of: ion fluence and energy, AAc and sulfuric acid concentration, and different substrata PVDF polymorphous (alpha or beta). At a particular time of the grafting process, the poly(AAc-Xmonomer) membranes detach from the substratum and continue their grafting in the solution. This method is useful to produce increased replicated membranes of the irradiated original surface.

  17. A comparison of cytotoxicity and oxidative stress from welding fumes generated with a new nickel-, copper-based consumable versus mild and stainless steel-based welding in RAW 264.7 mouse macrophages.

    Science.gov (United States)

    Badding, Melissa A; Fix, Natalie R; Antonini, James M; Leonard, Stephen S

    2014-01-01

    Welding processes that generate fumes containing toxic metals, such as hexavalent chromium (Cr(VI)), manganese (Mn), and nickel (Ni), have been implicated in lung injury, inflammation, and lung tumor promotion in animal models. While federal regulations have reduced permissible worker exposure limits to Cr(VI), this is not always practical considering that welders may work in confined spaces and exhaust ventilation may be ineffective. Thus, there has been a recent initiative to minimize the potentially hazardous components in welding materials by developing new consumables containing much less Cr(VI) and Mn. A new nickel (Ni) and copper (Cu)-based material (Ni-Cu WF) is being suggested as a safer alternative to stainless steel consumables; however, its adverse cellular effects have not been studied. This study compared the cytotoxic effects of the newly developed Ni-Cu WF with two well-characterized welding fumes, collected from gas metal arc welding using mild steel (GMA-MS) or stainless steel (GMA-SS) electrodes. RAW 264.7 mouse macrophages were exposed to the three welding fumes at two doses (50 µg/ml and 250 µg/ml) for up to 24 hours. Cell viability, reactive oxygen species (ROS) production, phagocytic function, and cytokine production were examined. The GMA-MS and GMA-SS samples were found to be more reactive in terms of ROS production compared to the Ni-Cu WF. However, the fumes from this new material were more cytotoxic, inducing cell death and mitochondrial dysfunction at a lower dose. Additionally, pre-treatment with Ni-Cu WF particles impaired the ability of cells to phagocytize E. coli, suggesting macrophage dysfunction. Thus, the toxic cellular responses to welding fumes are largely due to the metal composition. The results also suggest that reducing Cr(VI) and Mn in the generated fume by increasing the concentration of other metals (e.g., Ni, Cu) may not necessarily improve welder safety.

  18. Evaluation of the molecular mechanisms associated with cytotoxicity and inflammation after pulmonary exposure to different metal-rich welding particles.

    Science.gov (United States)

    Shoeb, Mohammad; Kodali, Vamsi; Farris, Breanne; Bishop, Lindsey M; Meighan, Terence; Salmen, Rebecca; Eye, Tracy; Roberts, Jenny R; Zeidler-Erdely, Patti; Erdely, Aaron; Antonini, James M

    2017-08-01

    Welding generates a complex aerosol of incidental nanoparticles and cytotoxic metals, such as chromium (Cr), manganese (Mn), nickel (Ni), and iron (Fe). The goal was to use both in vivo and in vitro methodologies to determine the mechanisms by which different welding fumes may damage the lungs. Sprague-Dawley rats were treated by intratracheal instillation (ITI) with 2.0 mg of gas metal arc-mild steel (GMA-MS) or manual metal arc-stainless steel (MMA-SS) fumes or saline (vehicle control). At 1, 3, and 10 days, bronchoalveolar lavage (BAL) was performed to measure lung toxicity. To assess molecular mechanisms of cytotoxicity, RAW264.7 cells were exposed to both welding fumes for 24 h (0-100 μg/ml). Fume composition was different: MMA-SS (41% Fe, 29% Cr, 17% Mn, 3% Ni) versus GMA-MS (85% Fe, 14% Mn). BAL indicators of lung injury and inflammation were increased by MMA-SS at all time points and by GMA-MS at 3 and 10 days after exposure. RAW264.7 cells exposed to MMA-SS had elevated generation of reactive oxygen species (ROS), protein-HNE (P-HNE) adduct formation, activation of ERK1/2, and expression of cyclooxygenase-2 (COX-2) compared to GMA-MS and control. Increased generation of ROS due to MMA-SS exposure was confirmed by increased expression of Nrf2 and heme oxygenase-1 (HO-1). Results of in vitro studies provide evidence that stainless steel welding fume mediate inflammatory responses via activation of ROS/P-HNE/ERK1/2/Nrf2 signaling pathways. These findings were corroborated by elevated expression of COX-2, Nrf2, and HO-1 in homogenized lung tissue collected 1 day after in vivo exposure.

  19. Cardiovascular effects in rats after intratracheal instillation of metal welding particles.

    Science.gov (United States)

    Zheng, Wen; Antonini, James M; Lin, Yen-Chang; Roberts, Jenny R; Kashon, Michael L; Castranova, Vincent; Kan, Hong

    2015-01-01

    Studies have indicated that pulmonary exposure to welding fumes can induce a series of adverse effects in the respiratory system, including infection, bronchitis, siderosis and decreased pulmonary function. Recent clinical and epidemiological studies have found that pulmonary exposure to welding fumes is also associated with a higher incidence of cardiovascular events. However, there is insufficient evidence to confirm a direct effect of welding fumes on the cardiovascular system. The present study investigated the effects of pulmonary exposure to welding fumes on the heart and the vascular system in rats. Two chemically distinct welding fumes generated from manual metal arc-hard surfacing (MMA-HS) and gas metal arc-mild steel (GMA-MS) welding were tested. Three groups of rats were instilled intratracheally with MMA-HS (2 mg/rat), GMA-MS (2 mg/rat) or saline as control once a week for seven weeks. On days 1 and 7 after the last treatment, basal cardiovascular function and the cardiovascular response to increasing doses of adrenoreceptor agonists were assessed. MMA-HS treatment reduced the basal levels of left ventricle end-systolic pressure and dP/dt(max) at 1 day post-treatment, and decreased dP/dt(min) in response to isoproterenol (ISO) at 7 days post-treatment. Unlike MMA-HS, GMA-MS only affected left ventricular end-diastolic pressure in response to ISO at 7 days post-treatment. Treatment with MMA-HS or GMA-MS did not alter heart rate and blood pressure. Our findings suggest that exposure to different welding fumes can induce different adverse effects on the cardiovascular system, and that cardiac contractility may be a sensitive indicator of cardiovascular dysfunction.

  20. Finding of No Significant Impact for the Missouri River Recovery Program Lower Little Sioux Bend Shallow Water Habitat Construction Project

    Science.gov (United States)

    2011-07-01

    when it is used or managed for food or fiber, to include timber products, fruit, nuts, grapes, grain, forage, oil seed, fish and meat , poultry and dairy...entirely on the Deer Island State Game Management Area (GMA) managed by the Iowa Department of Natural Resources (IDNR). Alternatives Through the...Quality (NDEQ), Nebraska Game and Parks Commission (NGPC), and USFWS, the Draft Project Implementation Report (PIR) was posted for comment on the MRRP

  1. Photodegradable neutral-cationic brush block copolymers for nonviral gene delivery.

    Science.gov (United States)

    Hu, Xianglong; Li, Yang; Liu, Tao; Zhang, Guoying; Liu, Shiyong

    2014-08-01

    We report on the fabrication of a photodegradable gene-delivery vector based on PEO-b-P(GMA-g-PDMAEMA) neutral-cationic brush block copolymers that possess cationic poly(N,N-dimethylaminoethyl methacrylate) (PDMAEMA) brushes for DNA compaction, poly(ethylene oxide) (PEO) as a hydrophilic block, and poly(glycidyl methacrylate) (PGMA) as the backbone. The PEO-b-P(GMA-g-PDMAEMA) copolymers were synthesized through the combination of reversible addition-fragmentation transfer (RAFT) polymerization and postmodification. A photocleavable PEO-based macroRAFT agent was first synthesized; next, the PEO-b-PGMA block copolymer was prepared by RAFT polymerization of GMA; this was followed by a click reaction to introduce the RAFT initiators on the side chains of the PGMA block; then, RAFT polymerization of DMAEMA afforded the PEO-b-P(GMA-g-PDMAEMA) copolymer. The obtained neutral-cationic brush block copolymer could effectively complex plasmid DNA (pDNA) into nanoparticles at an N/P ratio (i.e., the number of nitrogen residues per DNA phosphate) of 4. Upon UV irradiation, pDNA could be released owing to cleavage of the pDNA-binding cationic PDMAEMA side chains as well as the nitrobenzyl ester linkages at the diblock junction point. In addition, in vitro gene transfection results demonstrated that the polyplexes could be effectively internalized by cells with good transfection efficiency, and the UV irradiation protocol could considerably enhance the efficiency of gene transfection. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  2. Polypropylene fibers modified by plasma treatment for preparation of Ag nanoparticles.

    Science.gov (United States)

    Tseng, Chun-Hao; Wang, Cheng-Chien; Chen, Chuh-Yung

    2006-03-09

    A novel method for preparing poly(propylene-graft-2-methacrylic acid 3-(bis-carboxymethylamino)-2-hydroxy-propyl ester)-silver fibers (PPG-IAg fibers) by plasma-induced grafting polymerization is presented in this study. The chelating groups, -N(CH2COO-)2 (GMA-IDA), on the surface of the PPG-I fibers are the coordination sites for chelating silver ions. At these sites, Ag nanoparticles were grown first by reduction with UV light with a wavelength of 366 nm, and second, through immersion in a 24% formaldehyde solution with pH values set variously at 2, 5, 8, and 11. The characteristics of the PPG-I fibers with differing durations of plasma treatment were monitored by using a Fourier transform infrared (FT-IR) spectroscope. Scanning electronic microscopy (SEM) and elemental analysis show that the percentage of GMA-IDA grafted onto PP fiber reaches a maximum when the plasma treatment time is 3 min. Plasma treatment time beyond a certain length of time results in an abundance of free radicals and causes considerable cross-linking on the fiber surface which thus decreases the extent of grafting. Moreover, the crystalline phase of Ag nanoparticles is identified by using X-ray diffraction (XRD). When the PPG-I fibers are reduced by the UV light method, SEM and TEM microscopes reveal that the size of the Ag nanoparticles on the fiber surface decreases significantly with the increase of pH values in aqueous solutions. Notably, in the reduction of formaldehyde solution, the particle size of Ag nanoparticles reaches a minimum at the lowest pH value. The TEM observations show that Ag nanoparticles are distributed both in the exterior and interior of the grafting layer. In addition, under high pH values the distribution of the Ag nanoparticles permeate more deeply in the GMA-IDA grafting layer due to the swelling effect of the GMA-IDA polymer.

  3. Separation of PCR-ready DNA from dairy products using magnetic hydrophilic microspheres and poly(ethylene glycol)-NaCl water solutions

    Czech Academy of Sciences Publication Activity Database

    Rittich, B.; Španová, A.; Šálek, P.; Němcová, P.; Trachtová, Š.; Horák, Daniel

    2009-01-01

    Roč. 321, č. 10 (2009), s. 1667-1670 ISSN 0304-8853. [International Conference on Scientific and Clinical Applications of Magnetic Carriers /7./. Vancouver, 20.05.2008-24.05.2008] R&D Projects: GA ČR GA203/09/1242 Institutional research plan: CEZ:AV0Z40500505 Keywords : magnetic microsphere * P(HEMA-co-GMA) * DNA isolation Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.204, year: 2009

  4. Triggers of Chinese Economic Coercion

    Science.gov (United States)

    2014-09-01

    2007 Angela Merkel–Dalai Lama Meeting ..............................70 2. The 2008 Nicolas Sarkozy–Dalai Lama Meeting ............................72 E...president Nicolas Sarkozy,35 Reilly nevertheless asserts that that while a mixture of statecraft tactics will continue, carrots are the first weapon of...144 Kim Tan and Anita O. Legaspi, “PHL Says It Will ‘Secure Sovereignty’ if Challenged by China,” GMA News Online, April

  5. Looking at the future of manufacturing metrology: roadmap document of the German VDI/VDE Society for Measurement and Automatic Control

    OpenAIRE

    Berthold, J.; Imkamp, D.

    2013-01-01

    "Faster, safer, more accurately and more flexibly'' is the title of the "manufacturing metrology roadmap'' issued by the VDI/VDE Society for Measurement and Automatic Control (http://www.vdi.de/gma). The document presents a view of the development of metrology for industrial production over the next ten years and was drawn up by a German group of experts from research and industry. The following paper summarizes the content of the roadmap and explains the individual concepts of "Faster, safer...

  6. New Information Processing Techniques for Military Systems (les Nouvelles techniques de traitement de l’information pour les systemes militaires)

    Science.gov (United States)

    2001-04-01

    généralement nécessite le déploiement d’une ou de plusieurs bouées fonctionnant sur piles pour fournir une passerelle au nœud terrestre . Les conditions...diskreter Prozesse. In Proc. of VDI/ VDE GMA KongreJ Me& und Automa- tisierungstechnik, 1998. [2] A. Biere, A. Cimatti, E. Clarke, and Y. Zhu. Sym- bolic

  7. An Evaluation of the Marginal Sharpness of the Porcelain Labial Margin Metal Ceramic Restoration

    Science.gov (United States)

    1991-05-01

    these subgingival margins are open, significant bone resorption can result (Bjorn et al., 1969). Larato (1969a) examined 546 cast gold crowns and found...platinum foil was welded to the casting at three locations approximately 1.5 to 2 mm apart using an orthodontic spotwelder (Rocky Mountain Associates...individual stone dies with an autopolymerizing unfilled resin (Concise Orthodontic Bonding System, Dental Products/3M, St. Paul, MN). This Bis-GMA resin

  8. Crewstation Assessment of Reach as Applied to the OH-58A Helicopter

    Science.gov (United States)

    1984-12-13

    CLUSTER ENO ENO OFICE FIELD 0gMA BR? OMR BRI T CONSOLE LTS NST LTSI OFF OFF NO BRT MVO ANTI COLLISION FOS LTS Lii LTS OFF *OFF CFF OFF OFr AUTO Hyp...gINTER)-- 2 ANALISIS OPION(1-ALL OPERATORq,2-OPZRATORS ON LOS ONLY)--L 1 RFACH ALCORITHNl(lPASS THROUGH CONTROL,2-TERNINAIE &T CONTROL)-- 2 ***OPERATOR NO

  9. Does Trait Emotional Intelligence Predict Unique Variance in Early Career Success Beyond IQ and Personality?

    OpenAIRE

    Haro García, José Manuel de; Castejón Costa, Juan Luis

    2014-01-01

    In order to determine the contribution of emotional intelligence (EI) to career success, in this study, we analyzed the relationship between trait EI (TEI), general mental ability (GMA), the big five personality traits, and career success indicators, in a sample of 130 graduates who were in the early stages of their careers. Results from hierarchical regression analyses indicated that TEI, and especially its dimension “repair,” has incremental validity in predicting one of the career success ...

  10. Photopolymerization of highly filled dimethacrylate-based composites using Type I or Type II photoinitiators and varying co-monomer ratios.

