Sproll, Véronique; Schmidt, Thomas J.; Gubler, Lorenz
2018-03-01
The aim of this work was to investigate how hygroscopic moieties like hydrolyzed glycidyl methacrylate (GMA) influence the properties of sulfonated polysytrene based proton exchange membranes (PEM). Therefore, several membranes were synthesized by electron beam treatment of the ETFE (ethylene-alt-tetrafluoroethylene) base film with a subsequent co-grafting of styrene and GMA at different ratios. The obtained membranes were sulfonated to introduce proton conducting groups and the epoxide moiety of the GMA unit was hydrolyzed for a better water absorption. The PEM was investigated regarding its structural composition, water uptake and through-plane conductivity. It could be shown that the density of sulfonic acid groups has a higher influence on the proton conductivity of the PEM than an increased water uptake.
Dawlee, S; Jayakrishnan, A; Jayabalan, M
2009-12-01
A new class of radiopaque copolymer using methyl methacrylate (MMA) and glycidyl methacrylate (GMA) monomers was synthesized and characterized. The copolymer was made radiopaque by the epoxide ring opening of GMA using the catalyst o-phenylenediamine and the subsequent covalent attachment of elemental iodine. The copolymer was characterized by Fourier transform infrared (FTIR) spectra, energy dispersive X-ray analysis using environmental scanning electron microscope (EDAX), thermogravimetric analysis (TGA), and differential scanning calorimetry (DSC). X-ray visibility of the copolymer was checked by X-radiography. Blood compatibility and cytotoxicity of the newly synthesized copolymer were also evaluated. The iodinated copolymer was thermally stable, blood compatible, non-cytotoxic, and highly radiopaque. The presence of bulky iodine group created a new copolymer with modified properties for potential use in biomedical applications.
Magnetic poly(glycidyl methacrylate) microspheres for protein capture.
Koubková, Jana; Müller, Petr; Hlídková, Helena; Plichta, Zdeněk; Proks, Vladimír; Vojtěšek, Bořivoj; Horák, Daniel
2014-09-25
The efficient isolation and concentration of protein antigens from complex biological samples is a critical step in several analytical methods, such as mass spectrometry, flow cytometry and immunochemistry. These techniques take advantage of magnetic microspheres as immunosorbents. The focus of this study was on the development of new superparamagnetic polymer microspheres for the specific isolation of the tumor suppressor protein p53. Monodisperse macroporous poly(glycidyl methacrylate) (PGMA) microspheres measuring approximately 5 μm and containing carboxyl groups were prepared by multistep swelling polymerization of glycidyl methacrylate (GMA), 2-[(methoxycarbonyl)methoxy]ethyl methacrylate (MCMEMA) and ethylene dimethylacrylate (EDMA) as a crosslinker in the presence of cyclohexyl acetate as a porogen. To render the microspheres magnetic, iron oxide was precipitated within their pores; the Fe content in the particles received ∼18 wt%. Nonspecific interactions between the magnetic particles and biological media were minimized by coating the microspheres with poly(ethylene glycol) (PEG) terminated by carboxyl groups. The carboxyl groups of the magnetic PGMA microspheres were conjugated with primary amino groups of mouse monoclonal DO-1 antibody using conventional carbodiimide chemistry. The efficiency of protein p53 capture and the degree of nonspecific adsorption on neat and PEG-coated magnetic microspheres were determined by western blot analysis. Copyright © 2014 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Tong Long; Zu Jianhua; Liu Xinwen; Sun Guisheng; Yu Chunhui
2006-01-01
Glycidyl methacrylate (GMA) was grafted onto HDPE membranes by pre-irradiation method with 1.8 MeV E-beam and a kind of membranes having reactive epoxy groups was successfully synthesized. Effects of monomer concentration, reaction temperature and time and irradiation dose on the grafting yield were studied. Composition, thermo-property and surface morphology of the grafted membranes were studied by FTIR, DSC and Tapping-mode AFM, respectively. The FTIR measurements proved the synthesized copolymer is HDPE-g-GMA. The DSC results indicated the grafted HDPE's melting temperature (T m ) and heat of fusion (ΔH f ( HDPE) ) which was reduced with increasing grafting yield. The AFM images indicated that surface of the HDPE-g-GMA membranes was rougher than the virgin HDPE. (authors)
Thin-film type Li-ion battery, using a polyethylene separator grafted with glycidyl methacrylate
International Nuclear Information System (INIS)
Ko, J.M.; Min, B.G.; Kim, D.-W.; Ryu, K.S.; Kim, K.M.; Lee, Y.G.; Chang, S.H.
2004-01-01
For the improvement of organic electrolyte holding ability, the hydrophobic surface of a porous polyethylene (PE)-membrane separator was modified by grafting a hydrophilic monomer, glycidyl methacrylate (GMA), PE-g-GMA, by using electron beam technology, and applied to a thin film type Li-ion battery to elucidate the effect of a surface modification of a PE membrane separator on the cyclic life of Li-ion batteries. The Li-ion battery using the PE-g-GMA membrane separator showed a better cycle life than that of the unmodified PE membrane separator, indicating that the surface hydrophilicity of the PE membrane separator improved the electrolyte holding capability between the electrodes in the Li-ion cell and prevented the electrolyte leakage
International Nuclear Information System (INIS)
Selambakkannu, S.; Nor Azillah Fatimah Othman; Siti Fatahiyah Mohamad
2016-01-01
This paper focused on pre-treated banana fibers as a trunk polymer for optimization of radiation-induced graft copolymerization process parameters. Pre-treated banana fiber was grafted with glycidyl methacrylate (GMA) via electron beam irradiation. Optimization of grafting parameters in term of grafting yield was analyzed at numerous radiation dose, monomer concentration and reaction time. Grafting yield had been calculated gravimetrically against all the process parameters. The grafting yield at 40 kGy had increases from 14 % to 22.5 % at 1 h and 24 h of reaction time respectively. Grafting yield at 1 % of GMA was about 58 % and it increases to 187 % at 3 % GMA. The grafting of GMA onto pre-treated banana fibers confirmed with the characterization using FTIR, SEM and TGA. Grafting of GMA onto pre-treated fibers was successfully carried out and it was confirmed by the results obtained via the characterization. (author)
AFM study of the morphologic change of HDPE surface photografted with glycidyl methacrylate.
Wang, Huiliang; Han, Jianmei
2009-05-01
The UV-induced grafting of glycidyl methacrylate (GMA) onto high-density polyethylene (HDPE) and the atomic force microscopy (AFM) study of the morphologic change of the grafted surface are reported. The grafting was carried out in GMA acetone solutions with different monomer concentrations. Grafting was much faster in a solution with a higher monomer concentration. FTIR analyses proved that GMA had been successfully grafted onto HDPE. The morphologies of grafted HDPE surfaces changed with UV irradiation time. The monomer concentration had a significant effect on the morphologies of the grafted HDPE surfaces. The HDPE surface grafted in a solution with a higher monomer concentration was much rougher than that grafted in a solution with a lower monomer concentration. The growth models of the grafted granules or clusters are also proposed.
Syntheses of amine-type adsorbents with emulsion graft polymerization of glycidyl methacrylate
International Nuclear Information System (INIS)
Seko, N.; Bang, L.T.; Tamada, M.