    Science.gov (United States)

    Randolph, Luc D; Steinhaus, Johannes; Möginger, Bernhard; Gallez, Bernard; Stansbury, Jeffrey; Palin, William M; Leloup, Gaëtane; Leprince, Julian G

    2016-02-01

    The use of a Type I photoinitiator (monoacylphosphine oxide, MAPO) was described as advantageous in a model formulation, as compared to the conventional Type II photoinitiator (Camphorquinone, CQ). The aim of the present work was to study the kinetics of polymerization of various composite mixtures (20-40-60-80 mol%) of bisphenol A glycidyl dimethacrylate/triethylene glycol dimethacrylate (BisGMA/TegDMA) containing either CQ or MAPO, based on real-time measurements and on the characterization of various post-cure characteristics. Polymerization kinetics were monitored by Fourier-transform near-infrared spectroscopy (FT-NIRS) and dielectric analysis (DEA). A range of postcure properties was also investigated. FT-NIRS and DEA proved complementary to follow the fast kinetics observed with both systems. Autodecceleration occurred after ≈1 s irradiation for MAPO-composites and ≈5-10 s for CQ-composites. Conversion decreased with increasing initial viscosity for both photoinitiating systems. However despite shorter light exposure (3s for MAPO vs 20s for CQ-composites), MAPO-composites yielded higher conversions for all co-monomer mixtures, except at 20 mol% BisGMA, the less viscous material. MAPO systems were associated with increased amounts of trapped free radicals, improved flexural strength and modulus, and reduced free monomer release for all co-monomer ratios, except at 20 mol% BisGMA. This work confirms the major influence of the initiation system both on the conversion and network cross-linking of highly-filled composites, and further highlights the advantages of using MAPO photoinitiating systems in highly-filled dimethacrylate-based composites provided that sufficient BisGMA content (>40 mol%) and adapted light spectrum are used. Copyright © 2015 Academy of Dental Materials. Published by Elsevier Ltd. All rights reserved.

  11. Preparation and characterization of two types of covalently immobilized amyloglucosidase

    Directory of Open Access Journals (Sweden)

    ZORAN VUJCIC

    2005-05-01

    Full Text Available Amyloglucosidase from A. niger was covalently immobilized onto poly (GMA-co-EGDMA by the glutaraldehyde and periodate method. The immobilization of amyloglucosidase after periodate oxidation gave a preparate with the highest specific activity reported so far on similar polymers. The obtained immobilized preparates show the same pH optimum, but a higher temperature optimum compared with the soluble enzyme. The kinetic parameters for the hydrolysis of soluble starch by free and both immobilized enzymes were determined.

  12. Effects of feeding grains naturally contaminated with Fusarium mycotoxins on brain regional neurochemistry of laying hens, turkey poults, and broiler breeder hens.

    Science.gov (United States)

    Yegani, M; Chowdhury, S R; Oinas, N; MacDonald, E J; Smith, T K

    2006-12-01

    Three experiments were conducted to compare the effects of feeding blends of grains naturally contaminated with Fusarium mycotoxins on brain regional neurochemistry of laying hens, turkey poults, and broiler breeder hens. In Experiment 1, thirty-six 45-wk-old laying hens were fed diets including the following for 4 wk: 1) control, 2) contaminated grains, and 3) contaminated grains + 0.2% polymeric glucomannan mycotoxin adsorbent (GMA). Concentrations of brain neurotransmitters and metabolites were analyzed in pons, hypothalamus, and cortex by HPLC with electrochemical detection. Neurotransmitters and the metabolites measured included dopamine, 3,4-dihydroxylphenyacetic acid, homovanillic acid, serotonin [5-hydroxytryptamine (5-HT)], 5-hydroxyindolacetic acid, epinephrine, and norepinephrine. The feeding of contaminated grains significantly increased concentrations of 5-HT and decreased the 5-hydroxyindolacetic acid:5-HT in the pons region in the brain stem. Dietary supplementation with GMA prevented these effects. There was no effect of diet on concentrations of other neurotransmitters or metabolites in the pons, hypothalamus, or cortex. In Experiment 2, thirty-six 1-d-old turkey poults were fed diets including the following for 4 wk: 1) control, 2) contaminated grains, and 3) contaminated grains + 0.2% GMA. Hypothalamic, pons, and cortex neurotransmitter concentrations were not affected by diet. In Experiment 3, forty-two 26-wk-old broiler breeder hens were fed diets including the following for 15 wk: 1) control, 2) contaminated grains, and 3) contaminated grains + 0.2% GMA. There was no effect of diet on neurotransmitter concentrations in the pons, hypothalamus, or cortex. It was concluded that differences in intraspecies effects of these mycotoxins on brain neurotransmitter concentrations might explain the intraspecies differences in the severity of Fusarium mycotoxin-induced reductions in feed intake.

  13. Increasing productivity by improved arc and beam welding technologies

    International Nuclear Information System (INIS)

    Dilthey, Ulrich; Stein, Lars

    2005-01-01

    In the early sixties, GMA welding methods were introduced into industrial manufacturing and they have been consequently developed further ever since. Recent advances do not only refer to power-source technology but also improved wire feed systems and new consumables such as filler materials and shielding gases. Great efforts have been made to increase deposition rates, and with this efficiency and welding speeds, by extending the frontiers of known processes and by developing new ones

  14. Joining Pipe with the Hybrid Laser-GMAW Process: Weld Test Results and Cost Analysis

    Science.gov (United States)

    2006-06-01

    GMAW head separations an additional gas nozzle directed N2 gas at the laser keyhole for plasma suppression and supplemental shielding. Experiments were...beam weld and GMA weld taking place simultaneously in close prox- i m i t y. It has been noted in the literature that hy- brid often refers to laser ...near the beginning and end of the weld. Laser beam keyhole instability may be the cause. Ongoing investigations are being undertaken to determine the

  15. Real-Time Tracking of Neighborhood Surroundings and Mood in Urban Drug Misusers: Application of a New Method to Study Behavior in Its Geographical Context

    Science.gov (United States)

    Epstein, David H.; Tyburski, Matthew; Craig, Ian M.; Phillips, Karran A.; Jobes, Michelle L.; Vahabzadeh, Massoud; Mezghanni, Mustapha; Lin, Jia-Ling; Furr-Holden, C. Debra M.; Preston, Kenzie L.

    2013-01-01

    Background Maladaptive behaviors may be more fully understood and efficiently prevented by ambulatory tools that assess people’s ongoing experience in the context of their environment. Methods To demonstrate new field-deployable methods for assessing mood and behavior as a function of neighborhood surroundings (Geographical Momentary Assessment; GMA), we collected time-stamped GPS data and Ecological Momentary Assessment (EMA) ratings of mood, stress, and drug craving over 16 weeks at randomly prompted times during the waking hours of opioid-dependent polydrug users receiving methadone maintenance. Locations of EMA entries and participants’ travel tracks were calculated for the 12 hours before each EMA entry were mapped. Associations between subjective ratings and objective environmental ratings were evaluated at the whole neighborhood and 12-hour track levels. Results Participants (N=27) were compliant with GMA data collection; 3,711 randomly prompted EMA entries were matched to specific locations. At the neighborhood level, physical disorder was negatively correlated with negative mood, stress, and heroin and cocaine craving (ps <.0001 to .0335); drug activity was negatively correlated with stress, heroin and cocaine craving (ps .0009 to .0134). Similar relationships were found for the environments around respondents’ tracks in the 12 hours preceding EMA entries. Conclusions The results support the feasibility of GMA. The relationships between neighborhood characteristics and participants’ reports were counterintuitive and counter-hypothesized, and challenge some assumptions about how ostensibly stressful environments are associated with lived experience and how such environments ultimately impair health. GMA methodology may have applications for development of individual- or neighborhood-level interventions. PMID:24332365

  16. Evaluation of an Experimental Adhesive Resin for Orthodontic Bonding

    Science.gov (United States)

    Durgesh, B. H.; Alkheraif, A. A.; Pavithra, D.; Hashem, M. I.; Alkhudhairy, F.; Elsharawy, M.; Divakar, D. D.; Vallittu, P. K.; Matinlinna, J. P.

    2017-07-01

    The aim of this study was to evaluate in vitro the effect of an experimental adhesive resin for orthodontic bonding by measuring some the chemical and mechanical properties. The resin demonstrated increased values of nanohardness and elastic modulus, but the differences were not significant compared with those for the Transbond XT adhesives. The experimental adhesive resin could be a feasible choice or a substitute for the traditional bis-GMA-based resins used in bonding orthodontic attachments.

  17. Poly(Poly(Ethylene Glycol Methyl Ether Methacrylate Grafted Chitosan for Dye Removal from Water

    Directory of Open Access Journals (Sweden)

    Bryan Tsai

    2017-03-01

    Full Text Available As the demand for textile products and synthetic dyes increases with the growing global population, textile dye wastewater is becoming one of the most significant water pollution contributors. Azo dyes represent 70% of dyes used worldwide, and are hence a significant contributor to textile waste. In this work, the removal of a reactive azo dye (Reactive Orange 16 from water by adsorption with chitosan grafted poly(poly(ethylene glycol methyl ether methacrylate (CTS-GMA-g-PPEGMA was investigated. The chitosan (CTS was first functionalized with glycidyl methacrylate and then grafted with poly(poly(ethylene glycol methyl ether methacrylate using a nitroxide-mediated polymerization grafting to approach. Equilibrium adsorption experiments were carried out at different initial dye concentrations and were successfully fitted to the Langmuir and Freundlich adsorption isotherm models. Adsorption isotherms showed maximum adsorption capacities of CTS-g-GMA-PPEGMA and chitosan of 200 mg/g and 150 mg/g, respectively, while the Langmuir equations estimated 232 mg/g and 194 mg/g, respectively. The fundamental assumptions underlying the Langmuir model may not be applicable for azo dye adsorption, which could explain the difference. The Freundlich isotherm parameters, n and K, were determined to be 2.18 and 17.7 for CTS-g-GMA-PPEGMA and 0.14 and 2.11 for chitosan, respectively. An “n” value between one and ten generally indicates favorable adsorption. The adsorption capacities of a chitosan-PPEGMA 50/50 physical mixture and pure PPEGMA were also investigated, and both exhibited significantly lower adsorption capacities than pure chitosan. In this work, CTS-g-GMA-PPEGMA proved to be more effective than its parent chitosan, with a 33% increase in adsorption capacity.

  18. Interactions between resin monomers and commercial composite resins with human saliva derived esterases.

    Science.gov (United States)

    Jaffer, F; Finer, Y; Santerre, J P

    2002-04-01

    Cholesterol esterase (CE) and pseudocholinesterase (PCE) have been reported to degrade commercial and model composite resins containing bisphenylglycidyl dimethacrylate (BisGMA), triethylene glycol dimethacrylate (TEGDMA) or the latter in combination with urethane modified BisGMA monomer systems. In addition, human saliva has been shown to contain esterase like activities similar to CE and PCE. Hence, it was the aim of the current study to determine to what extent human saliva could degrade two common commercial composite resins (Z250 from 3M Inc. and Spectrum TPH from L.D. Caulk) which contain the above monomer systems. Saliva samples from different volunteers were collected, processed, pooled, and freeze-dried. TEGDMA and BisGMA monomers were incubated with human saliva derived esterase activity (HSDEA) and their respective hydrolysis was monitored using high performance liquid chromatography (HPLC). Both monomers were completely hydrolyzed within 25 h by HSDEA. Photopolymerized composites were incubated with buffer or human saliva (pH 7.0 and 37 C) for 2, 8 and 16 days. The incubation solutions were analyzed using HPLC and mass spectrometry. Surface morphology characterization was carried out using scanning electron microscopy. Upon biodegradation, the Z250 composite yielded higher amounts of BisGMA and TEGDMA related products relative to the TPH composite. However, there were higher amounts of ethoxylated bis-phenol A released from the TPH material. In terms of total mass of products released, human saliva demonstrated a greater ability to degrade Z250. In summary, HSDEA has been shown to contain esterase activities that can readily catalyze the biodegradation of current commercial composite resins.

  19. The selection of ultrasonic transducers for inspection of pipeline girth welds. Vol. 3. Evaluation of the pitch-catch technique for examination of the body region

    Energy Technology Data Exchange (ETDEWEB)

    Glover, A G; Fingerhut, M P; Dorling, D V

    1988-10-01

    Research was conducted to develop an ultrasonic inspection design for the nondestructive evaluation of pipeline girth welds made by the mechanized gas metal arc (GMA) welding process for onshore and offshore pipeline construction. This report describes the work carried out to evaluate the performance to the pitch-catch technique with respect to its ability to examine the body region of mechanized GMA welds in 19.5 mm thick material. Evaluation of the pitch-catch technique was carried out on simulated and real weld defects. Results show that an inspection design method and criteria can be specified for the detection of lack of sidewall fusion defects in the body region of mechanized GMA welds. The criteria specified a pitch-catch technique using a 2.25 MHz 45{degrees} transmitter and a 2.25 MHz 55{degrees} receiver probe. A single pair of these transducers can inspect wall thickness from 9.7 mm to 23.0 mm. The pitch-catch technique evaluated on 19.5 mm wall thickness materials demonstrated that the detection goal of projected depth with a signal-to-noise ratio of greater than 12dB could be met, and that no problems occurred with false indications or missed defects. High sensitivities to small defects in the body region were obtained using a single pair of pitch-catch probes that inspected the body region as a single plane. 4 refs., 14 figs., 6 tabs.

  20. Do the monomers release from the composite resins after artificial aging?

    Science.gov (United States)

    Tokay, Ugur; Koyuturk, Alp Erdin; Aksoy, Abdurrahman; Ozmen, Bilal

    2015-04-01

    The aim of this study is to measure the effect of thermal cycling on the amount of monomer released from three different composite materials by HPLC analysis method. Three different composite materials, inlay composite, posterior composite and micro-hybrid composite were used. Sixty cylinder specimens each with a dimension of approximately 1 cm width and 3 mm depth, were prepared before experiments were carried out. Inlay composite material was polymerized according to manufacturers' instructions. Thermal cycling device was used to simulate thermal differences which occur in the mouth media. Monomers were analyzed using HPLC technic after thermal cycling process. The amount of ethoxylated Bis-GMA and urethane dimethacrylate (UDMA) in inlay composite material, the amount of ethoxylated Bis-GMA in posterior composite material, the amount of ethoxylated Bis-GMA and triethyleneglycol dimethacrylate (TEGDMA) in micro-hybrid composite material were investigated. Monomer release of thermal cycles levels showed a linear increase in UDMA and TEGDMA (P < 0.05). In terms of thermal cycles levels, Bis-EMA released from posterior composite showed a cubic change (P < 0.001). It was observed that use of additional polymerization processes might have positive effect on the decrease of residual monomer. In the light of the results, we suggest that indirect composite resins have more outstanding features than direct composite resins in terms of biocompatibility. © 2015 Wiley Periodicals, Inc.

  1. Adsorption behavior of Urokinase by the polypropylene film with amine, hydroxylamine and polyol groups

    International Nuclear Information System (INIS)

    Lee, Kwang-Pill; Kang, Hae-Jeong; Joo, Duck-Lae; Choi, Seong-Ho

    2001-01-01

    For the purpose of the recovery of urokinase, the polypropylene (PP) films were modified by radiation-induced grafting of glycidylmethacrylate (GMA) and subsequent chemical modification of epoxy group of poly-GMA graft chains. The physical and chemical properties of the irradiated PP film, GMA-grafted PP film and the PP films modified with trimethylamine (TMA), hydroxylamine (HA), diethanolamine (DEA), and tri(hydroxymethyl)aminomethane (THMAM) were investigated by IR, SEM, and XPS. The adsorption of urokinase for the PP films modified with TMA, HA, DEA, and THMAM group were examined under various conditions of the functional group content, pH value and salt. It increased with increasing the content of functional group. The adsorption behavior of the PP films modified for different functional groups was in the following order: TMA>DEA>THMAM>HA. The adsorption of urokinase by the PP films with various functional groups at pH=7.4 were higher than that at pH=9.0. In TMA, DEA, and THMAM groups, the adsorption of urokinase without salts was also higher than those with salts. (author)

  2. Mechanical, Thermal Degradation, and Flammability Studies on Surface Modified Sisal Fiber Reinforced Recycled Polypropylene Composites

    Directory of Open Access Journals (Sweden)

    Arun Kumar Gupta

    2012-01-01

    Full Text Available The effect of surface treated sisal fiber on the mechanical, thermal, flammability, and morphological properties of sisal fiber (SF reinforced recycled polypropylene (RPP composites was investigated. The surface of sisal fiber was modified with different chemical reagent such as silane, glycidyl methacrylate (GMA, and O-hydroxybenzene diazonium chloride (OBDC to improve the compatibility with the matrix polymer. The experimental results revealed an improvement in the tensile strength to 11%, 20%, and 31.36% and impact strength to 78.72%, 77%, and 81% for silane, GMA, and OBDC treated sisal fiber reinforced recycled Polypropylene (RPP/SF composites, respectively, as compared to RPP. The thermogravimetric analysis (TGA, differential scanning calorimeter (DSC, and heat deflection temperature (HDT results revealed improved thermal stability as compared with RPP. The flammability behaviour of silane, GMA, and OBDC treated SF/RPP composites was studied by the horizontal burning rate by UL-94. The morphological analysis through scanning electron micrograph (SEM supports improves surface interaction between fiber surface and polymer matrix.

  3. Radiation modification of silicone rubber with glycidylmethacrylate

    International Nuclear Information System (INIS)

    Segura, Tania; Burillo, Guillermina

    2013-01-01

    The grafting of glycidilmethacrylate(GMA) was grafted onto silicone rubber (SR) by using the γ-ray pre-irradiation grafting method under different conditions. The effect of reaction time, total dose, reaction temperature and monomer concentration on the graft yield was studied. It was found that the degree of grafting can be controlled by adjusting these parameters. The chemical structure of SR before and after grafting was characterized using FTIR-ATR and SEM–EDS. The analysis revealed that the surface of the SR was uniformly covered by GMA and the cross-section analysis indicated that the grafting occurred in the bulk. Thermogravimetric analysis (TGA) showed that the graft copolymer was more thermally stable than polyglycidylmethacrylate but less stable than SR, and the DSC confirmed that the GMA was grafting onto silicone rubber. - Highlights: • A graft copolymer with silicone rubber was synthesized by gamma pre-irradiation method. • SEM–EDS analysis showed that the surface and the bulk of the new copolymer were grafted. • The thermal properties of the silicone rubber used were modified with grafting. • The new copolymer could be used to immobilize nucleophilic biomolecules

  4. Synthesis and effect of modification on methacylate - acrylate microspheres for Trametes versicolor laccase enzyme immobilization

    Science.gov (United States)

    Mazlan, Siti Zulaikha; Hanifah, Sharina Abu

    2014-09-01

    Immobilization of laccase on the modified copolymer methacrylate-acrylate microspheres was studied. A poly (glycidyl methacrylate-co-n-butyl acrylate) microsphere consists of epoxy groups were synthesized using suspension photocuring technique. The epoxy group in poly (GMA-nBA) microspheres were converted into amino groups with aldehyde group. Laccase immobilization is based on having the amino groups on the enzyme surface and aldehyde group on the microspheres via covalent binding. Fourier transform infrared spectroscopy (FT-IR) analysis proved the successful surface modification on microspheres. The FTIR spectrum shows the characteristic peaks at 1646 cm-1 assigned to the conformation of the polymerization that took place between monomer GMA and nBA respectively. In addition, after modification, FTIR peaks that assigned to the epoxy ring (844 cm-1 and 904 cm-1) were decreased. The results obtained from FTIR method signify good agreement with the epoxy content method. Hence, the activity of the laccase-immobilized microspheres increased upon increasing the epoxy content. Furthermore, poly (GMA-nBA) exhibited uniform microspheres with below 2 μm surface. Immobilized enzyme showed a broader pH profile and higher temperature compared native enzyme.

  5. Effect of increased exposure times on amount of residual monomer released from single-step self-etch adhesives.

    Science.gov (United States)

    Altunsoy, Mustafa; Botsali, Murat Selim; Tosun, Gonca; Yasar, Ahmet

    2015-10-16

    The aim of this study was to evaluate the effect of increased exposure times on the amount of residual Bis-GMA, TEGDMA, HEMA and UDMA released from single-step self-etch adhesive systems. Two adhesive systems were used. The adhesives were applied to bovine dentin surface according to the manufacturer's instructions and were polymerized using an LED curing unit for 10, 20 and 40 seconds (n = 5). After polymerization, the specimens were stored in 75% ethanol-water solution (6 mL). Residual monomers (Bis-GMA, TEGDMA, UDMA and HEMA) that were eluted from the adhesives (after 10 minutes, 1 hour, 1 day, 7 days and 30 days) were analyzed by high-performance liquid chromatography (HPLC). The data were analyzed using 1-way analysis of variance and Tukey HSD tests. Among the time periods, the highest amount of released residual monomers from adhesives was observed in the 10th minute. There were statistically significant differences regarding released Bis-GMA, UDMA, HEMA and TEGDMA between the adhesive systems (p<0.05). There were no significant differences among the 10, 20 and 40 second polymerization times according to their effect on residual monomer release from adhesives (p>0.05). Increasing the polymerization time did not have an effect on residual monomer release from single-step self-etch adhesives.

  6. Quantitative analysis of aqueous phase composition of model dentin adhesives experiencing phase separation

    Science.gov (United States)

    Ye, Qiang; Park, Jonggu; Parthasarathy, Ranganathan; Pamatmat, Francis; Misra, Anil; Laurence, Jennifer S.; Marangos, Orestes; Spencer, Paulette

    2013-01-01

    There have been reports of the sensitivity of our current dentin adhesives to excess moisture, for example, water-blisters in adhesives placed on over-wet surfaces, and phase separation with concomitant limited infiltration of the critical dimethacrylate component into the demineralized dentin matrix. To determine quantitatively the hydrophobic/hydrophilic components in the aqueous phase when exposed to over-wet environments, model adhesives were mixed with 16, 33, and 50 wt % water to yield well-separated phases. Based upon high-performance liquid chromatography coupled with photodiode array detection, it was found that the amounts of hydrophobic BisGMA and hydrophobic initiators are less than 0.1 wt % in the aqueous phase. The amount of these compounds decreased with an increase in the initial water content. The major components of the aqueous phase were hydroxyethyl methacrylate (HEMA) and water, and the HEMA content ranged from 18.3 to 14.7 wt %. Different BisGMA homologues and the relative content of these homologues in the aqueous phase have been identified; however, the amount of crosslinkable BisGMA was minimal and, thus, could not help in the formation of a crosslinked polymer network in the aqueous phase. Without the protection afforded by a strong crosslinked network, the poorly photoreactive compounds of this aqueous phase could be leached easily. These results suggest that adhesive formulations should be designed to include hydrophilic multimethacrylate monomers and water compatible initiators. PMID:22331596

  7. Assessing needs and assets for building a regional network infrastructure to reduce cancer related health disparities.

    Science.gov (United States)

    Wells, Kristen J; Lima, Diana S; Meade, Cathy D; Muñoz-Antonia, Teresita; Scarinci, Isabel; McGuire, Allison; Gwede, Clement K; Pledger, W Jack; Partridge, Edward; Lipscomb, Joseph; Matthews, Roland; Matta, Jaime; Flores, Idhaliz; Weiner, Roy; Turner, Timothy; Miele, Lucio; Wiese, Thomas E; Fouad, Mona; Moreno, Carlos S; Lacey, Michelle; Christie, Debra W; Price-Haywood, Eboni G; Quinn, Gwendolyn P; Coppola, Domenico; Sodeke, Stephen O; Green, B Lee; Lichtveld, Maureen Y

    2014-06-01

    Significant cancer health disparities exist in the United States and Puerto Rico. While numerous initiatives have been implemented to reduce cancer disparities, regional coordination of these efforts between institutions is often limited. To address cancer health disparities nation-wide, a series of regional transdisciplinary networks through the Geographic Management Program (GMaP) and the Minority Biospecimen/Biobanking Geographic Management Program (BMaP) were established in six regions across the country. This paper describes the development of the Region 3 GMaP/BMaP network composed of over 100 investigators from nine institutions in five Southeastern states and Puerto Rico to develop a state-of-the-art network for cancer health disparities research and training. We describe a series of partnership activities that led to the formation of the infrastructure for this network, recount the participatory processes utilized to develop and implement a needs and assets assessment and implementation plan, and describe our approach to data collection. Completion, by all nine institutions, of the needs and assets assessment resulted in several beneficial outcomes for Region 3 GMaP/BMaP. This network entails ongoing commitment from the institutions and institutional leaders, continuous participatory and engagement activities, and effective coordination and communication centered on team science goals. Copyright © 2014 Elsevier Ltd. All rights reserved.

  8. Abaca/polyester nonwoven fabric functionalization for metal ion adsorbent synthesis via electron beam-induced emulsion grafting

    Science.gov (United States)

    Madrid, Jordan F.; Ueki, Yuji; Seko, Noriaki

    2013-09-01

    A metal ion adsorbent was developed from a nonwoven fabric trunk material composed of both natural and synthetic polymers. A pre-irradiation technique was used for emulsion grafting of glycidyl methacrylate (GMA) onto an electron beam irradiated abaca/polyester nonwoven fabric (APNWF). The dependence of degree of grafting (Dg), calculated from the weight of APNWF before and after grafting, on absorbed dose, reaction time and monomer concentration were evaluated. After 50 kGy irradiation with 2 MeV electron beam and subsequent 3 h reaction with an emulsion consisting of 5% GMA and 0.5% polyoxyethylene sorbitan monolaurate (Tween 20) surfactant in deionized water at 40 °C, a grafted APNWF with a Dg greater than 150% was obtained. The GMA-grafted APNWF was further modified by reaction with ethylenediamine (EDA) in isopropyl alcohol at 60 °C to introduce amine functional groups. After a 3 h reaction with 50% EDA, an amine group density of 2.7 mmole/gram adsorbent was achieved based from elemental analysis. Batch adsorption experiments were performed using Cu2+ and Ni2+ ions in aqueous solutions with initial pH of 5 at 30 °C. Results show that the adsorption capacity of the grafted adsorbent for Cu2+ is four times higher than Ni2+ ions.

  9. Desalination by electrodialysis with ion-exchange membrane prepared by radiation-induced graft polymerization

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Seong-Ho; Jeong, Young Han; Ryoo, Jae Jeong; Lee, Kwang-Pill [Department of Chemistry Graduate School, Kyungpook National University, Taegu (Korea)

    2000-07-01

    Ion-exchange membranes modified with triethylamine [-N(CH{sub 2}CH{sub 3}){sub 3}] and phosphoric acid (-PO{sub 3}H) groups were prepared by radiation-induced grafting of glycidyl methacrylate (GMA) onto polyolefin nonwavon fabric (PNF) and subsequent chemical modification of poly (GMA) graft chains. The physical and chemical properties of the GMA-grafted PNF and the PNF modified with ion-exchange groups were investigated by SEM and XPS. The ion-exchange capacities of the cation- and anion-exchange membrane were 0.20 and 1.24mmol/g, respectively. The content of cation- and anion exchange group increased with increasing grafting yield (d.g.=100%). Electrical resistance of PNF modified with TEA and -PO{sub 3}H group decreased with increasing ion-exchange group capacities. Application of the graft-type ion-exchange membranes as separators for electrodialysis enabled use to reduce the time required to achieve 85.5% desalination of the 0.5M NaCl solution. (author)

  10. Desalination by electrodialysis with the ion-exchange membrane prepared by radiation-induced graft polymerization

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Seong-Ho; Han Jeong, Young; Jeong Ryoo, Jae; Lee, Kwang-Pill E-mail: kplee@kyungpook.ac.kr

    2001-07-01

    Ion-exchange membranes modified with the triethylamine [-N(CH{sub 2}CH{sub 3}){sub 3}] and phosphoric acid (-PO{sub 3} H) groups were prepared by radiation-induced grafting of glycidyl methacrylate (GMA) onto the polyolefin nonwavon fabric (PNF) and subsequent chemical modification of poly(GMA) graft chains. The physical and chemical properties of the GMA-grafted PNF and the PNF modified with ion-exchange groups were investigated by SEM, XPS, TGA, and DSC. Furthermore, electrochemical properties such as specific electric resistance, transport number of K{sup +}, and desalination were examined. The grafting yield increased with increasing reaction time and reaction temperature. The maximum grafting yield was obtained with 40% (vol.%) monomer concentration in dioxane at 60 deg. C. The content of the cation- and anion-exchange group increased with increasing grafting yield. Electrical resistance of the PNF modified with TEA and -PO{sub 3} H group decreased, while the water uptake (%) increased with increasing ion-exchange group capacities. Transport number of the PNF modified with ion-exchange group were the range of ca. 0.82-0.92. The graft-type ion-exchange membranes prepared by radiation-induced graft copolymerization were successfully applied as separators for electrodialysis. (author)

  11. A strategy to develop and implement Canadian standards for quality assurance in radiation therapy

    International Nuclear Information System (INIS)

    1999-05-01

    In Canada, the Atomic Energy Control Board (AECB) regulates the limits of radiation exposure to the public and to workers in industry. In 1993, it discussed the fact that the safety of radiation therapy patients who receive medical exposures is not regulated [AE93]. The Group of Medical Advisors (GMA) to the AECB initiated a research contract to review quality assurance in Canadian radiation oncology centres and nuclear medicine departments. The review [MA95] revealed that the level of quality assurance in radiation therapy facilities varied across the country. As a result, the GMA undertook its own review of quality assurance in radiation therapy centres and made recommendations on how to achieve a uniform national system [MA98]. In response to the GMA report, the President of the AECB formed a Joint Working Group (JWG-11) to propose how Canadian Standards for Quality Assurance in Radiation Therapy could be developed and implemented. These national standards for quality assurance will serve as a common basis for establishing and evaluating quality assurance programs at individual radiation therapy centres. These standards should address the structure of quality assurance programs and quality assurance for radiation therapy equipment, personnel, and procedures. (author)

  12. Thermal and Mechanical Properties of Poly(butylene succinate Films Reinforced with Silica

    Directory of Open Access Journals (Sweden)

    Sangviroon Nanthaporn

    2015-01-01

    Full Text Available In recent year, bioplastics have become more popular resulting from the growing concerns on environmental issues and the rising fossil fuel price. However, their applications were limited by its mechanical and thermal properties. The aim of this research is thus to improve mechanical and thermal properties of PBS bioplastic films by reinforcing with silica. Due to the poor interfacial interaction between the PBS matrix and silica, glycidyl methacrylate grafted poly(butylene succinate (PBS-g-GMA was used as a compatibilizer in order to improve the interaction between bioplastic films and filler. PBS-g-GMA was prepared in a twin-screw extruder and analyzed by the FTIR spectrometer. PBS and silica were then mixed in a twin-screw extruder and processed into films by a chill-roll cast extruder. The effects of silica loading on thermal and mechanical properties of the prepared bioplastic films were investigated. It was found that the mechanical properties of PBS/silica composite films were improved when 1%wt of silica was added. However, the mechanical properties decreased with increasing silica loading due to the agglomeration of silica particles. The results also show that the silica/PBS films with PBS-g-GMA possessed improved mechanical properties over the films without the compatibilizer.