2007-01-01
Glycidyl methacrylate (GMA) which was precursor monomer for the synthesis of metal ion adsorbent was emulsified by surfactant of Tween 20 (Tw-20). The emulsion of 5% GMA in the water was stable for 48 h at Tw-20 concentration of 0.5%. Graft polymerization of GMA on polyethylene fiber was carried out in the emulsion state at various pre-irradiation doses. Degree of grafting (Dg) reached 103%, 301% and 348% for 1 h grafting at 40 deg. C with pre-irradiation of 10, 30 and 40 kGy, respectively. But the Dg was depressed when the pre-irradiation dose was over 50 kGy since cross-linking occurred simultaneously in the trunk polymer. Dg decreased with increment of Tw-20 concentration in emulsion of 5% GMA at pre-irradiation of 40 kGy. The three kinds of amine-type adsorbents were synthesized by reacting diethylenetriamine (DETA), triethylenetetramine (TETA) and ethylenediamine (EDA) with GMA-grafted polyethylene fiber. The synthesized EDA-type adsorbent had the highest selectivity against U ion and the distribution coefficient was 2.0 x 10 6
Mahmoud Nasef, Mohamed; Abbasi, Ali; Ting, T. M.
2014-10-01
A new CO2 adsorbent containing triethylamine (TEA) was prepared by radiation induced grafting of glycidyl methacrylate (GMA) onto polyethylene coated polypropylene (PE-PP) non-woven sheet followed by amination reaction. The degree of grafting (DOG%) was controlled by variation of monomer concentration and absorbed dose. The incorporation of aminated poly(GMA) was investigated by Fourier transform infrared (FTIR) and scanning electron microscope (SEM). The adsorbent with DOG of 350% and amination yield of 60% exhibited CO2 adsorption capacity of 4.52 mol/kg at ambient temperature and pressure.
Synthesis and characterization of monosize magnetic poly(glycidyl methacrylate) beads
Institute of Scientific and Technical Information of China (English)
Evrim Banu Alt1nta(s); Lokman Uzun; Adil Denizli
2007-01-01
Monosize, 1.6 μm, magnetic beads of poly(glycidyl methacrylate) [M-poly(GMA)], were prepared by dispersion polymerization in the presence of Fe3O4 nano-powder. Monosize M-poly(GMA) beads were characterized by swelling tests, density measurements, electron spin resonance (ESR), vibrating sample magnetometer (VSM) and scanning electron microscopy (SEM). The characteristic functional groups of M-poly(GMA)beads were analyzed by Fourier transform infrared spectrometer (FTIR). The M-poly(GMA) beads are highly uniform in size and have a spherical shape and non-porous structure. Polydispersity index (PDI) of M-poly(GMA) beads was calculated to be around 1.008. The hydrated density of the M-poly(GMA) beads measured at 25 ℃ was 1.14 g/cm3. The content of oxirane groups on the surface of the M-poly(GMA) sample was found to be 3.46 mmol/g by using perchloric acid titration. The specific surface area of the M-poly(GMA) beads was determined to be 3.2 m2/g.The equilibrium swelling ratio was 52%. The volume fraction of magnetite nanopowder in the M-poly(GMA) beads was found to be 4.5%. The g factor, that can be considered as a quantity characteristic of the molecules in which the unpaired electrons are located, was found to be 2.28for M-poly(GMA). The external magnetic field at resonance was calculated to be 2055 Gs which was found sufficient to excite all of the dipole moments present in 1.0 g of M-poly(GMA) sample.
In vivo genotoxicity assessment of acrylamide and glycidyl methacrylate.
Dobrovolsky, Vasily N; Pacheco-Martinez, M Monserrat; McDaniel, L Patrice; Pearce, Mason G; Ding, Wei
2016-01-01
Acrylamide (ACR) and glycidyl methacrylate (GMA) are structurally related compounds used for making polymers with various properties. Both chemicals can be present in food either as a byproduct of processing or a constituent of packaging. We performed a comprehensive evaluation of ACR and GMA genotoxicity in Fisher 344 rats using repeated gavage administrations. Clastogenicity was measured by scoring micronucleated (MN) erythrocytes from peripheral blood, DNA damage in liver, bone marrow and kidneys was measured using the Comet assay, and gene mutation was measured using the red blood cell (RBC) and reticulocyte Pig-a assay. A limited histopathology evaluation was performed in order to determine levels of cytotoxicity. Doses of up to 20 mg/kg/day of ACR and up to 250 mg/kg/day of GMA were used. ACR treatment resulted in DNA damage in the liver, but not in the bone marrow. While ACR was not a clastogen, it was a weak (equivocal) mutagen in the cells of bone marrow. GMA caused DNA damage in the cells of bone marrow, liver and kidney, and induced MN reticulocytes and Pig-a mutant RBCs in a dose-dependent manner. Collectively, our data suggest that both compounds are in vivo genotoxins, but the genotoxicity of ACR is tissue specific. Published by Elsevier Ltd.
Moawia, Rihab Musaad; Nasef, Mohamed Mahmoud; Mohamed, Nor Hasimah; Ripin, Adnan
2016-05-01
Flax fibres were modified by radiation induced graft copolymerization of glycidyl methacrylate (GMA) by pre-irradiation method in an emulsion medium. The effect of reaction parameters on the degree of grafting (DOG) such as concentration of bleaching agent, absorbed dose, monomer concentration, temperature and reaction time were investigated. The DOG was found to be dependent on the investigated parameters. The incorporation of poly(GMA) grafts in the bleached flax fibres was confirmed by Fourier transform infrared spectroscopy (FTIR) and scanning electron microscopy (SEM). The structural and mechanical changes were evaluated by X-ray diffraction (XRD) and mechanical tester, respectively. The results revealed that reacting bleached flax fibres irradiated with 20 kGy with 5% GMA emulsion containing 0.5% polyoxyethylene-sorbitan monolaurate (Tween 20) surfactant at 40 °C for 1 h led to a maximum DOG of 148%. The grafted fibres showed sufficient mechanical strength and hydrophobicity which make them promising precursors for development of adsorbents after appropriate chemical treatments.
Stabilitas emulsi kopolimer S-GMA (stirena – glisidil metakrilat
Directory of Open Access Journals (Sweden)
Isananto Winursito
1992-08-01
Full Text Available Epoxy groups in glycidyl methacrylate (GMA units have been available for the reaction with amine of proteins or other biological active substrates to prepare biomaterials and hybrid devices. Soap-soap copolymerization of GMA with styrene (S result the formation of stable latex. Hydrolysis of epoxy groups in copolymer particles increased emulsion stability. The effect of pH, temperature and reaction time in the hydrolysis of S-GMA copolymer have been investigated.