  13. Design and experimental study of a novel giant magnetostrictive actuator

    Energy Technology Data Exchange (ETDEWEB)

    Xue, Guangming, E-mail: yy0youxia@163.com [Vehicle and Electrical Engineering Department, Ordnance Engineering College, Shijiazhuang, 050003 China (China); Zhang, Peilin; He, Zhongbo; Li, Dongwei; Huang, Yingjie [Vehicle and Electrical Engineering Department, Ordnance Engineering College, Shijiazhuang, 050003 China (China); Xie, Wenqiang [Cadre Rotational Training Brigade, Ordnance Engineering College, Shijiazhuang, 050003 China (China)

    2016-12-15

    Giant magnetostrictive actuator has been widely used in precise driving occasions for its excellent performance. However, in driving a switching valve, especially the ball-valve in an electronic controlled injector, the actuator can’t exhibit its good performance for limits in output displacement and responding speed. A novel giant magnetostrictive actuator, which can reach its maximum displacement for being exerted with no bias magnetic field, is designed in this paper. Simultaneously, elongating of the giant magetostrictive material is converted to shortening of the actuator's axial dimension with the help of an output rod in “T” type. Furthermore, to save responding time, the driving voltage with high opening voltage while low holding voltage is designed. Responding time and output displacement are studied experimentally with the help of a measuring system. From measured results, designed driving voltage can improve the responding speed of actuator displacement quite effectively. And, giant magnetostrictive actuator can output various steady-state displacements to reach more driving effects. - Highlights: • GMA with zero bias magnetic field can reach maximum displacement in one direction. • Driving wave with high opening voltage can promote GMA's responding speed. • Higher opening voltage is exerted, less rise time is reached. • Continuous displacements from 0 to maximum value can be achieved by GMA.

  14. Effects of Temperature and pH on Immobilized Laccase Activity in Conjugated Methacrylate-Acrylate Microspheres

    Directory of Open Access Journals (Sweden)

    Siti Zulaikha Mazlan

    2017-01-01

    Full Text Available Immobilization of laccase on the functionalized methacrylate-acrylate copolymer microspheres was studied. Poly(glycidyl methacrylate-co-n-butyl acrylate microspheres consisting of epoxy groups were synthesized using facile emulsion photocuring technique. The epoxy groups in poly(GMA-co-nBA microspheres were then converted to amino groups. Laccase immobilization is based on covalent binding via amino groups on the enzyme surface and aldehyde group on the microspheres. The FTIR spectra showed peak at 1646 cm−1 assigned to the conformation of the polymerization that referred to GMA and nBA monomers, respectively. After modification of the polymer, intensity of FTIR peaks assigned to the epoxy ring at 844 cm−1 and 904 cm−1 was decreased. The results obtained from FTIR exhibit a good agreement with the epoxy content method. The activity of laccase-immobilized microspheres increased upon increasing the epoxy content. Furthermore, poly(GMA-co-nBA microspheres revealed uniform size below 2 µm that contributes to large surface area of the microspheres to be used as a matrix, thus increasing the enzyme capacity and enzymatic reaction. Immobilized enzyme also shifted to higher pH and temperature compared to free enzyme.

  15. Prolonged treatment with transcutaneous electrical nerve stimulation (TENS) modulates neuro-gastric motility and plasma levels of vasoactive intestinal peptide (VIP), motilin and interleukin-6 (IL-6) in systemic sclerosis.

    Science.gov (United States)

    McNearney, Terry A; Sallam, Hanaa S; Hunnicutt, Sonya E; Doshi, Dipti; Chen, Jiande D Z

    2013-01-01

    We assessed the effects of transcutaneous electrical nerve stimulation (TENS) on neurogastric functioning in scleroderma patients. Seventeen SSc patients underwent 30 min TENS treatment >10Hz at GI acupuncture points PC6 and ST36, once (acute TENS) and then after two weeks of TENS sessions for 30 min twice daily (prolonged TENS). Data collected at Visits 1 and 2 included gastric myoelectrical activity (GMA) by surface electrogastrography (EGG), heart rate variability (HRV) by surface electrocardiography (EKG), GI specific symptoms and health related SF-36 questionnaires. Plasma VIP, motilin and IL-6 levels were determined. Statistical analyses were performed by Student's t-test, Spearman Rank and p-values TENS, the percentages of normal slow waves and average slow wave coupling (especially channels 1, 2 reflecting gastric pacemaker and corpus regions) were significantly increased; 2. the percentage of normal slow waves was significantly correlated to sympathovagal balance; 3. Mean plasma VIP and motilin levels were significantly decreased after acute TENS, (vs. baseline), generally maintained in the prolonged TENS intervals. Compared to baseline, mean plasma IL-6 levels were significantly increased after acute TENS, but significantly decreased after prolonged TENS. 4. After prolonged TENS, the frequency of awakening due to abdominal pain and abdominal bloating were significantly and modestly decreased, respectively. In SSc patients, two weeks of daily TENS improved patient GMA scores, lowered plasma VIP, motilin and IL-6 levels and improved association between GMA and sympathovagal balance. This supports the therapeutic potential of prolonged TENS to enhance gastric myoelectrical functioning in SSc.

  16. Sweet’s Syndrome Successfully Treated with Granulocyte and Monocyte Adsorption Apheresis

    Directory of Open Access Journals (Sweden)

    Asami Fujii

    2017-05-01

    Full Text Available Sweet’s syndrome is a neutrophilic dermatosis characterized by an abrupt onset of painful erythematous lesions showing neutrophilic infiltrates in the dermis. Fever and an elevated neutrophil level are generally observed. Sweet’s syndrome may be idiopathic, malignancy-associated, or drug-induced (mainly involving granulocyte colony-stimulating factor (G-CSF administration. Although systemic corticosteroids are usually effective, the symptoms of Sweet’s syndrome recur in some refractory cases. Herein, we report a case of a 55-year-old Japanese woman with recurrent symptoms of fever (>39°C and painful erythematous lesions on her four extremities, trunk, and neck. Laboratory findings revealed leukocytosis and high levels of C-reactive protein (CRP and G-CSF. She was diagnosed with a recurrence of Sweet’s syndrome, and was exclusively treated with granulocyte and monocyte adsorption apheresis (GMA therapy once a week for 3 consecutive weeks. After the first session of GMA therapy, all symptoms including the erythematous lesions and fever were completely resolved, and serum G-CSF level was reduced. Leukocyte count, neutrophil count, serum amyloid A protein, and CRP levels were restored within normal ranges by 2 weeks. Thus, GMA therapy can successfully treat a patient with recurrent Sweet’s syndrome, potentially related to the restoration of elevated serum G-CSF levels.

  17. Resistance to Hydrogen Peroxide Highlights Gymnodinium catenatum (Dinophyceae) Sensitivity to Geomagnetic Activity.

    Science.gov (United States)

    Vale, Paulo

    2018-01-01

    The chain-forming dinoflagellate Gymnodinium catenatum was exposed to hydrogen peroxide. Microscopical examination revealed striking dose-response alterations in chain formation above 245 μm: singlets replaced the dominance of long chain formations. These observations were valid for cells acclimated to halogen light. Under fluorescent light, cells were more resistant to modifications in chain length after H 2 O 2 exposure. Growth along 9 h in the presence of extracellular H 2 O 2 followed an hormesis response in both light regimes. Under halogen light conditions, alterations in chain formation and net growth were related to culture time, inocula concentration and geomagnetic activity (GMA) in the proceeding hours. Below a 16 nT threshold in GMA average growth was 0%, while above 16 nT it was circa +9%, independently if the local static magnetic field was altered by a permanent magnet or not. Mycosporine-like amino acids that can have an antioxidant role and are easily oxidized decreased from 7.1 to 6.5 pg cell -1 (P < 0.05) under halogen light and exposure to 245 μm H 2 O 2 . GMA, as well as UV-A, increased stress responsiveness that can momentarily protect cells from extracellular H 2 O 2 addition. However, stress response is dependent on bio-availability of several micronutrients and macronutrients, many found at limiting concentrations in oceanic waters. © 2017 The American Society of Photobiology.

  18. Surface modifying of microporous PTFE capillary for bilirubin removing from human plasma and its blood compatibility

    International Nuclear Information System (INIS)

    Jin Gu; Yao Qizhi; Zhang Shanzi; Zhang Lei

    2008-01-01

    In this study, human serum albumin (HSA) was covalently immobilized onto the inner surface of microporous poly(tetrafluoroethylene) (MPTFE) capillaries for direct bilirubin removal from human plasma. To obtain active binding sites for HSA, the MPTFE capillaries were chemically functionalized by using a coating of poly(vinyl alcohol) (PVA)-glycidyl methacrylate (GMA) copolymers. Characterization of grafted MPTFE capillaries was verified by XPS, Fourier transform infrared spectroscopy (FT-IR), scanning electronic microscopy (SEM). Non-specific adsorption on the PVA-GMA coated capillary remains low (< 0.38 mg bilirubin/g), and higher affinity adsorption capacity, of up to 73.6 mg bilirubin/g polymer was obtained after HSA is immobilized. Blood compatibility of the grafted MPTFE capillary was evaluated by SEM and platelet rich plasma (PRP) contacting experiments. The experimental data on blood compatibility indicated that PVA-coated and PVA-GMA-HSA coated PTFE capillary showed a sharp suppress on platelets adhesion. The proposed method has the potential of serving in bilirubin removal in clinical application

  19. Methacrylate and acrylate allergy in dental personnel.

    Science.gov (United States)

    Aalto-Korte, Kristiina; Alanko, Kristiina; Kuuliala, Outi; Jolanki, Riitta

    2007-11-01

    Methacrylates are important allergens in dentistry. The study aimed to analyse patch test reactivity to 36 acrylic monomers in dental personnel in relation to exposure. We reviewed the test files at the Finnish Institute of Occupational Health from 1994 to 2006 for allergic reactions to acrylic monomers in dental personnel and analysed the clinical records of the sensitized patients. 32 patients had allergic reactions to acrylic monomers: 15 dental nurses, 9 dentists, and 8 dental technicians. The dentists and dental nurses were most commonly exposed to 2-hydroxyethyl methacrylate (2-HEMA), triethyleneglycol dimethacrylate (TREGDMA), and 2,2-bis[4-(2-hydroxy-3-methacryloxypropoxy) phenyl]propane (bis-GMA). 8 dentists and 12 dental nurses were allergic to 2-HEMA. The remaining dentist was positive to bis-GMA and other epoxy acrylates. The remaining 3 dental nurses reacted to diethyleneglycol diacrylate (DEGDA) or triethyleneglycol diacrylate (TREGDA), but not to monofunctional and multifunctional methacrylates. Our dental technicians were mainly exposed and sensitized to methyl methacrylate (MMA) and ethyleneglycol dimethacrylate (EGDMA). 1 technician reacted only to 2-HEMA, and another to ethyl methacrylate (EMA) and ethyl acrylate (EA). 2-HEMA was the most important allergen in dentists and dental nurses, and MMA and EGDMA in dental technicians. Reactions to bis-GMA, DEGDA, TREGDA, EMA and EA were relevant in some patients.

  20. Influence of the linking spacer length and type on the enantioseparation ability of β-cyclodextrin functionalized monoliths.

    Science.gov (United States)

    Guo, Jialiang; Xiao, Yuan; Lin, Yuanjing; Zhang, Qiaoxuan; Chang, Yiqun; Crommen, Jacques; Jiang, Zhengjin

    2016-05-15

    In order to investigate the effect of the linking spacer on the enantioseparation ability of β-cyclodextrin (β-CD) functionalized polymeric monoliths, three β-CD-functionalized organic polymeric monoliths with different spacer lengths were prepared by using three amino-β-CDs, i.e. mono-6-amino-6-deoxy-β-CD, mono-6-ethylenediamine-6-deoxy-β-CD, mono-6-hexamethylenediamine-6-deoxy-β-CD, as starting materials. These amino-β-CDs reacted with glycidyl methacrylate to produce functional monomers which were then copolymerized with ethylene dimethacrylate. The enantioseparation ability of the three monoliths was evaluated using 14 chiral acidic compounds, including mandelic acid derivatives, nonsteroidal anti-inflammatory drugs, N-derivatized amino acids, and chiral herbicides under optimum chromatographic conditions. Notably, the poly(GMA-NH2-β-CD-co-EDMA) column provides higher enantioresolution and enantioselectivity than the poly(GMA-EDA-β-CD-co-EDMA) and poly(GMA-HDA-β-CD-co-EDMA) columns for most tested chiral analytes. Furthermore, the enantioseparation performance of triazole-linker containing monoliths was compared to that of ethylenediamine-linker containing monoliths. The results indicate that the enantioselectivity of β-CD monolithic columns is strongly related to the length and type of spacer tethering β-CD to the polymeric support. Copyright © 2016 Elsevier B.V. All rights reserved.

  1. Assessing Needs and Assets for Building a Regional Network Infrastructure to Reduce Cancer Related Health Disparities

    Science.gov (United States)

    Wells, Kristen J.; Lima, Diana S.; Meade, Cathy D.; Muñoz-Antonia, Teresita; Scarinci, Isabel; McGuire, Allison; Gwede, Clement K.; Pledger, W. Jack; Partridge, Edward; Lipscomb, Joseph; Matthews, Roland; Matta, Jaime; Flores, Idhaliz; Weiner, Roy; Turner, Timothy; Miele, Lucio; Wiese, Thomas E.; Fouad, Mona; Moreno, Carlos S.; Lacey, Michelle; Christie, Debra W.; Price-Haywood, Eboni G.; Quinn, Gwendolyn P.; Coppola, Domenico; Sodeke, Stephen O.; Green, B. Lee; Lichtveld, Maureen Y.

    2015-01-01

    Significant cancer health disparities exist in the United States and Puerto Rico. While numerous initiatives have been implemented to reduce cancer disparities, regional coordination of these efforts between institutions is often limited. To address cancer health disparities nationwide, a series of regional transdisciplinary networks through the Geographic Management Program (GMaP) and the Minority Biospecimen/Biobanking Geographic Management Program (BMaP) were established in six regions across the country. This paper describes the development of the Region 3 GMaP/BMaP network composed of over 100 investigators from nine institutions in five Southeastern states and Puerto Rico to develop a state-of-the-art network for cancer health disparities research and training. We describe a series of partnership activities that led to the formation of the infrastructure for this network, recount the participatory processes utilized to develop and implement a needs and assets assessment and implementation plan, and describe our approach to data collection. Completion, by all nine institutions, of the needs and assets assessment resulted in several beneficial outcomes for Region 3 GMaP/BMaP. This network entails ongoing commitment from the institutions and institutional leaders, continuous participatory and engagement activities, and effective coordination and communication centered on team science goals. PMID:24486917

  2. Enzymatic removal of phenol and p-chlorophenol in enzyme reactor: Horseradish peroxidase immobilized on magnetic beads

    International Nuclear Information System (INIS)

    Bayramoglu, Guelay; Arica, M. Yakup

    2008-01-01

    Horseradish peroxidase was immobilized on the magnetic poly(glycidylmethacrylate-co-methylmethacrylate) (poly(GMA-MMA)), via covalent bonding and used for the treatment of phenolic wastewater in continuous systems. For this purposes, horseradish peroxidase (HRP) was covalently immobilized onto magnetic poly(GMA-MMA) beds using glutaraldehyde (GA) as a coupling agent. The maximum HRP immobilization capacity of the magnetic poly(GMA-MMA)-GA beads was 3.35 mg g -1 . The immobilized HRP retained 79% of the activity of the free HRP used for immobilization. The immobilized HRP was used for the removal of phenol and p-chlorophenol via polymerization of dissolved phenols in the presence of hydrogen peroxide (H 2 O 2 ). The effect of pH and temperature on the phenol oxidation rate was investigated. The results were compared with the free HRP, which showed that the optimum pH value for the immobilized HRP is similar to that for the free HRP. The optimum pH value for free and immobilized HRP was observed at pH 7.0. The optimum temperature for phenols oxidation with immobilized HRP was between 25 and 35 deg. C and the immobilized HRP has more resistance to temperature inactivation than that of the free form. Finally, the immobilized HRP was operated in a magnetically stabilized fluidized bed reactor, and phenols were successfully removed in the enzyme reactor

  3. Modification of flax fibres by radiation induced emulsion graft copolymerization of glycidyl methacrylate

    Science.gov (United States)

    Moawia, Rihab Musaad; Nasef, Mohamed Mahmoud; Mohamed, Nor Hasimah; Ripin, Adnan

    2016-05-01

    Flax fibres were modified by radiation induced graft copolymerization of glycidyl methacrylate (GMA) by pre-irradiation method in an emulsion medium. The effect of reaction parameters on the degree of grafting (DOG) such as concentration of bleaching agent, absorbed dose, monomer concentration, temperature and reaction time were investigated. The DOG was found to be dependent on the investigated parameters. The incorporation of poly(GMA) grafts in the bleached flax fibres was confirmed by Fourier transform infrared spectroscopy (FTIR) and scanning electron microscopy (SEM). The structural and mechanical changes were evaluated by X-ray diffraction (XRD) and mechanical tester, respectively. The results revealed that reacting bleached flax fibres irradiated with 20 kGy with 5% GMA emulsion containing 0.5% polyoxyethylene-sorbitan monolaurate (Tween 20) surfactant at 40 °C for 1 h led to a maximum DOG of 148%. The grafted fibres showed sufficient mechanical strength and hydrophobicity which make them promising precursors for development of adsorbents after appropriate chemical treatments.

  4. Controlled grafting of vinylic monomers on polyolefins: a robust mathematical modeling approach.

    Science.gov (United States)

    Saeb, Mohammad Reza; Rezaee, Babak; Shadman, Alireza; Formela, Krzysztof; Ahmadi, Zahed; Hemmati, Farkhondeh; Kermaniyan, Tayebeh Sadat; Mohammadi, Yousef

    2017-01-01

    Experimental and mathematical modeling analyses were used for controlling melt free-radical grafting of vinylic monomers on polyolefins and, thereby, reducing the disturbance of undesired cross-linking of polyolefins. Response surface, desirability function, and artificial intelligence methodologies were blended to modeling/optimization of grafting reaction in terms of vinylic monomer content, peroxide initiator concentration, and melt-processing time. An in-house code was developed based on artificial neural network that learns and mimics processing torque and grafting of glycidyl methacrylate (GMA) typical vinylic monomer on high-density polyethylene (HDPE). Application of response surface and desirability function enabled concurrent optimization of processing torque and GMA grafting on HDPE, through which we quantified for the first time competition between parallel reactions taking place during melt processing: (i) desirable grafting of GMA on HDPE; (ii) undesirable cross-linking of HDPE. The proposed robust mathematical modeling approach can precisely learn the behavior of grafting reaction of vinylic monomers on polyolefins and be placed into practice in finding exact operating condition needed for efficient grafting of reactive monomers on polyolefins.

  5. The association between phenomena on the Sun, geomagnetic activity, meteorological variables, and cardiovascular characteristic of patients with myocardial infarction

    Science.gov (United States)

    Vencloviene, Jone; Babarskiene, Ruta; Slapikas, Rimvydas; Sakalyte, Gintare

    2013-09-01

    It has been found that solar and geomagnetic activity affects the cardiovascular system. Some evidence has been reported on the increase in the rate of myocardial infarction, stroke and myocardial infarction related deaths during geomagnetic storms. We investigated the association between cardiovascular characteristics of patients, admitted for myocardial infarction with ST elevation (STEMI), and geomagnetic activity (GMA), solar proton events (SPE), solar flares, and meteorological variables during admission. The data of 1,979 patients hospitalized at the Hospital of Lithuanian University of Health Sciences (Kaunas) were analyzed. We evaluated the association between environmental variables and patient's characteristics by multivariate logistic regression, controlling patient's gender and age. Two days after geomagnetic storms the risk of STEMI was over 1.5 times increased in patients who had a medical history of myocardial infarction, stable angina, renal or pulmonary diseases. The dose-response association between GMA level and STEMI risk for patients with renal diseases in history was observed. Two days after SPE the risk of STEMI in patients with stable angina in anamnesis was increased over 1.5 times, adjusting by GMA level. The SPE were associated with an increase of risk for patients with renal diseases in history. This study confirms the strongest effect of phenomena in the Sun in high risk patients.

  6. Introduction of various amine groups onto polyethylene bead prepared by radiation-induced polymerization

    International Nuclear Information System (INIS)

    Kim, M.S.; Choi, S.H.; Lee, K.P.

    2002-01-01

    Complete text of publication follows. Radiation-induced graft polymerization is a good method for modification of chemical and physical properties of polymeric materials because it can endow properties such as membrane quality, ion exchange, blood compatibility, dyeability, protein adsorption, and immobilization of bioactive materials. Polyethylene microbead is very useful material due to the following advantages; low price, simple purchase, high sensitivity, and simple analysis. On the other hand, the epoxy group of the glycidyl methacrylate (GMA) can easily be converted to the various functional groups such as amines, alcohols, phosphoric acid, sulfonic acid, and amino acid, etc. Cyclodextrin have been applied universally in various industries such as foods, cosmetics, pharmaceutical industry, analytical chemistry, and chemical industry. In order to obtain cyclodextrins, polyethylene microbead with the epoxy group were prepared by radiation-induced graft polymerization of GMA onto polyethylene microbead. The physical and chemical properties of the GMA-induced polyethylene microbeads were investigated by IR, thermal analysis (TGA/DSC), and SEM, respectively. Subsequently, the various amine groups such as diethylamine. diethylenetriamine, triethylamine, triethylenetetramine, and 1,6-hexanediamine were induced onto the epoxy group in polyethylene microbead. Finally, cyclodextrin glucanotransferase were immobilized onto polyethylene microbead with various amines under the various experimental conditions, such as pH, amin content, immobilization time, and etc. The activity of CGTase-immobilized polyethylene microbead was determined by Phenolphthein method. The production of the cyclodextrins from starch is in progress

  7. Synthesis and characterization of new functionalized polymer-Fe3O4 nanocomposite particles

    Directory of Open Access Journals (Sweden)

    A. Bukowska

    2017-01-01

    Full Text Available In this study, Fe3O4 nanoparticles (NPs were functionalized with copolymer or terpolymer bearing glycidyl methacrylate (GMA moieties making them suitable for potential applications as drug delivery systems (DDS. For this purpose, the surface of magnetic nanoparticles was first coated with 3-(trimethoxysilyl propyl methacrylate (MPS by a silanization reaction to introduce reactive methacrylate groups onto the surface. Subsequently, monomers were grafted onto the surface of modified-MPS particles via two polymerization methods: seed emulsion (GMA, divinylbenzene, DVB, and styrene, S and distillation – precipitation (GMA and DVB. The obtained nanocomposite particles were characterized by FTIR (Fourier transform infrared spectroscopy, DR UV-Vis (diffuse reflectance ultraviolet – visible spectroscopy, TEM (transmission electron microscopy combined with EDS (energy dispersive X-ray spectroscopy analysis and DLS (dynamic light scattering. FTIR spectroscopy showed that indeed a polymer – Fe3O4@MPS composite was obtained. TEM and EDS analysis showed that the seed emulsion method resulted in nanosized, 100 nm Fe3O4@MPS core/polymer shell NPs, forming long chains. On the contrary, the distillation – precipitation method caused the formation of an inverted structure, i.e. polymer core coated by a Fe3O4@MPS shell, which exhibited a very coarse size distribution varying from several hundreds to over 2 µm.

  8. A Complicated Case of Tacrolimus-Induced Rapid Remission after Cesarean Section in the Early Third Trimester for Refractory Severe Ulcerative Colitis Flaring in the Initial Period of Gestation

    Directory of Open Access Journals (Sweden)

    Takashi Mizushima

    2011-04-01

    Full Text Available A 36-year-old woman who had been diagnosed with ulcerative colitis at the age of 17 years was referred to our hospital because of severe abdominal pain and repeated bloody diarrhea that persisted during pregnancy despite combination therapy with high-dose corticosteroids and weekly granulocyte and monocyte adsorptive apheresis (GMA. She underwent combination therapy consisting of high-dose corticosteroids, intensive GMA (two sessions per week and vancomycin, which was used to eradicate Clostridium difficile, under total parenteral nutrition control until the estimated weight of her fetus reached 1,000 g. This combination therapy was partially successful, resulting in almost complete disappearance of abdominal pain and a marked decrease in stool frequency. However bloody diarrhea persisted and the patient developed anemia and hypoalbuminemia and was unable to prolong her gestation time. Cesarean section was conducted at 28 weeks of gestation without any congenital abnormalities or neurological defects. Oral administration of tacrolimus was begun 7 days after cesarean section, which was followed by rapid induction of remission. Corticosteroids were then gradually tapered off. Tacrolimus is one therapeutic option after cesarean section in pregnant patients who do not respond well to GMA and high-dose corticosteroids for persistent active ulcerative colitis.

  9. Graft copolymerization of glycidyl methacrylate onto delignified kenaf fibers through pre-irradiation technique

    International Nuclear Information System (INIS)

    Sharif, Jamaliah; Mohamad, Siti Fatahiyah; Fatimah Othman, Nor Azilah; Bakaruddin, Nurul Azra; Osman, Hasnul Nizam; Güven, Olgun

    2013-01-01

    Glycidyl methacrylate grafted kenaf (GMA-g-Kenaf) was prepared by pre-irradiation grafting technique. Kenaf fibers were treated with different concentration of sodium chlorite solution before used as trunk polymer. Treated kenaf fibers were irradiated by electron beam followed by grafting reaction in GMA/water emulsion system. The degree of grafting was determined as a function of absorbed dose, reaction time, reaction temperature and concentration of monomer. The results showed that the lignin content was decreased from 14.3% to as low as 3.3% with the increased of sodium chlorite concentration. This was evidenced by SEM pictures which show the surface of treated kenaf fibers was cleaner and smoother compared to that of untreated one. The degree of grafting increased with the increase of absorbed dose, reaction temperature, reaction time and monomer concentration as well as with decreasing lignin content. Formation of graft copolymer was confirmed with SEM, FTIR analysis. The structural investigation by XRD showed that degree of crystallinity of graft copolymers decreased with the increase in degree of grafting. - Highlights: • We used kenaf fibers for radiation induce graft copolymerization with GMA. • Kenaf fibers was treated to remove lignin in order to increase grafting yield. • Treated kenaf fibers were graft copolymerize through preirradiation technique. • Optimum conditions for graft copolymerization of kenaf fibers were established. • Formation of graft copolymer is also confirmed with SEM, FTIR and XRD

  10. Reconstruction of gastric slow wave from finger photoplethysmographic signal using radial basis function neural network.

    Science.gov (United States)

    Mohamed Yacin, S; Srinivasa Chakravarthy, V; Manivannan, M

    2011-11-01

    Extraction of extra-cardiac information from photoplethysmography (PPG) signal is a challenging research problem with significant clinical applications. In this study, radial basis function neural network (RBFNN) is used to reconstruct the gastric myoelectric activity (GMA) slow wave from finger PPG signal. Finger PPG and GMA (measured using Electrogastrogram, EGG) signals were acquired simultaneously at the sampling rate of 100 Hz from ten healthy subjects. Discrete wavelet transform (DWT) was used to extract slow wave (0-0.1953 Hz) component from the finger PPG signal; this slow wave PPG was used to reconstruct EGG. A RBFNN is trained on signals obtained from six subjects in both fasting and postprandial conditions. The trained network is tested on data obtained from the remaining four subjects. In the earlier study, we have shown the presence of GMA information in finger PPG signal using DWT and cross-correlation method. In this study, we explicitly reconstruct gastric slow wave from finger PPG signal by the proposed RBFNN-based method. It was found that the network-reconstructed slow wave provided significantly higher (P wave than the correlation obtained (≈0.7) between the PPG slow wave from DWT and the EEG slow wave. Our results showed that a simple finger PPG signal can be used to reconstruct gastric slow wave using RBFNN method.

  11. Correlating cytotoxicity to elution behaviors of composite resins in term of curing kinetic.

    Science.gov (United States)

    Meng, Junquan; Yang, Huichuan; Cao, Man; Li, Lei; Cai, Qing

    2017-09-01

    Cytotoxicity of photocurable composite resins is a key issue for their safe use in dental restoration. Curing kinetic and elution behaviors of the composite resin would have decisive effects on its cytotoxicity. In this study, composite resins composed of bisphenol-glycidyl dimethacrylate (Bis-GMA), triethyleneglycol dimethacrylate (TEGDMA), camphorquinone (CQ), N,N-dimethylaminoethyl methacrylate (DMAEMA) and barium glass powders were prepared by setting the photoinitiators CQ/DMAEMA at 0.5wt%, 1wt% or 3wt% of the total weight of Bis-GMA/TEGDMA. The ratio of Bis-GMA/TEGDMA was 6:4, the ratio of CQ/DMAEMA was 1:1, and the incorporated inorganic powder was 75wt%. Then, curing kinetics were studied by using real-time Fourier transform infrared spectroscopy (FTIR) and photo-DSC (differential scanning calorimeter). Elution behaviors in both ethanol solution and deionized water were monitored by using liquid chromatogram/mass spectrometry (LC/MS). Cytotoxicity was evaluated by in vitro culture of L929 fibroblasts. Finally, they were all analyzed and correlated in terms of initiator contents. It was found that the commonly used 0.5wt% of photoinitiators was somewhat insufficient in obtaining composite resin with low cytotoxicity. Copyright © 2017. Published by Elsevier B.V.