Wang, Hejing; Qian, Junmin; Zhang, Yaping; Xu, Weijun; Xiao, Juxiang; Suo, Aili
2017-01-01
Breast cancer negatively affects women's health worldwide. The tumour microenvironment plays a critical role in tumour initiation, proliferation, and metastasis. Cancer cells are traditionally grown in two-dimensional (2D) cultures as monolayers on a flat solid surface lacking cell-cell and cell-matrix interactions. These experimental conditions deviate from the clinical situation. Improved experimental systems that can mimic the in vivo situation are required to discover new therapies, particularly for anti-angiogenic agents that mainly target intercellular factors and play an essential role in treating some cancers. Chitosan can be modified to construct three-dimensional (3D) tumour models. Here, we report an in vitro 3D tumour model using a hydroxyethyl chitosan/glycidyl methacrylate (HECS-GMA) hydrogel produced by a series of chitosan modifications. Parameters relating to cell morphology, viability, proliferation, and migration were analysed using breast cancer MCF-7 cells. In a xenograft model, secretion of angiogenesis-related growth factors and the anti-angiogenic efficacy of Endostar and Bevacizumab in cells grown in HECS-GMA hydrogels were assessed by immunohistochemistry. Hydroxyethyl chitosan/glycidyl methacrylate hydrogels had a highly porous microstructure, mechanical properties, swelling ratio, and morphology consistent with a 3D tumour model. Compared with a 2D monolayer culture, breast cancer MCF-7 cells residing in the HECS-GMA hydrogels grew as tumour-like clusters in a 3D formation. In a xenograft model, MCF-7 cells cultured in the HECS-GMA hydrogels had increased secretion of angiogenesis-related growth factors. Recombinant human endostatin (Endostar), but not Bevacizumab (Avastin), was an effective anti-angiogenic agent in HECS-GMA hydrogels. The HECS-GMA hydrogel provided a 3D tumour model that mimicked the in vivo cancer microenvironment and supported the growth of MCF7 cells better than traditional tissue culture plates. The HECS-GMA
International Nuclear Information System (INIS)
Moawia, Rihab Musaad; Nasef, Mohamed Mahmoud; Mohamed, Nor Hasimah; Ripin, Adnan
2016-01-01
Flax fibres were modified by radiation induced graft copolymerization of glycidyl methacrylate (GMA) by pre-irradiation method in an emulsion medium. The effect of reaction parameters on the degree of grafting (DOG) such as concentration of bleaching agent, absorbed dose, monomer concentration, temperature and reaction time were investigated. The DOG was found to be dependent on the investigated parameters. The incorporation of poly(GMA) grafts in the bleached flax fibres was confirmed by Fourier transform infrared spectroscopy (FTIR) and scanning electron microscopy (SEM). The structural and mechanical changes were evaluated by X-ray diffraction (XRD) and mechanical tester, respectively. The results revealed that reacting bleached flax fibres irradiated with 20 kGy with 5% GMA emulsion containing 0.5% polyoxyethylene-sorbitan monolaurate (Tween 20) surfactant at 40 °C for 1 h led to a maximum DOG of 148%. The grafted fibres showed sufficient mechanical strength and hydrophobicity which make them promising precursors for development of adsorbents after appropriate chemical treatments. - Highlights: • Flax fibers were modified by radiation induced emulsion grafting of GMA. • Bleaching with 0.7 wt% Na-chlorite was essential for achieving high DOGs. • Effect of reaction parameters on the degree of grafting were established. • The incorporation of poly-GMA grafts was proved by SEM, FTIR and XRD. • The obtained poly-GMA grafted flax fibers have potential for adsorbent making.
International Nuclear Information System (INIS)
Bondar, Yu.V.; Kim, H.J.; Lim, Y.J.; Kravets, L.I.
2004-01-01
Full text: Two types of sorption-active polypropylene fiber carrying strong-acid sulfonate groups and amino groups have been synthesized by radiation-induced graft polymerization of glycidyl methacrylate (GMA) with subsequent chemical modification of the epoxy groups of poly-GMA graft chains. The effect of various polymerization parameters on the GMA grafting degree was investigated in detail. The epoxy ring-opening of poly-GMA graft chains with introduction of strong-acid sulfonate groups was carried out with sodium hydrogen sulfite in water-dimethylformamide solution at 70 o C. The main peculiarities of the sulfonation reaction in depending on the reaction time and GMA grafting degree have been investigated. It was shown that for the samples with GMA grafting degree more than 50% two simultaneous processes take place during the sulfonation reaction, namely the incorporation of the sulfonate groups via opening of the GMA epoxy-rings as well as hydrolysis of the GMA epoxy-rings with the formation of α-glycol groups. Amine groups were incorporated by treatment of GMA-grafted polypropylene fibers with excess of diethylene triamine reagent. The conversion of the epoxy groups into the functional groups was investigated as a function of the degree of GMA grafting and reaction time. The ion-exchange characteristics of obtained sorption-active polypropylene fibers were determined
International Nuclear Information System (INIS)
Bondar, Yu.V.; Kim, H.J.; Lim, Y.J.; Kravets, L.I.
2004-01-01
Two types of sorption-active polypropylene fiber carrying strong-acid sulfonate groups and amino groups have been synthesized by radiation-induced graft polymerization of glycidyl methacrylate (GMA) with subsequent chemical modification of the epoxy groups of poly-GMA graft chains. The effect of various polymerization parameters on the GMA grafting degree was investigated in detail. The epoxy ring-opening of poly-GMA graft chains with introduction of strong-acid sulfonate groups was carried out with sodium hydrogen sulfite in water-dimethylformamide solution at 70 o C. The main peculiarities of the sulfonation reaction in depending on the reaction time and GMA grafting degree have been investigated. It was shown that for the samples with GMA grafting degree more than 50% two simultaneous processes take place during the sulfonation reaction, namely the incorporation of the sulfonate groups via opening of the GMA epoxy-rings as well as hydrolysis of the GMA epoxy-rings with the formation of α-glycol groups. Amine groups were incorporated by treatment of GMA-grafted polypropylene fibers with excess of diethylene triamine reagent. The conversion of the epoxy groups into the functional groups was investigated as a function of the degree of GMA grafting and reaction time. The ion-exchange characteristics of obtained sorption-active polypropylene fibers were determined. (author)
Immobilization of α-amylase onto poly(glycidyl methacrylate) grafted electrospun fibers by ATRP
International Nuclear Information System (INIS)
Oktay, Burcu; Demir, Serap; Kayaman-Apohan, Nilhan
2015-01-01
In this study, novel α-amylase immobilized poly(vinyl alcohol) (PVA) nanofibers were prepared. The PVA nanofiber surfaces were functionalized with 2-bromoisobutyryl bromide (BiBBr) and followed by surface initiated atom transfer radical polymerization (SI-ATRP) of glycidyl methacrylate (GMA). The morphology of the poly(glycidyl methacrylate) (PGMA) grafted PVA nanofibers was characterized by scanning electron microscopy (SEM). Also PGMA brushes were confirmed by X-ray photo electron microscopy (XPS). α-Amylase was immobilized in a one step process onto the PGMA grafted PVA nanofiber. The characteristic properties of the immobilized and free enzymes were examined. The thermal stability of the enzyme was improved and showed maximum activity at 37 °C by immobilization. pH values of the maximum activity of the free and immobilized enzymes were also found at 6.0 and 6.5, respectively. Free enzyme lost its activity completely within 15 days. The immobilized enzyme lost only 23.8% of its activity within 30 days. - Highlights: • Electrospun photocrosslinkable PVA nanofiber was prepared. • PGMA brushes were conducted on PVA nanofiber via SI-ATRP. • The immobilized enzyme showed maximum activity at pH 6.0 and at 37 °C. • Functionalized nanofibers may be used as promising supports for enzyme immobilization
International Nuclear Information System (INIS)
Abdel-Hady, E.E.; El-Toony, M.M.; Abdel-Hamed, M.O.
2013-01-01
Simultaneous gamma irradiation was used effectively for grafting facilitation of glycidyl methacrylate (GMA) and styrene (Sty) onto polyvinylidine fluoride (PVDF). Grafting percent was 122 when monomers ratio are 30% Sty and 70% GMA at 20 KGy gamma irradiation dose. Characterization of the membrane was performed using FT-IR, ion exchange capacity (IEC), water uptake. Mechanical behavior such as tensile strength was studied while morphological structure of the membrane was carried out by scan electron microscope (SEM). The membrane with degree of grafting 122% showed higher IEC (1.2 m mol/cm) than those of Nafion membrane with corresponding proton conductivity of 5.7 × 10 −2 S/cm similar to it. Operating the fuel cell unit showed higher voltage of the prepared membranes than that of Nafion 211. The prepared membranes stability for 300 h work approved their applicability from the cost benefit point of view
Radio-iodide uptake by modified poly (glycidyl methacrylate) as anion exchange resin
Energy Technology Data Exchange (ETDEWEB)
Othman, Sameh H. [Atomic Energy Authority, Cairo (Egypt). Nuclear Research Center; Atomic Energy Authority, Cairo (Egypt). Second Research Reactor; Elbarbary, Ahmed M. [Atomic Energy Authority, Cairo (Egypt). Radiation Research of Polymer Chemistry Dept.; Rashad, Ghada; Fasih, T.W. [Atomic Energy Authority, Cairo (Egypt). Hot Laboratories Center
2017-03-01
Poly(glycidyl methacrylate) (PGMA) microspheres were prepared by radiation induced polymerization of glycidyl methacrylate (GMA) monomer. The factors affecting the degree of polymerization and yield (%) of PGMA such as type of solvent, monomer concentration, and irradiation dose were investigated. It was found that the PGMA yield (%) increases with increasing monomer concentration up to 50% and absorbed dose of 5 kGy. The resulting PGMA containing the epoxy group was chemically modified by hydroxyl amine to act as anion-exchange resin for uptake of {sup 131}I{sup -} ions. The modified PGMA (MPGMA) was characterized by Fourier transform infrared (FT-IR) spectrophotometer, thermal gravimetric analysis (TGA) and scanning electron microscopy (SEM). I-131 is produced from the fission of U-235 with low-enrichment uranium (LEU) targets in the Egyptian Second Research Reactor (ETRR-2). Separation of iodide from the radioactive solution by batchwise and column techniques was employed to determine the adsorption capacity of the MPGMA. Quality control of {sup 131}I product solution and radiochemical purity was examined by using the ascending paper chromatography method. The uptake behavior of MPGMA towards {sup 131}I{sup -} ions were studied at different experimental conditions and achieved by X-ray fluorescence (XRF). The synthesized MPGMA showed good results as anion-exchange and an effective adsorbent for uptaking {sup 131}I{sup -} ions.