  12. Intensifying radiation induced grafting of 4-vinylpyridine/glycidyl methacrylate mixtures onto poly(ethylene-co-tetrafluoroethylene) films using ultrasound

    International Nuclear Information System (INIS)

    Nasef, Mohamed Mahmoud; Sithambaranathan, Paveswari; Ahmad, Arshad; Abouzari-lotf, Ebrahim

    2017-01-01

    A new ultrasound-aided method was used to enhance grafting of 4-vinylpyridine (4-VP) and glycidyl methacrylate (GMA) monomers mixtures onto electron beam (EB) irradiated poly(ethylene-co-tetrafluoroethylene) (ETFE) film for the first time. The effects of reaction parameters such as absorbed dose, monomer concentration, reaction time on both of degree of grafting (DG) and grafting efficiency (GE) were investigated under sonication and conventional grafting at similar temperatures. Fourier transform infrared (FTIR) and atomic force microscopy (AFM) were used to monitor the impact of the applied ultrasound on composition and surfaces of the grafted films whereas 1 H-NMR was used to investigate composition of the grafting residues. The ultrasound-aided grafting of 4-VP/GMA was found to enhance both of DG% and GE remarkably. Moreover, it produced grafted ETFE films having smoother surfaces without homopolymer contamination compared to grafted films obtained from conventional grafting. The results of this study suggest that the use of ultrasound is a promising way for intensifying grafting process and improving its economy. - Highlights: • Grafting of 4-VP/GMA onto ETFE films was carried out with the aid of ultrasound. • Degree of grafting was found to be strongly dependent on reaction parameters. • Sonication remarkably enhanced the reaction kinetics and grafting efficiency. • Grafted films with smoother surfaces without homopolymer contamination were obtained. • Ultrasound aided grafting is superior to conventional one and promotes intensification.

  13. Fabrication of electrospun HPGL scaffolds via glycidyl methacrylate cross-linker: Morphology, mechanical and biological properties

    Energy Technology Data Exchange (ETDEWEB)

    Baratéla, Fernando José Costa; Zazuco Higa, Olga [Biotechnology Center, Institute of Energy and Nuclear Research (IPEN), Av. Professor Lineu Prestes 2242, 05508-000 São Paulo, SP (Brazil); Duarte dos Passos, Esdras [PostGraduate Program in Materials for Engineering, Federal University of Itajubá (UNIFEI), Av. BPS 1303, 37500-903 Itajubá, MG (Brazil); Alencar de Queiroz, Alvaro Antonio, E-mail: alencar@unifei.edu.br [Physics and Chemistry Institute (IFQ), Federal University of Itajubá (UNIFEI), Av. BPS 1303, 37500-903 Itajubá, MG (Brazil); High Voltage Laboratory (LAT-EFEI), Federal University of Itajubá (UNIFEI), Av. BPS 1303, 37500-903 Itajubá, MG (Brazil)

    2017-04-01

    Electrospinning is a suitable method to produce scaffolds composed of nanoscale to microscale fibers, which are comparable to the extracellular matrix (ECM). Hyperbranched polyglycerol (HPGL) is a highly biocompatible polyether polyol potentially useful for the design of fibrous scaffolds mimicking the ECM architecture. However, scaffolds developed from HPGL have poor mechanical properties and morphological stability in the aqueous environments required for tissue engineering applications. This work reports the production of stable electrospun HPGL scaffolds (EHPGLS) using glycidyl methacrylate (GMA) as cross-linker to enhance the water stability and mechanical property of electrospun HPGL. The diameter and morphology of the produced EHPGLS were analyzed by scanning electron microscopy (SEM). It was observed that electrical fields in the range of 0.2 kV·cm{sup −1} to 1.0 kV·cm{sup −1} decrease the average fiber diameter of EHPGLS. The increase in porosity of EHPGLS with GMA concentration indicates the in situ formation of a heterogeneous structure resultant from the phase separation during crosslinking of HPGL by GMA. EHPGLS containing 20% (w/w) GMA concentration possessed highest tensile strength (295.4 ± 11.32 kPa), which is approximately 58 times higher than that of non-crosslinked EHPGLS (5.1 ± 2.12 kPa). The MTS cell viability results showed that the EHPGLS have no significant cytotoxicity effect on Chinese hamster ovary (CHO-K1) cells. Scanning electron microscopy (SEM) indicates that the cultured BALB/3T3 fibroblasts cells were able to keep contact each other's, thus forming a homogeneous monolayer on the internal surface of the EHPGLS. - Highlights: • A hyperbranched polyglycerol (HPGL) scaffold with elastic modulus of 295.4 ± 11.32 kPa was developed for soft tissue repair. • HPGL scaffold was prepared by electrospinning method. • The porosity of HPGL scaffolds can be tuned by selecting the degree of GMA in HPGL. • Electrospun HPGL

  14. Study and Optimization on graft polymerization under normal pressure and air atmospheric conditions, and its application to metal adsorbent

    International Nuclear Information System (INIS)

    Ueki, Yuji; Chandra Dafader, Nirmal; Hoshina, Hiroyuki; Seko, Noriaki; Tamada, Masao

    2012-01-01

    Radiation-induced graft polymerization of glycidyl methacrylate (GMA) onto non-woven polyethylene (NWPE) fabric was achieved under normal pressure and air atmospheric conditions, without using unique apparatus such as glass ampoules or vacuum lines. To attain graft polymerization under normal pressure and air atmospheric conditions, the effects of the pre-irradiation dose, pre-irradiation atmosphere, pre-irradiation temperature, de-aeration of GMA-emulsion, grafting atmosphere in a reactor, and dissolved oxygen (DO) concentration in GMA-emulsion on the degree of grafting (Dg) were investigated in detail. It was found that the DO concentration had the strongest influence, the pre-irradiation dose, de-aeration of emulsion and grafting atmosphere had a relatively strong impact, and the pre-irradiation atmosphere and pre-irradiation temperature had the least effect on Dg. The optimum DO concentration before grafting was 2.0 mg/L or less. When a polyethylene bottle was used as a reactor instead of a glass ampoule, graft polymerization under normal pressure and air atmospheric conditions could be achieved under the following conditions; the pre-irradiation dose was more than 50 kGy, the volume ratio of GMA-emulsion to air was 50:1 or less, and the DO concentration in GMA-emulsion during grafting was below 2.0 mg/L. Under these grafting conditions, Dg was controlled within a range of up to 362%. The prepared GMA–grafted NWPE (GMA–g-NWPE) fabric was modified with a phosphoric acid to obtain an adsorbent for heavy metal ions. In the column-mode adsorption tests of Pb(II), the adsorption performance of the produced phosphorylated GMA–g-NWPE fabric (fibrous metal adsorbent) was not essentially dependent on the flow rate of the feed. The breakthrough points of 200, 500, and 1000 h −1 in space velocity were 483, 477 and 462 bed volumes, and the breakthrough capacities of the three flow rates were 1.16, 1.15 and 1.16 mmol-Pb(II)/g-adsorbent.

  15. pH-Responsive Tumor-Targetable Theranostic Nanovectors Based on Core Crosslinked (CCL Micelles with Fluorescence and Magnetic Resonance (MR Dual Imaging Modalities and Drug Delivery Performance

    Directory of Open Access Journals (Sweden)

    Sidan Tian

    2016-06-01

    Full Text Available The development of novel theranostic nanovectors is of particular interest in treating formidable diseases (e.g., cancers. Herein, we report a new tumor-targetable theranostic agent based on core crosslinked (CCL micelles, possessing tumor targetable moieties and fluorescence and magnetic resonance (MR dual imaging modalities. An azide-terminated diblock copolymer, N3-POEGMA-b-P(DPA-co-GMA, was synthesized via consecutive atom transfer radical polymerization (ATRP, where OEGMA, DPA, and GMA are oligo(ethylene glycolmethyl ether methacrylate, 2-(diisopropylaminoethyl methacrylate, and glycidyl methacrylate, respectively. The resulting diblock copolymer was further functionalized with DOTA(Gd (DOTA is 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetrakisacetic acid or benzaldehyde moieties via copper(I-catalyzed alkyne-azide cycloaddition (CuAAC chemistry, resulting in the formation of DOTA(Gd-POEGMA-b-P(DPA-co-GMA and benzaldehyde-POEGMA-b-P(DPA-co-GMA copolymers. The resultant block copolymers co-assembled into mixed micelles at neutral pH in the presence of tetrakis[4-(2-mercaptoethoxyphenyl]ethylene (TPE-4SH, which underwent spontaneous crosslinking reactions with GMA residues embedded within the micellar cores, simultaneously switching on TPE fluorescence due to the restriction of intramolecular rotation. Moreover, camptothecin (CPT was encapsulated into the crosslinked cores at neutral pH, and tumor-targeting pH low insertion peptide (pHLIP, sequence: AEQNPIYWARYADWLFTTPLLLLDLALLVDADEGTCG moieties were attached to the coronas through the Schiff base chemistry, yielding a theranostic nanovector with fluorescence and MR dual imaging modalities and tumor-targeting capability. The nanovectors can be efficiently taken up by A549 cells, as monitored by TPE fluorescence. After internalization, intracellular acidic pH triggered the release of loaded CPT, killing cancer cells in a selective manner. On the other hand, the nanovectors labeled with DOTA

  16. Free composition instead of language dictatorship

    NARCIS (Netherlands)

    Bergmans, Lodewijk; te Brinke, Steven; Bockisch, Christoph; Aksit, Mehmet

    Historically, programming languages have been—benevolent—dictators: reducing all possible semantics to specific ones offered by a few built-in language constructs. Over the years, some programming languages have freed the programmers from the restrictions to use only built-in libraries, built-in

  17. Cytotoxicity of dental composite (co)monomers and the amalgam component Hg{sup 2+} in human gingival fibroblasts

    Energy Technology Data Exchange (ETDEWEB)

    Reichl, Franz-Xaver; Simon, Sabine; Esters, Magalie; Seiss, Mario [Ludwig-Maximilians-University of Munich, Walther-Straub-Institute of Pharmacology and Toxicology, Munich (Germany); Kehe, Kai [Bundeswehr Institute of Pharmacology and Toxicology, Munich (Germany); Kleinsasser, Norbert [University of Regensburg, Department of Otolaryngology - Head and Neck Surgery, Regensburg (Germany); Hickel, Reinhard [Ludwig-Maximilians-University, Department of Operative Dentistry and Periodontology, Munich (Germany)

    2006-08-15

    Unpolymerized resin (co)monomers or mercury (Hg) can be released from restorative dental materials (e.g. composites and amalgam). They can diffuse into the tooth pulp or the gingiva. They can also reach the gingiva and organs by the circulating blood after the uptake from swallowed saliva. The cytotoxicity of dental composite components hydroxyethylmethacrylate (HEMA), triethyleneglycoldimethacrylate (TEGDMA), urethanedimethacrylate (UDMA), and bisglycidylmethacrylate (Bis-GMA) as well as the amalgam component Hg{sup 2+} (as HgCl{sub 2}) and methyl mercury chloride (MeHgCl) was investigated on human gingival fibroblasts (HGFs) at two time intervals. To test the cytotoxicity of substances, the bromodeoxyuridine (BrdU) assay and the lactate dehydrogenase (LDH) assay were used. The test substances were added in various concentrations and cells were incubated for 24 or 48 h. The EC{sub 50} values were obtained as half-maximum-effect concentrations from fitted curves. Following EC{sub 50} values were found [BrdU: mean (mmol/l); SEM in parentheses; n=12]: (24 h/48 h) HEMA 8.860 (0.440)/6.600(0.630), TEGDMA 1.810(0.130)/1.220(0.130), UDMA 0.120(0.010)/0.140(0.010), BisGMA 0.060(0.004)/0.040(0.002), HgCl{sub 2} 0.015(0.001)/0.050(0.006), and MeHgCl 0.004(0.001)/0.005(0.001). Following EC{sub 50} values were found [LDH: mean (mmol/l); SEM in parentheses; n=12]: (24 h/48 h) HEMA 9.490(0.300)/7.890(1.230), TEGDMA 2.300(0.470)/1.950(0.310), UDMA 0.200(0.007)/0.100(0.007), BisGMA 0.070(0.005)/0.100(0.002), and MeHgCl 0.014(0.006)/0.010(0.003). In both assays, the following range of increased toxicity was found for composite components (24 and 48 h): HEMA < TEGDMA < UDMA < BisGMA. In both assays, MeHgCl was the most toxic substance. In the BrdU assay, Hg{sup 2+} was about fourfold less toxic than MeHgCl but Hg{sup 2+} was about fourfold more toxic than BisGMA. In the BrdU test, a significantly (P<0.05) decreased toxicity was observed for Hg{sup 2+} at 48 h, compared to the 24 h

  18. Influence of polymeric matrix on the physical and chemical properties of experimental composites

    Directory of Open Access Journals (Sweden)

    Flávia GONÇALVES

    2015-01-01

    Full Text Available Nowadays, the main reasons for replacement of resin-based composite restorations are fracture or problems with the integrity of their interface, such as marginal staining, microleakage, or secondary caries. The aim of the present study was to evaluate the influence of the organic matrix on polymerization stress (PS, degree of conversion (DC, elastic modulus (E, flexural strength (FS, Knoop hardness (KHN, sorption (SP, and solubility (SL. In order to obtain a material which combines better mechanical properties with lower PS, seven experimental composites were prepared using BisGMA to TEGDMA molar ratios of 2:8, 3:7, 4:6, 5:5, 6:4, 7:3 and 8:2 and 40% of silica. PS was obtained in a universal testing machine, using acrylic as bonding substrate. DC was determined using Fourier Transform Raman spectroscopy. E and FS were obtained by the three-point bending test. KHN was measured by a microindentation test using a load of 25 g for 30 s. SP and SL were assessed according to ISO 4049. The data were submitted to one-way ANOVA. The increase in BisGMA concentration resulted in the decrease of PS, DC, E, FS and KHN. However, it did not change the SP and SL values. FS, E and KHN showed a strong and direct relationship with the DC of the materials. The composite material with a BisGMA to TEGDMA molar ratio of 1:1 was the one with better mechanical properties and lower PS.

  19. The Baby Moves prospective cohort study protocol: using a smartphone application with the General Movements Assessment to predict neurodevelopmental outcomes at age 2 years for extremely preterm or extremely low birthweight infants.