Directory of Open Access Journals (Sweden)
E. C. Muniz
2012-05-01
Full Text Available This work reports the preparation of hydrogels based on PVA-GMA, PVA-GMA is poly(vinyl alcohol (PVA functionalized with vinyl groups from glycidyl methacrylate (GMA, and on PVA-GMA with different content of chondroitin sulfate (CS. The degrees of swelling of PVA-GMA and PVA-GMA/CS hydrogels were evaluated in distilled water and the swelling kinetics was performed in simulated gastric and intestinal fluids (SGF and SIF. PVA-GMA and PVAGMA/CS hydrogels demonstrated to be resistant on SGF and SIF fluids. The elastic modulus, E, of swollen-hydrogels were determined through compressive tests and, according to the obtained results, the hydrogels presented good mechanical properties. At last, the presence of CS enhances the hydrogel cell compatibility as gathered by cytotoxicity assays. It was concluded that the hydrogels prepared through this work presented characteristics that allow them to be used as biomaterial, as a carrier in drug delivery system or to act as scaffolds in tissue engineering as well.
Directory of Open Access Journals (Sweden)
DU Jun
2017-12-01
Full Text Available Graft copolymers of PLA-g-MAH, PLA-g-GMA and PLA-co-MAH/GMA were prepared by means of melt grafting. The structure of the graft copolymers were characterized by FTIR.Wood flour/PLA composites were prepared by injection molding with three kinds of graft copolymers as compatibilizers, and the fractured morphology of composites was investigated by scanning electron microscope (SEM. Results show that there is no obvious phase interface between wood flour and PLA,which indicating the interfacial compatibility of wood flour/PLA composites is improved after adding different graft copolymers. The determination results of mechanical properties, processing flowability and dynamic rheological property of composites prepared with different graft copolymers reveal that, compared to the composite without compatibilizer, the tensile strength and impact strength of wood flour/PLA composites are increased by 9.54% and 7.23% respectively, and the equilibrium torque, shear heat, storage modulus and complex viscosity are all increased after adding maleic anhydride/glycidyl methacrylate cografted polylactic acid.
Energy Technology Data Exchange (ETDEWEB)
Chung, T.-H.; Chang, J.-Y. [Department of Chemical Engineering, National Chung Cheng University, Chiayi 621, Taiwan (China); Lee, W.-C. [Department of Chemical Engineering, National Chung Cheng University, Chiayi 621, Taiwan (China)], E-mail: chmwcl@ccu.edu.tw
2009-05-15
Surface-functionalized magnetic poly(styrene-glycidyl methacrylate) (PS-GMA) microspheres were prepared and coupled with Sca-1 antibody for cell selection from murine bone marrow mononuclear cells (MNCs). Biotinylated Sca-1 antibody could be directly coupled to avidin-bound magnetic microspheres. Alternatively, oxidized goat anti-mouse antibody was covalently bound onto the amino group-containing magnetic microspheres in a site-directed manner, and the resultant conjugate was coupled with non-modified Sca-1 antibody. Using the indirect antibody-bound magnetic microspheres, the purity of isolated Sca-1{sup +} cells increased with bead-to-cell ratio. Using a bead-to-cell ratio of 10 beads/cell, a purity of 85% Sca-1{sup +} cells corresponding to a 17-fold enrichment was achieved.
International Nuclear Information System (INIS)
Sharif, Jamaliah; Mohamad, Siti Fatahiyah; Fatimah Othman, Nor Azilah; Bakaruddin, Nurul Azra; Osman, Hasnul Nizam; Güven, Olgun
2013-01-01
Glycidyl methacrylate grafted kenaf (GMA-g-Kenaf) was prepared by pre-irradiation grafting technique. Kenaf fibers were treated with different concentration of sodium chlorite solution before used as trunk polymer. Treated kenaf fibers were irradiated by electron beam followed by grafting reaction in GMA/water emulsion system. The degree of grafting was determined as a function of absorbed dose, reaction time, reaction temperature and concentration of monomer. The results showed that the lignin content was decreased from 14.3% to as low as 3.3% with the increased of sodium chlorite concentration. This was evidenced by SEM pictures which show the surface of treated kenaf fibers was cleaner and smoother compared to that of untreated one. The degree of grafting increased with the increase of absorbed dose, reaction temperature, reaction time and monomer concentration as well as with decreasing lignin content. Formation of graft copolymer was confirmed with SEM, FTIR analysis. The structural investigation by XRD showed that degree of crystallinity of graft copolymers decreased with the increase in degree of grafting. - Highlights: • We used kenaf fibers for radiation induce graft copolymerization with GMA. • Kenaf fibers was treated to remove lignin in order to increase grafting yield. • Treated kenaf fibers were graft copolymerize through preirradiation technique. • Optimum conditions for graft copolymerization of kenaf fibers were established. • Formation of graft copolymer is also confirmed with SEM, FTIR and XRD
International Nuclear Information System (INIS)
Liu Jianhui; Feng Na; Chang Suqin; Kang Hongliang
2012-01-01
In order to improve the compatibility of magnesium hydroxide particles [Mg(OH) 2 ] and polymer matrix, poly(glycidyl methacrylate) (PGMA) grafted from magnesium hydroxide particles were synthesized via surface-initiated atom transfer radical polymerization (SI-ATRP). In this work, two approaches for the immobilization of ATRP initiator on the magnesium hydroxide particles surface were compared and selected. The density of initiator was significantly increased by the method of introducing more hydroxyl groups via ATRP of 2-hydroxyethyl methacrylate (HEMA) on the surface. The percentage of bromine atom for the initiator-functionalized magnesium hydroxide particles [Mg(OH) 2 -g-PHEMA-Br] reached to 1.75%, compared to 0.48% for Mg(OH) 2 -Br determined by XPS analysis. The surface-initiated ATRP of glycidyl methacrylate (GMA) can be conducted in a controlled manner, as revealed by the linear kinetic plot, linear increase of number average molecular weight (M n ) with monomer conversions, and the relatively narrow molecular weight distributions (M w /M n ∼ 1.4) of PGMA chains. The percentage of grafting PG (%) and the thickness of the grafted polymer layer increased with the increasing of polymerization time and reached to 116.6% and 197.6 nm after 300 min respectively. As for the polymerization with different initial monomer concentration, the number average molecular weights (M n ) and weight average molecular weights (M w ) of PGMA increased with the increasing of initial monomer concentration. TGA indicated that the initial decomposition temperature of Mg(OH) 2 -g-PHEMA-PGMA composite particles (253 °C) was much lower than that of unmodified magnesium hydroxide particles (337 °C).
Energy Technology Data Exchange (ETDEWEB)
Liu Jianhui [School of Textile and Materials Engineering, Dalian Polytechnic University, Dalian 116034 (China); Feng Na, E-mail: fengna12@163.com [School of Textile and Materials Engineering, Dalian Polytechnic University, Dalian 116034 (China); Chang Suqin [China Leather and Footwear Industry Research Institute, Beijing 100015 (China); Kang Hongliang [State Key Laboratory of Polymer Physics and Chemistry, Joint Laboratory of Polymer Science and Material, Beijing National Laboratory for Molecular Sciences (BNLMS), Institute of Chemistry, Chinese Academy of Sciences, Beijing 100080 (China)
2012-06-01
In order to improve the compatibility of magnesium hydroxide particles [Mg(OH){sub 2}] and polymer matrix, poly(glycidyl methacrylate) (PGMA) grafted from magnesium hydroxide particles were synthesized via surface-initiated atom transfer radical polymerization (SI-ATRP). In this work, two approaches for the immobilization of ATRP initiator on the magnesium hydroxide particles surface were compared and selected. The density of initiator was significantly increased by the method of introducing more hydroxyl groups via ATRP of 2-hydroxyethyl methacrylate (HEMA) on the surface. The percentage of bromine atom for the initiator-functionalized magnesium hydroxide particles [Mg(OH){sub 2}-g-PHEMA-Br] reached to 1.75%, compared to 0.48% for Mg(OH){sub 2}-Br determined by XPS analysis. The surface-initiated ATRP of glycidyl methacrylate (GMA) can be conducted in a controlled manner, as revealed by the linear kinetic plot, linear increase of number average molecular weight (M{sub n}) with monomer conversions, and the relatively narrow molecular weight distributions (M{sub w}/M{sub n} {approx} 1.4) of PGMA chains. The percentage of grafting PG (%) and the thickness of the grafted polymer layer increased with the increasing of polymerization time and reached to 116.6% and 197.6 nm after 300 min respectively. As for the polymerization with different initial monomer concentration, the number average molecular weights (M{sub n}) and weight average molecular weights (M{sub w}) of PGMA increased with the increasing of initial monomer concentration. TGA indicated that the initial decomposition temperature of Mg(OH){sub 2}-g-PHEMA-PGMA composite particles (253 Degree-Sign C) was much lower than that of unmodified magnesium hydroxide particles (337 Degree-Sign C).
Aerdts, A.M.; Groeninckx, G.; Zirkzee, H.F.; Aert, van H.A.M.; Geurts, J.M.
1997-01-01
Functional core—shell impact modifiers of glycidyl methacrylate (GMA) functionalized methyl methacrylate—butadiene—styrene (MBS) have been prepared via a seeded semi-continuous emulsion polymerization. These functional MBS—GMA particles were blended with polyamide-6. Investigations by transmission
Contact allergy to epoxy (meth)acrylates.
Aalto-Korte, Kristiina; Jungewelter, Soile; Henriks-Eckerman, Maj-Len; Kuuliala, Outi; Jolanki, Riitta
2009-07-01
Contact allergy to epoxy (meth)acrylates, 2,2-bis[4-(2-hydroxy-3-methacryloxypropoxy) phenyl]propane (bis-GMA), 2,2-bis[4-(2-hydroxy-3-acryloxypropoxy)phenyl]-propane (bis-GA), 2,2-bis[4-(methacryl-oxyethoxy)phenyl] propane (bis-EMA), 2,2-bis[4-(methacryloxy)phenyl]-propane (bis-MA), and glycidyl methacrylate (GMA) is often manifested together with contact allergy to diglycidyl ether of bisphenol A (DGEBA) epoxy resin. To analyse patterns of concomitant allergic reactions to the five epoxy (meth)acrylates in relation to exposure. We reviewed the 1994-2008 patch test files at the Finnish Institute of Occupational Health (FIOH) for reactions to the five epoxy (meth)acrylates, and examined the patients' medical records for exposure. Twenty-four patients had an allergic reaction to at least one of the studied epoxy (meth)acrylates, but specific exposure was found only in five patients: two bis-GMA allergies from dental products, two bis-GA allergies from UV-curable printing inks, and one bis-GA allergy from an anaerobic glue. Only 25% of the patients were negative to DGEBA epoxy resin. The great majority of allergic patch test reactions to bis-GMA, bis-GA, GMA and bis-EMA were not associated with specific exposure, and cross-allergy to DGEBA epoxy resin remained a probable explanation. However, independent reactions to bis-GA indicated specific exposure. Anaerobic sealants may induce sensitization not only to aliphatic (meth)acrylates but also to aromatic bis-GA.
Novel fluorescent poly(glycidyl methacrylate) - silica microspheres
Czech Academy of Sciences Publication Activity Database
Grama, Silvia; Boiko, N.; Bilyy, R.; Klyuchivska, O.; Antonyuk, V.; Stoika, R.; Horák, Daniel
2014-01-01
Roč. 56, July (2014), s. 92-104 ISSN 0014-3057 R&D Projects: GA MŠk EE2.3.30.0029; GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:61389013 Keywords : microspheres * silica * poly(glycidyl methacrylate) Subject RIV: CE - Biochemistry Impact factor: 3.005, year: 2014
Directory of Open Access Journals (Sweden)
Kaimeng Xu
2016-01-01
Full Text Available Rubber seed shell (RSS was modified by grafting treatment using glycidyl methacrylate (GMA at various concentrations. The RSS was then used to reinforce high-density polyethylene (HDPE. The effects of modification on the mechanical, water absorption, and thermal properties of the RSS/HDPE composites were studied using a mechanical testing instrument, weighing method, Vicat softening temperature (VST testing, thermogravimetry, and dynamic mechanical analysis. The results showed that the GMA grafting produced an improvement in the flexural and tensile properties of the composites. The water absorption rate of the composites also had an obvious decrease. While a slight increase in VST was found, the various concentrations of GMA showed no improvement in VST. GMA modification also could elevate the thermal stability of the composites at the initial decomposition stage. The optimum grafting concentration of GMA (2.5% led to the lowest thermal weight loss (37.07% and 26.56% during the first and second decomposition stages. The E’ values of the composites had a significant increase with the addition of GMA. There were two peaks of tan δ for the untreated samples, but the modified samples exhibited a shift in the transition peak at higher temperatures; moreover, the second peak disappeared.
Poly(glycidyl methacrylate-co-ethylene glycol dimethacrylate)/clay composites
International Nuclear Information System (INIS)
Marinovic, S.; Vukovic, Z.; Nastasovic, A.; Milutinovic-Nikolic, A.; Jovanovic, D.
2011-01-01
Highlights: → We synthesized macroporous composites of poly(GMA-co-EGDMA) and either raw or acid modified clay. → Morphological, textural and thermal properties of the composite with acid modified clay were significantly changed with retained macroporosity. → Composite with raw clay has enhanced thermal stability. - Abstract: In this study, macroporous composites of poly(glycidyl methacrylate-co-ethylene glycol dimethacrylate) i.e. poly(GMA-co-EGDMA) and clay were prepared by radical suspension copolymerization. The composites with either raw (S 0 ) or acid-modified clay (S A ) were characterized by Fourier transform infrared spectroscopy (FTIR), scanning electron microscopy (SEM), and thermogravimetric (TG) and textural analysis. The morphological, textural and thermal properties of the composite with raw clay (CP-S 0 ) differed slightly from those of the copolymer (CP), with exception of the thermal stability expressed in the shifting of the initial degradation temperature from 125 deg. C for CP to 210 deg. C for CP-S 0 . On the other hand, composite with modified clay (CP-S A ) was a material with significantly changed morphology, porous structure parameters and a qualitatively different thermal behavior in comparison to CP and CP-S 0 . CP-S A had mass residue, after heating at 600 deg. C, three times higher than the amount of S A introduced into the reaction system. This indicates a different manner of incorporation of S A , compared to S 0 , into the composite. Both the obtained composites retained their macroporosity and might be used in all applications that involve macroporous copolymers and, due to the altered thermal properties, their application may be extended.