    Science.gov (United States)

    Spittle, A J; Olsen, J; Kwong, A; Doyle, L W; Marschik, P B; Einspieler, C; Cheong, Jly

    2016-10-03

    Infants born extremely preterm (EP; smartphone application (app) developed for caregivers to video and upload their infant's general movements to be scored remotely by a certified GMA assessor. The aim of this study is to determine the predictive ability of using the GMA via the Baby Moves app for neurodevelopmental impairment in infants born EP/ELBW. This prospective cohort study will recruit infants born EP/ELBW across the state of Victoria, Australia in 2016 and 2017. A control group of normal birth weight (>2500 g birth weight), term-born (≥37 weeks' gestation) infants will also be recruited as a local reference group. Parents will video their infant's general movements at two time points between 3 and 4 months' corrected age using the Baby Moves app. Videos will be scored by certified GMA assessors and classified as normal or abnormal. Parental satisfaction using the Baby Moves app will be assessed via survey. Neurodevelopmental outcome at 2 years' corrected age includes developmental delay according to the Bayley Scales of Infant and Toddler Development-III and cerebral palsy diagnosis. This study was approved by the Human Research and Ethics Committees at the Royal Children's Hospital, The Royal Women's Hospital, Monash Health and Mercy Health in Melbourne, Australia. Study findings will be disseminated via peer-reviewed publications and conference presentations. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/.

  20. Alterations of energy metabolism and glutathione levels of HL-60 cells induced by methacrylates present in composite resins.

    Science.gov (United States)

    Nocca, G; De Palma, F; Minucci, A; De Sole, P; Martorana, G E; Callà, C; Morlacchi, C; Gozzo, M L; Gambarini, G; Chimenti, C; Giardina, B; Lupi, A

    2007-03-01

    Methacrylic compounds such as 2-hydroxyethyl methacrylate (HEMA), triethylene glycol dimethacrylate (TEGDMA) and bisphenol A glycerolate (1 glycerol/phenol) dimethacrylate (Bis-GMA) are largely present in auto- or photopolymerizable composite resins. Since the polymerization reaction is never complete, these molecules are released into the oral cavity tissues and biological fluids where they could cause local adverse effects. The aim of this work was to verify the hypothesis that the biological effects of HEMA, TEGDMA and Bis-GMA - at a non-cytotoxic concentration - depend on the interaction with mitochondria and exert consequent alterations of energy metabolism, GSH levels and the related pathways in human promyelocytic cell line (HL-60). The biological effects of methacrylic monomers were determined by analyzing the following parameters: GSH concentration, glucose-6-phosphate dehydrogenase (G6PDH) and glutathione reductase (GR) activity, oxygen and glucose consumption and lactate production along with cell differentiation and proliferation. All monomers induced both cellular differentiation and decrease in oxygen consumption. Cells treated with TEGDMA and Bis-GMA showed a significant enhancement of glucose consumption and lactate production. TEGDMA and HEMA induced GSH depletion stimulating G6PDH and GR activity. All the monomers under study affect the metabolism of HL-60 cells and show differentiating activity. Since alterations in cellular metabolism occurred at compound concentrations well below cytotoxic levels, the changes in energy metabolism and glutathione redox balance could be considered as potential mechanisms for inducing clinical and sub-clinical adverse effects and thus providing useful parameters when testing biocompatibility of dental materials.

  1. Development of an amine-type adsorbent by electron beam-induced emulsion grafting of glycidyl methacrylate onto a nonwoven fabric

    International Nuclear Information System (INIS)

    Madrid, Jordan; Ueki, Yuji; Seko, Noriaki

    2013-01-01

    In the recent years, radiation-induced graft polymerization of various monomers onto different types of trunk polymers have been extensively used for researchers on adsorbents for cations, anions and different compounds, battery separators, antibacterial bandages, protein separators, and fuel cell applications. Some of these technologies were transferred to end-users and eventually commercialized. In most of these studies, a post-grafting reaction is performed to introduced chemical groups that impart functionality to the grafted material. In this paper, pre-irradiation technique was used for emulsion grafting of glycidyl methacrylate (GMA) onto an electron beam irradiated abaca-polyester nonwoven fabric (APNWF). The dependence of degree of grafting (Dg), calculated from the weight of APNWF before and after grafting, on irradiation dose, reaction time and monomer concentration were studies. After 50 kGy irradiation with 2 MeV electron beam and subsequent 3-hour reaction with an emulsion consisting of 5% GMA and 0.5% polyoxyethylene sorbitan monolaurate (Tween 20) surfactant in deionized water at 40 degree centegrade, a grafted APNWF with a Dg greater than 150% was obtained. The GMA grafted APNWF was further modified by reaction with ethylenediamine (EDA) in isopropyl alcohol at 60 degree centegrade to introduce amine functional groups. A 3-hour reaction with 50% EDA resulted to an amine group density of 2.7 mmole/gram-adsorbent. Preliminary batch adsorption experiments using Cu 2+ and Ni 2+ ions in aqueous solutions show that the adsorption capacity of the grafted adsorbent is four times greater for Cu 2+ ions compared to Ni 2+ ions. (author)

  2. Abaca/polyester nonwoven fabric functionalization for metal ion adsorbent synthesis via electron beam-induced emulsion grafting

    International Nuclear Information System (INIS)

    Madrid, Jordan F.; Ueki, Yuji; Seko, Noriaki

    2013-01-01

    A metal ion adsorbent was developed from a nonwoven fabric trunk material composed of both natural and synthetic polymers. A pre-irradiation technique was used for emulsion grafting of glycidyl methacrylate (GMA) onto an electron beam irradiated abaca/polyester nonwoven fabric (APNWF). The dependence of degree of grafting (Dg), calculated from the weight of APNWF before and after grafting, on absorbed dose, reaction time and monomer concentration were evaluated. After 50 kGy irradiation with 2 MeV electron beam and subsequent 3 h reaction with an emulsion consisting of 5% GMA and 0.5% polyoxyethylene sorbitan monolaurate (Tween 20) surfactant in deionized water at 40 °C, a grafted APNWF with a Dg greater than 150% was obtained. The GMA-grafted APNWF was further modified by reaction with ethylenediamine (EDA) in isopropyl alcohol at 60 °C to introduce amine functional groups. After a 3 h reaction with 50% EDA, an amine group density of 2.7 mmole/gram adsorbent was achieved based from elemental analysis. Batch adsorption experiments were performed using Cu 2+ and Ni 2+ ions in aqueous solutions with initial pH of 5 at 30 °C. Results show that the adsorption capacity of the grafted adsorbent for Cu 2+ is four times higher than Ni 2+ ions. - Highlights: • An amine type adsorbent from abaca/polyester nonwoven fabric was synthesized. • Pre-irradiation method was used in grafting glycidyl methacrylate on nonwoven fabric. • Radiation-induced grafting was performed with monomer in emulsion state. • The calculated adsorption capacity for Cu 2+ is four times higher than Ni 2+ ions. • Grafted adsorbent can remove Cu 2+ faster than a chemically similar commercial resin

  3. Short-Term Changes in Weather and Space Weather Conditions and Emergency Ambulance Calls for Elevated Arterial Blood Pressure

    Directory of Open Access Journals (Sweden)

    Jone Vencloviene

    2018-03-01

    Full Text Available Circadian rhythm influences the physiology of the cardiovascular system, inducing diurnal variation of blood pressure. We investigated the association between daily emergency ambulance calls (EACs for elevated arterial blood pressure during the time intervals of 8:00–13:59, 14:00–21:59, and 22:00–7:59 and weekly fluctuations of air temperature (T, barometric pressure, relative humidity, wind speed, geomagnetic activity (GMA, and high-speed solar wind (HSSW. We used the Poisson regression to explore the association between the risk of EACs and weather variables, adjusting for seasonality and exposure to CO, PM10, and ozone. An increase of 10 °C when T > 1 °C on the day of the call was associated with a decrease in the risk of EACs during the time periods of 14:00–21:59 (RR (rate ratio = 0.78; p < 0.001 and 22:00–7:59 (RR = 0.88; p = 0.35. During the time period of 8:00–13:59, the risk of EACs was positively associated with T above 1 °C with a lag of 5–7 days (RR = 1.18; p = 0.03. An elevated risk was associated during 8:00–13:59 with active-stormy GMA (RR = 1.22; p = 0.003; during 14:00–21:59 with very low GMA (RR = 1.07; p = 0.008 and HSSW (RR = 1.17; p = 0.014; and during 22:00–7:59 with HSSW occurring after active-stormy days (RR = 1.32; p = 0.019. The associations of environmental variables with the exacerbation of essential hypertension may be analyzed depending on the time of the event.

  4. Compósitos polímero-madeira preparados por polimerização in situ de metil metacrilato usando aditivos bifuncionais

    Directory of Open Access Journals (Sweden)

    Bruno Dufau Mattos

    2015-12-01

    Full Text Available Resumo O presente trabalho teve por objetivo a confecção de compósitos polímero-madeira por meio de polimerização in situ de metil metacrilato (MMA, utilizando ácido metacrílico (MAA e glicidil metacrilato (GMA como agentes de ligação e reticulação. Amostras de madeira de guapuruvu foram impregnadas em um sistema de vácuo e pressão e polimerizadas em estufa a 90°C por 10h, usando 1,5% de peroxido de benzoíla como catalisador. Os compósitos foram caracterizados por meio de testes de absorção de água e estabilidade dimensional, molhabilidade, ATR-IR, TGA, MEV e WPG. Os espectros de ATR-IR mostraram incrementos nas bandas a 1746, 1460, e 1145 cm–1, referentes as estruturas químicas dos polímeros dentro da madeira, confirmado posteriormente pelas imagens de MEV. A termogravimetria apontou reações químicas entre os copolímeros e a parede celular da madeira nos compósitos com GMA e MAA. Os compósitos preparados com MMA apresentaram incrementos acima de 50% nas propriedades higroscópicas e de estabilidade dimensional, entretanto a adição de GMA e MAA resultou em maiores incrementos nas mesmas propriedades, entre 66-90%.

  5. Investigations of step-growth thiol-ene polymerizations for novel dental restoratives.

    Science.gov (United States)

    Lu, Hui; Carioscia, Jacquelyn A; Stansbury, Jeffery W; Bowman, Christopher N

    2005-12-01

    The goal of this work was to investigate the feasibility of formulating novel dental restorative materials that utilize a step-growth thiol-ene photopolymerization. Particularly, we are aiming to significantly reduce the polymerization shrinkage and shrinkage stress while retaining adequate physical properties as compared to current dimethacrylatre-based systems. The thiol-ene system is composed of a 4:3 molar mixture of triallyl-1,3,5-triazine-2,4,6-trione (TATATO) and pentaerythritol tetramercaptopropionate (PETMP). The simultaneous measurement of shrinkage stress and functional group conversion was performed. Solvent extraction of unreacted monomers and dynamic mechanical analysis on the polymer networks that were formed were also studied. Flexural strength was measured for both filled and unfilled PETMP/TATATO and Bis-GMA/TEGDMA systems. Photopolymerization of PETMP/TATATO occurs at a much higher rate, with the maximum polymerization rate six times faster, than Bis-GMA/TEGDMA cured under the identical conditions. The results from the simultaneous measurement of shrinkage stress and conversion showed that the onset of shrinkage stress coincides with the delayed gel point conversion, which is predicted to be 41% for the 3:4 stoichiometric PETMP/TATATO resin composition. The maximum shrinkage stress developed for PETMP/TATATO was about 0.4 MPa, which was only approximately 14% of the maximum shrinkage stress of the Bis-GMA/TEGDMA system. Adequate flexural strength and flexural modulus values were obtained for both filled and unfilled PETMP/TATATO systems. The dramatically reduced shrinkage stress, increased polymerization rate, significance increased functional group conversion, and decreased leachable species are all benefits for the use-of thiol-ene systems as potential dental restorative materials.

  6. Effects of feed-borne Fusarium mycotoxins on hematology and immunology of laying hens.

    Science.gov (United States)

    Chowdhury, S R; Smith, T K; Boermans, H J; Woodward, B

    2005-12-01

    Feeding grains naturally contaminated with Fusarium mycotoxins has been shown to alter metabolism and performance of laying hens. The objectives of the current experiment were to examine the effects of feeding grains naturally contaminated with Fusarium mycotoxins on hematology and immunological indices and functions of laying hens and the possible protective effect of feeding a polymeric glucomannan mycotoxin adsorbent (GMA). One hundred forty-four laying hens were fed for 12 wk with diets formulated with (1) uncontaminated grains, (2) contaminated grains, or (3) contaminated grains + 0.2% GMA. Fusarium mycotoxins such as deoxynivalenol (DON, 12 mg/kg), 15-acetyl-DON (0.5 mg/kg), and zearalenone (0.6 mg/kg) were identified in the contaminated diets arising from contaminated grains grown in Ontario, Canada. The concentrations of DON arising from naturally contaminated grains in this study were similar to purified mycotoxin fed to experimental mice. The chronic feeding of Fusarium mycotoxins induced small decreases in hematocrit values, total numbers of white blood cells, lymphocytes including both CD4+ and CD8+ T lymphocytes and B lymphocytes, and biliary IgA concentration. Supplementation of diets containing feedborne mycotoxins with GMA prevented the reduction in total number of B lymphocytes in the peripheral blood and the reduction in biliary IgA concentration. In addition, the delayed-type hypersensitivity response to dinitrochlorobenzene was increased by feed-borne mycotoxins, whereas IgG and IgM antibody titers to sheep red blood cells were not affected by diet. We concluded that chronic consumption of grains naturally contaminated with Fusarium mycotoxins at levels likely to be encountered in practice were not systemically immunosuppressive or hematotoxic; however, mucosal immunocompetence needs to be explored further.

  7. Effects of feed-borne Fusarium mycotoxins on hematology and immunology of turkeys.

    Science.gov (United States)

    Chowdhury, S R; Smith, T K; Boermans, H J; Woodward, B

    2005-11-01

    Feeding grains naturally-contaminated with Fusarium mycotoxins has been shown to alter the metabolism and performance of turkeys. The objectives of the current experiment were to examine the effects of feeding turkeys with grains naturally contaminated with Fusarium mycotoxins on their hematology and immunological indices (including functions), and the possible protective effect of feeding a polymeric glucomannan mycotoxin adsorbent (GMA). Two hundred twenty-five 1-d-old male turkey poults were fed corn, wheat, and soybean meal-based starter (0 to 3 wk), grower (4 to 6 wk), developer (7 to 9 wk), and finisher (10 to 12 wk) diets formulated with uncontaminated grains, contaminated grains, or contaminated grains with 0.2% GMA. The chronic consumption of Fusarium mycotoxins caused minor and transient changes in hematocrit (0.33 L/L) and hemoglobin (10(6) g/L) concentrations as well as in blood basophil (0.13 x 10(9)/L) and monocyte counts (3.42 x 10(9)/L) compared with controls. Supplementation of the contaminated diet with GMA prevented these effects on blood cell counts. Biliary IgA concentrations were significantly increased (4.45-fold) when birds were fed contaminated grains compared with controls, but serum IgA concentrations were not affected. Contact hypersensitivity to dinitrochlorobenzene, which is a CD8+ T-cell-mediated delayed-type hypersensitivity response, was decreased (48%) by feed-borne mycotoxins compared with the control. By contrast, the primary and secondary antibody response to sheep red blood cells, a CD4+ T-cell-mediated response, was not affected. It was concluded that chronic consumption of grains naturally contaminated with Fusarium mycotoxins exerts only minor adverse effects on the hematology and some immunological indices of turkeys. Consumption of grains naturally contaminated with Fusarium mycotoxins may, however, increase the susceptibility of turkeys to infectious agents against which CD8+ T cells play a major role in defense.