Magnetic poly(glycidyl methacrylate) microspheres for protein capture
Czech Academy of Sciences Publication Activity Database
Koubková, Jana; Müller, P.; Hlídková, Helena; Plichta, Zdeněk; Proks, Vladimír; Vojtěšek, B.; Horák, Daniel
2014-01-01
Roč. 31, č. 5 (2014), s. 482-491 ISSN 1871-6784 R&D Projects: GA ČR GCP207/12/J013; GA MŠk 7E12053 EU Projects: European Commission(XE) 246513 - NADINE Institutional support: RVO:61389013 Keywords : glycidyl methacrylate * microspheres * protein p53 Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.898, year: 2014
Textural properties of poly(glycidyl methacrylate) : acid-modified bentonite nanocomposites
Zunic, M.; Milutinovic-Nikolic, A.; Nastasovic, A.; Vukovic, Z.; Loncarevic, D.; Vukovic, I.; Loos, K.; ten Brinke, G.; Jovanovic, D.; Sharma, Bhaskar; Ubaghs, Luc; Keul, Helmut; Höcker, Hartwig; Loontjens, Ton; Benthem, Rolf van; Žunić, M.; Milutinović-Nikolić, A.; Nastasović, A.; Vuković, Z.; Lončarević, D.; Vuković, I.; Jovanović, D.
The aim of this study was to obtain enhanced textural properties of macroporous crosslinked copolymer poly(glycidyl methacrylate-co-ethylene glycol dimethacrylate) by synthesizing nanocomposites with acid-modified bentonite. Nanocomposites were obtained by introducing various amounts of
Mohammed Safiullah, S.; Abdul Wasi, K.; Anver Basha, K.
2015-12-01
Poly(glycidyl methacrylate) core/copper nanoparticle shell nanocomposite (PGMA/Cu nanohybrid) was prepared by simple two step method (i) The synthesis of poly(glycidyl methacrylate) (PGMA) beads by free radical suspension polymerization followed by (ii) direct deposition of copper nanoparticles (CuNPs) on activated PGMA beads. The PGMA beads were used as a soft template to host the CuNPs without surface modification of it. In this method the CuNPs were formed by chemical reduction of copper salts using sodium borohydride in water medium and deposited directly on the activated PGMA. Two different concentrations of copper salts were employed to know the effect of concentration on the shape and size of nanoparticles. The results showed that, the different sizes and shapes of CuNPs were deposited on the PGMA matrix. The X-ray Diffraction study results showed that the CuNPs were embedded on the surface of the PGMA matrix. The scanning electron microscopic images revealed that the fabrication of CuNPs on the PGMA matrix possess different shapes and changes the morphology and nature of PGMA beads significantly. The fluorescent micrograph also confirmed that the CuNPs were doped on the PGMA surface. The thermal studies have demonstrated that the CuNPs deposition on the surface of PGMA beads had a significant effect.
Energy Technology Data Exchange (ETDEWEB)
Baratéla, Fernando José Costa; Zazuco Higa, Olga [Biotechnology Center, Institute of Energy and Nuclear Research (IPEN), Av. Professor Lineu Prestes 2242, 05508-000 São Paulo, SP (Brazil); Duarte dos Passos, Esdras [PostGraduate Program in Materials for Engineering, Federal University of Itajubá (UNIFEI), Av. BPS 1303, 37500-903 Itajubá, MG (Brazil); Alencar de Queiroz, Alvaro Antonio, E-mail: alencar@unifei.edu.br [Physics and Chemistry Institute (IFQ), Federal University of Itajubá (UNIFEI), Av. BPS 1303, 37500-903 Itajubá, MG (Brazil); High Voltage Laboratory (LAT-EFEI), Federal University of Itajubá (UNIFEI), Av. BPS 1303, 37500-903 Itajubá, MG (Brazil)
2017-04-01
Electrospinning is a suitable method to produce scaffolds composed of nanoscale to microscale fibers, which are comparable to the extracellular matrix (ECM). Hyperbranched polyglycerol (HPGL) is a highly biocompatible polyether polyol potentially useful for the design of fibrous scaffolds mimicking the ECM architecture. However, scaffolds developed from HPGL have poor mechanical properties and morphological stability in the aqueous environments required for tissue engineering applications. This work reports the production of stable electrospun HPGL scaffolds (EHPGLS) using glycidyl methacrylate (GMA) as cross-linker to enhance the water stability and mechanical property of electrospun HPGL. The diameter and morphology of the produced EHPGLS were analyzed by scanning electron microscopy (SEM). It was observed that electrical fields in the range of 0.2 kV·cm{sup −1} to 1.0 kV·cm{sup −1} decrease the average fiber diameter of EHPGLS. The increase in porosity of EHPGLS with GMA concentration indicates the in situ formation of a heterogeneous structure resultant from the phase separation during crosslinking of HPGL by GMA. EHPGLS containing 20% (w/w) GMA concentration possessed highest tensile strength (295.4 ± 11.32 kPa), which is approximately 58 times higher than that of non-crosslinked EHPGLS (5.1 ± 2.12 kPa). The MTS cell viability results showed that the EHPGLS have no significant cytotoxicity effect on Chinese hamster ovary (CHO-K1) cells. Scanning electron microscopy (SEM) indicates that the cultured BALB/3T3 fibroblasts cells were able to keep contact each other's, thus forming a homogeneous monolayer on the internal surface of the EHPGLS. - Highlights: • A hyperbranched polyglycerol (HPGL) scaffold with elastic modulus of 295.4 ± 11.32 kPa was developed for soft tissue repair. • HPGL scaffold was prepared by electrospinning method. • The porosity of HPGL scaffolds can be tuned by selecting the degree of GMA in HPGL. • Electrospun HPGL
International Nuclear Information System (INIS)
Bondar, Yu.V.; Kim, H.J.; Lim, Y.J.