  8. The effect of solar-geomagnetic activity during and after admission on survival in patients with acute coronary syndromes

    Science.gov (United States)

    Vencloviene, Jone; Babarskiene, Ruta; Milvidaite, Irena; Kubilius, Raimondas; Stasionyte, Jolanta

    2014-08-01

    A number of studies have established the effects of solar-geomagnetic activity on the human cardio-vascular system. It is plausible that the heliophysical conditions existing during and after hospital admission may affect survival in patients with acute coronary syndromes (ACS). We analyzed data from 1,413 ACS patients who were admitted to the Hospital of Kaunas University of Medicine, Lithuania, and who survived for more than 4 days. We evaluated the associations between active-stormy geomagnetic activity (GMA), solar proton events (SPE), and solar flares (SF) that occurred 0-3 days before and after admission, and 2-year survival, based on Cox's proportional-hazards model, controlling for clinical data. After adjustment for clinical variables, active-stormy GMA on the 2nd day after admission was associated with an increased (by 1.58 times) hazard ratio (HR) of cardiovascular death (HR = 1.58, 95 % CI 1.07-2.32). For women, geomagnetic storm (GS) 2 days after SPE occurred 1 day after admission increased the HR by 3.91 times (HR = 3.91, 95 % CI 1.31-11.7); active-stormy GMA during the 2nd-3rd day after admission increased the HR by over 2.5 times (HR = 2.66, 95 % CI 1.40-5.03). In patients aged over 70 years, GS occurring 1 day before or 2 days after admission, increased the HR by 2.5 times, compared to quiet days; GS in conjunction with SF on the previous day, nearly tripled the HR (HR = 3.08, 95 % CI 1.32-7.20). These findings suggest that the heliophysical conditions before or after the admission affect the hazard ratio of lethal outcome; adjusting for clinical variables, these effects were stronger for women and older patients.

  9. Magnetic storms and variations in hormone levels among residents of North Polar area - Svalbard

    Science.gov (United States)

    Breus, Tamara; Zenchenko, Tatiana; Boiko, Evgeni

    It was previously shown that magnetic storms lead to an increase in the level of cortisol and noradrenalin in healthy and sick people with cardiovascular diseases [Breus Rapoport. 2003]. However, in the healthy group in the cited study was only 4 people and it seemed that these results need to be checked. In the present work the 4 examinations (January, March, June, October) of large groups of healthy inhabitants of high latitudes (Svalbard, the most northerly in the world year-round inhabited settlements) on the blood levels of adrenal hormones (cortisol) and thyroid hormones (triiodothyronine (T3 ) and thyroxine T4) have been done. The aim was to study the possible sensitivity of these biochemical parameters in three independent groups of people living in this region (men working underground (364 samples), the men working on the ground (274 samples) and women (280 samples)) to variations in external natural factors of high latitudes. For the analysis we used the following parameters of space and terrestrial weather :index of intensity of solar radio emission at a wavelength 10.7sm (RF10.7), planetary geomagnetic activity index - daily Kp index ( Kp) , the daily average Ap index ( Ap) , the maximum per every 3 -hour Kp index ) as well as the daily average indicators of flow rate of galactic cosmic rays neutron component (N), atmospheric pressure ( RATM ) and its rate of change ( the difference between the Ratm today and yesterday ) according to the geophysical station Oulu (Finland , http://cosmicrays.oulu.fi/). The obtained data indicate that the most expressed dependence of the level of studied three hormones is from the level of geomagnetic activity (GMA)-Kp, Ap, Kpmax - 3h. For two of the four seasons (June and October) with increasing levels of GMA a significant (p stress reaction in reply on GMA disturbance. 1. Breus T.K. and Rapoport S.I. Magnetic storms. Medico- biological aspects (in Russian), Publ.Co Soviet Sport,.Moscow, 2003, 271p.

  10. Effect of food simulating liquids on release of monomers from two dental resin composites

    Directory of Open Access Journals (Sweden)

    Ghavam M

    2010-06-01

    Full Text Available "nBackground and Aims: The elution of residual monomers from cured dental composites to oral cavity has a harmful effect on human health and can affect their clinical durability. The purpose of this study was to evaluate the amount of eluted monomers (Bis-GMA, TEGDMA, UDMA from two types of composites (Gradia and P60 after exposure to food simulating liquids such as ethanol (25, 50, 75 % and heptane 50 % for 24 hours and 7 days. "nMaterials and Methods: Forty specimens of each composite were prepared. Equal numbers of each composite were immersed in tubes containing 2cc volumes of 25, 50, 75 % ethanole and 50 % heptane. The amount of eluted monomers in standard condition such as Bis-GMA, TEGDMA and UDMA was measured by GC/MS (Gas Chromatography/Mass Spectroscopy and results were statistically analysed by three way and one way ANOVA. P<0.05 was considered as the level of significancy. "nResults: The results showed that Gradia released more TEGDMA than P60. In assessing the effect of environment, the result showed that ethanol caused releasing monomers more than heptane and the concentration rate of 75 % ethanole resulted in most releasing of monomers. In assessing the effect of time, the observation showed that more monomers were released 7 days compared to 24 hours. Bis-GMA and UDMA were not detected in any solutions in these conditions. "nConclusion: Ethanole caused more release of monomers than heptane and 75 % ethanole released the most amount of monomers. Gradia released more amount of TEGDMA than P60.

  11. Glycidyl methacrylate-co-N-vinyl-2-pyrrolidone coated polypropylene strips: Synthesis, characterization and standardization for dot-enzyme linked immunosorbent assay

    Energy Technology Data Exchange (ETDEWEB)

    Tyagi, Charu; Tomar, Lomas [Centre for Biomedical Engineering, Indian Institute of Technology, Delhi 110016 (India); Singh, Harpal [Centre for Biomedical Engineering, Indian Institute of Technology, Delhi 110016 (India)], E-mail: tyagicharu11@rediffmail.com

    2009-01-26

    Glycidyl methacrylate and N-vinyl-2-pyrrolidone (GMA-co-NVP) copolymers with various GMA:NVP ratios were synthesized by solution polymerization technique in toluene using 2,2'-azobisisobutyronitrile (AIBN) as free radical initiator and dip coated onto polypropylene strips. The copolymer composition in polymeric coatings was confirmed by proton NMR spectroscopy. Various techniques like FTIR, SEM and contact angle were used for surface characterization of the polymer coatings. These polymer coated strips were evaluated and standardized for their application in dot-ELISA in two steps. In first step, specificity, sensitivity and reproducibility of the assay on developed polymer coated strips was evaluated through a model system using rabbit anti-goat IgG, goat anti-rabbit IgG and goat anti-rabbit IgG HRP (horseradish peroxidase)-conjugate. Polymer coating with GMA-NVP mol% ratio of 78:22 was able to detect rabbit anti-goat IgG antibody at a concentration as low as 2 ng mL{sup -1} with 1% BSA as blocking agent using antispecies IgG peroxidase conjugate diluted 1500 times. In the second step, the sensitivity and specificity of the developed system was established with human blood and finally used to identify the source of mosquito blood meal which is an important parameter in epidemiological studies, particularly in determining the role of mosquito in malaria transmission. The time duration of standardized assay with developed polymer coated strips was cut down to one hour compared to the 3-4 h required in usual dot-ELISA.

  12. Guidelines on the medical management of tritiated water overexposures

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-09-01

    The Medical Advisers to the Atomic Energy Control Board provide advice to occupational and family physicians treating overexposed workers. GMA-7 provides information and guidance to medical practitioners on the medical management of individuals who have been overexposed to tritiated water. Various treatment principles are presented with special emphasis on techniques for facilitating removal of tritiated water from the body so as to reduce the total radiation dose. Risks and biological effects from exposures to tritiated water and various radiation protection precautions are also discussed. 32 refs., 1 tab.

  13. Guidelines on the medical management of tritiated water overexposures

    International Nuclear Information System (INIS)

    1995-09-01

    The Medical Advisers to the Atomic Energy Control Board provide advice to occupational and family physicians treating overexposed workers. GMA-7 provides information and guidance to medical practitioners on the medical management of individuals who have been overexposed to tritiated water. Various treatment principles are presented with special emphasis on techniques for facilitating removal of tritiated water from the body so as to reduce the total radiation dose. Risks and biological effects from exposures to tritiated water and various radiation protection precautions are also discussed. 32 refs., 1 tab

  14. Weldability of thermally grain-refined Fe-12Ni-0.25Ti for cryogenic structural applications

    International Nuclear Information System (INIS)

    Williams, D.E.

    1980-02-01

    The weldability of a research alloy designed for structural use in liquid helium temperature, cryogenic environments was investigated. Plates of iron-12 weight percent nickel-0.25 weight percent titanium were grain refined by the four-step, grain refining thermal treatment developed for this alloy and welded with Inconel Number 92 weld wire using the Gas Metal Arc (GMA) welding process with argon-15% helium gas shielding. Both a single pass and a double-sided, 2 pass electron beam (EB) weld were also made without filler metal addition. Weldments were radiographed and sectioned and the charpy V-notch specimens removed were tested at liquid nitrogen and helium temperatures

  15. Degree of conversion and monomer elution of CQ/amine and TPO adhesives.

    Science.gov (United States)

    Pongprueksa, Pong; Miletic, Vesna; Janssens, Henriette; Van Landuyt, Kirsten L; De Munck, Jan; Godderis, Lode; Van Meerbeek, Bart

    2014-06-01

    To evaluate the effect of photo-initiator on the degree of conversion (DC) and elution of Bis-GMA and HEMA for 8 one-step adhesive formulations. We used Scotchbond Universal ('SBU-CQ/amine_4.0', 3M ESPE), containing about 2wt% camphorquinone (CQ) and 2wt% ethyl-4-dimethylamino benzoate (EDMAB), an experimental 'SBU-TPO_2.1' version, containing 2.1wt% diphenyl(2,4,6-trimethylbenzoyl)phosphine oxide (TPO), and 6 experimental LUB adhesives (Kuraray Noritake), namely 'LUB-CQ/amine_0.7', 'LUB-CQ/amine_1.4', 'LUB-CQ/amine_4.0', 'LUB-TPO_0.35', 'LUB-TPO_0.7' and 'LUB-TPO_2.0', respectively containing 0.35wt% CQ and 0.35wt% EDMAB, 0.7wt% CQ and 0.7wt% EDMAB, 2.0wt% CQ and 2.0wt% EDMAB, 0.35wt% TPO, 0.7wt% TPO, and 2.0wt% TPO. DC was measured using micro-Raman spectroscopy. Additional specimens were immersed in ethanol for 24h to determine the elution of Bis-GMA and HEMA using HPLC. DC of the respective SBU and LUB adhesives was alike at high photo-initiator concentration. At low concentration, TPO was significantly more efficient than CQ/amine (LUB adhesives only). A statistically significant positive photo-initiator concentration effect on DC was noted for both CQ/amine and TPO (LUB adhesives only). A statistically significant inverse photo-initiator concentration effect on HEMA elution was noted for both the CQ/amine- and TPO-containing LUB adhesives. A significantly strong correlation was found between DC and Bis-GMA elution (R(2)=0.744, p=0.026), and between DC and HEMA elution (R(2)=0.913, p=0.002) for the LUB adhesives. The photo-initiator kind and concentration affect DC and the Bis-GMA/HEMA elution. TPO can be used as an alternative photo-initiator for CQ/amine. Copyright © 2014 Academy of Dental Materials. Published by Elsevier Ltd. All rights reserved.

  16. Proceedings of the Annual Meeting (21st), Aquatic Plant Control Research Program Held in Mobile, Alabama on 17-21 November 1986

    Science.gov (United States)

    1987-11-01

    E. Westerdahl , WES, Presiding 8:15 a.m. Aquatic Herbicide User Guide Herbicide Concentration/Exposure Time Relationships-2,4-D, Sonar, Endothall, and...Diquat -H. E. Westerdahl 8:30 a.m. Controlled-Release Poly GMA/2,4-D Evaluation -R. Gupta, Day Chem, Inc., Dayton, Ohio 8:45 a.m. Herbicide/Adjuvant...0631 USAE Waterways Experiment Howard Westerdahl Station, PO Box 631 USAE Waterways Experiment Vicksburg, MS 39180-0631 Station, PO Box 631 Michael

  17. Advancing Military Professionalism in Africa

    Science.gov (United States)

    2014-07-01

    professional military. It simultaneously undermines a military’s commitment to protect the country and its citizens. Plato noted some 2,400 years ago...stepping down from his post as Senior Advisor to the President on Defence and Security.42 He procured not only spoiled food rations for the Ugandan... Plato , The Republic, tr. G.M.A. Grube (Hacket, 1992), 417b and 434a-b. 17 “Above the State: The Officers’ Republic in Egypt,” Carnegie Middle East Center

  18. Hot coiled steel strip with elevated niobium content for pipelines and its weldability

    International Nuclear Information System (INIS)

    Brozda, J.; Zeman, M.

    2010-01-01

    Examinations and tests have been performed on thermomechanically rolled and hot coiled 14 mm thick steel strips with a low carbon and elevated niobium content, assigned for the production of pipelines. There were examined basic mechanical properties of the steels, brittle fracture resistance of the parent material and simulated HAZ's, susceptibility to cold cracking as well as properties of MMA and GMA welded joints. It was found that the tested steels are characterized by a good weldability, are not prone to cold cracking, have a low brittle fracture transition temperature and the HAZ of welded joints shows a sufficient high brittle fracture resistance. (authors)

  19. Making waves in seismic exploration software: Annual report 1998

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-07-01

    GMA International is in the business of developing and supplying geological, geophysical and petrophysical computer-aided exploration software products for use in hydrocarbon exploration and exploitation world-wide. The company is headquartered in Calgary; it also has offices in Houston and London. It has over 5,500 installations and licensing arrangements with over 700 companies in 53 countries. This report details operating results during 1998, which included adding 77 new clients and the sale of over 300 new software licenses to new and existing clients. Consolidated balance sheets provide statements of earning (losses) and retained earnings, and changes in the company's financial position.

  20. Making waves in seismic exploration software: Annual report 1998

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-11-01

    GMA International is in the business of developing and supplying geological, geophysical and petrophysical computer-aided exploration software products for use in hydrocarbon exploration and exploitation world-wide. The company is headquartered in Calgary; it also has offices in Houston and London. It has over 5,500 installations and licensing arrangements with over 700 companies in 53 countries. This report details operating results during 1998, which included adding 77 new clients and the sale of over 300 new software licenses to new and existing clients. Consolidated balance sheets provide statements of earning (losses) and retained earnings, and changes in the company`s financial position.