2006-01-01
The design and development of sorption-active natural and synthetic polymer fibers and textile materials is of great scientific and practical interest. The advantages of that type of polymeric adsorbents, as their highly developed specific surface, excellent ion-exchange and adsorption parameters and ease of their use especially under continuous conditions, allow them to find a great application in the chemical, biomedical, ecological and industrial fields. To obtain functional polymer materials with the desired performance, the non-active polymer surface have to be modified. Among different innovative techniques used for the introduction of graft chains, the radiation-chemical method of initiation has some economical and ecological preferences over others. It allows to introduce into inert polymeric matrix chains of a monomer already containing a desirable functional group, or to graft chains of a precursor-monomer and subsequently its chemical modification to form required functional groups. At present an epoxy-group containing monomer, glycidyl methacrylate (GMA), is successfully used as a precursor-monomer for production of polymeric adsorbents of variety applications on the base of membranes, films, fibers and fabrics. Two types of sorption-active polypropylene fiber carrying strong-acid sulfonate groups and amino groups have been synthesized by radiation-induced graft polymerization of GMA, with subsequent chemical modification of the epoxy groups of poly-GMA graft chains. The effect of various polymerization parameters on the GMA grafting degree was investigated in detail. The epoxy ring-opening of poly-GMA graft chains with introduction of strong-acid sulfonate groups was carried out with sodium hydrogen sulfite in water-dimethylformamide solution at 70 deg C. The main peculiarities of the sulfonation reaction in depending on the reaction time and GMA grafting degree have been investigated. Amine groups were incorporated by treatment of the GMA
Energy Technology Data Exchange (ETDEWEB)
Nava-Ortiz, C.A.B. [Departamento de Quimica de Radiaciones y Radioquimica, Instituto de Ciencias Nucleares, Universidad Nacional Autonoma de Mexico, Circuito Exterior, Ciudad Universitaria, Mexico DF 04510 (Mexico); Burillo, G. [Departamento de Quimica de Radiaciones y Radioquimica, Instituto de Ciencias Nucleares, Universidad Nacional Autonoma de Mexico, Circuito Exterior, Ciudad Universitaria, Mexico DF 04510 (Mexico)], E-mail: burillo@nucleares.unam.mx; Bucio, E. [Departamento de Quimica de Radiaciones y Radioquimica, Instituto de Ciencias Nucleares, Universidad Nacional Autonoma de Mexico, Circuito Exterior, Ciudad Universitaria, Mexico DF 04510 (Mexico); Alvarez-Lorenzo, C. [Departamento de Farmacia y Tecnologia Farmaceutica, Facultad de Farmacia, Universidad de Santiago de Compostela, 15782 Santiago de Compostela (Spain)
2009-01-15
Glycidyl methacrylate was grafted onto polyethylene films using a preirradiation method with {gamma} rays. The effect of absorbed dose, monomer concentration, and reaction time on the degree of grafting was determined. The grafted samples were verified by FTIR-ATR spectroscopy. {beta}-Cyclodextrin was immobilized onto polypropylene modified with glycidyl methacrylate, and the ability of the cavities of {beta}-cyclodextrin to form inclusion complexes was demonstrated using the typically organic compound approach with m-toluic acid (3-MBA) as a probe.
Czech Academy of Sciences Publication Activity Database
Grama, Silvia; Plichta, Zdeněk; Trchová, Miroslava; Kovářová, Jana; Beneš, Milan J.; Horák, Daniel
2014-01-01
Roč. 77, April (2014), s. 11-17 ISSN 1381-5148 R&D Projects: GA MŠk EE2.3.30.0029 Institutional support: RVO:61389013 Keywords : multistep swelling polymerization * poly(glycidyl methacrylate) * poly(2,3-dihydroxypropyl methacrylate) Subject RIV: CE - Biochemistry Impact factor: 2.515, year: 2014
Iodinated glycidyl methacrylate copolymer as a radiopaque material for biomedical applications.
Dawlee, S; Jayabalan, M
2013-07-01
Polymeric biomaterial was synthesized by copolymerizing 50:50 mol% of monomers, glycidyl methacrylate and methyl methacrylate. Iodine atoms were then grafted to the epoxide groups of glycidyl methacrylate units, rendering the copolymer radiopaque. The percentage weight of iodine in the present copolymer was found to be as high as 23%. The iodinated copolymer showed higher glass transition temperature and thermal stability in comparison with unmodified polymer. Radiographic analysis showed that the copolymer possessed excellent radiopacity. The iodinated copolymer was cytocompatible to L929 mouse fibroblast cells. The in vivo toxicological evaluation by intracutaneous reactivity test of the copolymer extracts has revealed that the material was nontoxic. Subcutaneous implantation of iodinated copolymer in rats has shown that the material was well tolerated. Upon explantation and histological examination, no hemorrhage, infection or necrosis was observed. The samples were found to be surrounded by a vascularized capsule consisting of connective tissue cells. The results indicate that the iodinated copolymer is biocompatible and may have suitable applications as implantable materials.
International Nuclear Information System (INIS)
Nasef, Mohamed Mahmoud; Sithambaranathan, Paveswari; Ahmad, Arshad; Abouzari-lotf, Ebrahim
2017-01-01
A new ultrasound-aided method was used to enhance grafting of 4-vinylpyridine (4-VP) and glycidyl methacrylate (GMA) monomers mixtures onto electron beam (EB) irradiated poly(ethylene-co-tetrafluoroethylene) (ETFE) film for the first time. The effects of reaction parameters such as absorbed dose, monomer concentration, reaction time on both of degree of grafting (DG) and grafting efficiency (GE) were investigated under sonication and conventional grafting at similar temperatures. Fourier transform infrared (FTIR) and atomic force microscopy (AFM) were used to monitor the impact of the applied ultrasound on composition and surfaces of the grafted films whereas 1 H-NMR was used to investigate composition of the grafting residues. The ultrasound-aided grafting of 4-VP/GMA was found to enhance both of DG% and GE remarkably. Moreover, it produced grafted ETFE films having smoother surfaces without homopolymer contamination compared to grafted films obtained from conventional grafting. The results of this study suggest that the use of ultrasound is a promising way for intensifying grafting process and improving its economy. - Highlights: • Grafting of 4-VP/GMA onto ETFE films was carried out with the aid of ultrasound. • Degree of grafting was found to be strongly dependent on reaction parameters. • Sonication remarkably enhanced the reaction kinetics and grafting efficiency. • Grafted films with smoother surfaces without homopolymer contamination were obtained. • Ultrasound aided grafting is superior to conventional one and promotes intensification.
Czech Academy of Sciences Publication Activity Database
Hlídková, Helena; Horák, Daniel; Proks, Vladimír; Kučerová, Z.; Pekárek, Michal; Kučka, Jan
2013-01-01
Roč. 13, č. 4 (2013), s. 503-511 ISSN 1616-5187 R&D Projects: GA ČR GCP207/12/J013; GA ČR GAP206/12/0381; GA MŠk 7E12053 EU Projects: European Commission(XE) 246513 - NADINE Institutional support: RVO:61389013 Keywords : coatings * glycidyl methacrylate * 2-hydroxyethyl methacrylate Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.650, year: 2013
Poly(GMA/MA/MBAA) Copolymer Beads: a Highly Efficient Support Immobilizing Penicillin G Acylase
Institute of Scientific and Technical Information of China (English)
Ping XUE; Guan Zhong LU; Wan Yi LIU
2006-01-01
The hydrophilic, macroporous and beaded ternary copolymer of glycidyl methacrylate (GMA)/methacrylamide(MA)/N,N'-methylene-bis(acrylamide)(MBAA)was synthesized using the industrial agents by inverse suspension polymerization. The apparent activity of the immobilized penicillin G acylase reached 1096 IU/g for hydrolysis penicillin G on the beads with diameter of 0.11-0.13 mm, and it changed hardly after 50 cycles. It can be expected to be a good potential in industrial application.
Versatility of Alkyne-Modified Poly(Glycidyl Methacrylate) Layers for Click Reactions
International Nuclear Information System (INIS)
Soto-Cantu, Erick; Lokitz, Bradley S.; Hinestrosa Salazar, Juan Pablo; Deodhar, Chaitra; Messman, Jamie M.; Ankner, John Francis; Kilbey, S. Michael II
2011-01-01
Functional soft interfaces are of interest for a variety of technologies. We describe three methods for preparing substrates with alkyne groups, which show versatility for 'click' chemistry reactions. Two of the methods have the same root: formation of thin, covalently attached, reactive interfacial layers of poly(glycidyl methacrylate) (PGMA) via spin coating onto silicon wafers followed by reactive modification with either propargylamine or 5-hexynoic acid. The amine or the carboxylic acid moieties react with the epoxy groups of PGMA, creating interfacial polymer layers decorated with alkyne groups. The third method consists of using copolymers comprising glycidyl methacrylate and propargyl methacrylate (pGP). The pGP copolymers are spin coated and covalently attached on silicon wafers. For each method, we investigate the factors that control film thickness and content of alkyne groups using ellipsometry, and study the nanophase structure of the films using neutron reflectometry. Azide-terminated polymers of methacrylic acid and 2-vinyl-4,4-dimethylazlactone synthesized via reversible addition-fragmentation chain transfer polymerization were attached to the alkyne-modified substrates using 'click' chemistry, and grafting densities in the range of 0.007-0.95 chains nm -2 were attained. The maximum density of alkyne groups attained by functionalization of PGMA with propargylamine or 5-hexynoic acid was approximately 2 alkynes nm -3 . The alkyne content obtained by the three decorating approaches was sufficiently high that it was not the limiting factor for the click reaction of azide-capped polymers.
International Nuclear Information System (INIS)
Madrid, Jordan; Ueki, Yuji; Seko, Noriaki
2013-01-01
In the recent years, radiation-induced graft polymerization of various monomers onto different types of trunk polymers have been extensively used for researchers on adsorbents for cations, anions and different compounds, battery separators, antibacterial bandages, protein separators, and fuel cell applications. Some of these technologies were transferred to end-users and eventually commercialized. In most of these studies, a post-grafting reaction is performed to introduced chemical groups that impart functionality to the grafted material. In this paper, pre-irradiation technique was used for emulsion grafting of glycidyl methacrylate (GMA) onto an electron beam irradiated abaca-polyester nonwoven fabric (APNWF). The dependence of degree of grafting (Dg), calculated from the weight of APNWF before and after grafting, on irradiation dose, reaction time and monomer concentration were studies. After 50 kGy irradiation with 2 MeV electron beam and subsequent 3-hour reaction with an emulsion consisting of 5% GMA and 0.5% polyoxyethylene sorbitan monolaurate (Tween 20) surfactant in deionized water at 40 degree centegrade, a grafted APNWF with a Dg greater than 150% was obtained. The GMA grafted APNWF was further modified by reaction with ethylenediamine (EDA) in isopropyl alcohol at 60 degree centegrade to introduce amine functional groups. A 3-hour reaction with 50% EDA resulted to an amine group density of 2.7 mmole/gram-adsorbent. Preliminary batch adsorption experiments using Cu 2+ and Ni 2+ ions in aqueous solutions show that the adsorption capacity of the grafted adsorbent is four times greater for Cu 2+ ions compared to Ni 2+ ions. (author)
Czech Academy of Sciences Publication Activity Database
Feczkó, T.; Trif, L.; Németh, B.; Horák, Daniel
2016-01-01
Roč. 641, 10 October (2016), s. 24-28 ISSN 0040-6031 Institutional support: RVO:61389013 Keywords : porous poly(glycidyl methacrylate-ethylene dimethacrylate) beads * paraffin * cetyl alcohol Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.236, year: 2016
International Nuclear Information System (INIS)
Mohammed Safiullah, S.; Abdul Wasi, K.; Anver Basha, K.
2015-01-01
Graphical abstract: - Highlights: • PGMA/Cu nanohybrids have been synthesized by Surface deposition method. • The CuNPs were deposited on the PGMA surface without surface modification. • CuNP deposition on PGMA has a significant effect on morphology and thermal stability. - Abstract: Poly(glycidyl methacrylate) core/copper nanoparticle shell nanocomposite (PGMA/Cu nanohybrid) was prepared by simple two step method (i) The synthesis of poly(glycidyl methacrylate) (PGMA) beads by free radical suspension polymerization followed by (ii) direct deposition of copper nanoparticles (CuNPs) on activated PGMA beads. The PGMA beads were used as a soft template to host the CuNPs without surface modification of it. In this method the CuNPs were formed by chemical reduction of copper salts using sodium borohydride in water medium and deposited directly on the activated PGMA. Two different concentrations of copper salts were employed to know the effect of concentration on the shape and size of nanoparticles. The results showed that, the different sizes and shapes of CuNPs were deposited on the PGMA matrix. The X-ray Diffraction study results showed that the CuNPs were embedded on the surface of the PGMA matrix. The scanning electron microscopic images revealed that the fabrication of CuNPs on the PGMA matrix possess different shapes and changes the morphology and nature of PGMA beads significantly. The fluorescent micrograph also confirmed that the CuNPs were doped on the PGMA surface. The thermal studies have demonstrated that the CuNPs deposition on the surface of PGMA beads had a significant effect.
Energy Technology Data Exchange (ETDEWEB)
Mohammed Safiullah, S., E-mail: safichem@gmail.com [Department of Chemistry, C. Abdul Hakeem College of Engineering & Technology, Melvisharam, Vellore District, Tamil Nadu 632509 (India); P.G. & Research Department of Chemistry, C. Abdul Hakeem College, Melvisharam, Vellore District, Tamil Nadu 632509 (India); Abdul Wasi, K. [P.G. & Research Department of Chemistry, C. Abdul Hakeem College, Melvisharam, Vellore District, Tamil Nadu 632509 (India); Anver Basha, K., E-mail: kanverbasha@gmail.com [P.G. & Research Department of Chemistry, C. Abdul Hakeem College, Melvisharam, Vellore District, Tamil Nadu 632509 (India)
2015-12-01
Graphical abstract: - Highlights: • PGMA/Cu nanohybrids have been synthesized by Surface deposition method. • The CuNPs were deposited on the PGMA surface without surface modification. • CuNP deposition on PGMA has a significant effect on morphology and thermal stability. - Abstract: Poly(glycidyl methacrylate) core/copper nanoparticle shell nanocomposite (PGMA/Cu nanohybrid) was prepared by simple two step method (i) The synthesis of poly(glycidyl methacrylate) (PGMA) beads by free radical suspension polymerization followed by (ii) direct deposition of copper nanoparticles (CuNPs) on activated PGMA beads. The PGMA beads were used as a soft template to host the CuNPs without surface modification of it. In this method the CuNPs were formed by chemical reduction of copper salts using sodium borohydride in water medium and deposited directly on the activated PGMA. Two different concentrations of copper salts were employed to know the effect of concentration on the shape and size of nanoparticles. The results showed that, the different sizes and shapes of CuNPs were deposited on the PGMA matrix. The X-ray Diffraction study results showed that the CuNPs were embedded on the surface of the PGMA matrix. The scanning electron microscopic images revealed that the fabrication of CuNPs on the PGMA matrix possess different shapes and changes the morphology and nature of PGMA beads significantly. The fluorescent micrograph also confirmed that the CuNPs were doped on the PGMA surface. The thermal studies have demonstrated that the CuNPs deposition on the surface of PGMA beads had a significant effect.
Magnetic poly(glycidyl methacrylate) microspheres for Campylobacter jejuni detection in food
Czech Academy of Sciences Publication Activity Database
Horák, Daniel; Hochel, I.
061, - (2005), s. 1-12 ISSN 1618-7229 R&D Projects: GA ČR(CZ) GA525/05/0311; GA ČR(CZ) GA525/02/0287 Institutional research plan: CEZ:AV0Z40500505 Keywords : magnetic * microspheres * glycidyl methacrylate Subject RIV: GM - Food Processing Impact factor: 0.926, year: 2005 http://www.e-polymers.org
International Nuclear Information System (INIS)
Lokitz, Bradley S.; Wei, Jifeng; Hinestrosa Salazar, Juan P.; Ivanov, Ilia N.; Browning, James B.; Ankner, John Francis; Kilbey, S. Michael II; Messman, Jamie M.
2012-01-01
The assembly of dually reactive, well-defined diblock copolymers incorporating the chemoselective/functional monomer, 4,4-dimethyl-2-vinylazlactone (VDMA) and the surface-reactive monomer glycidyl methacrylate (GMA) is examined to understand how competition between surface attachment and microphase segregation influences interfacial structure. Reaction of the PGMA block with surface hydroxyl groups not only anchors the copolymer to the surface, but limits chain mobility, creating brush-like structures comprising PVDMA blocks, which contain reactive azlactone groups. The block copolymers are spin coated at various solution concentrations and annealed at elevated temperature to optimize film deposition to achieve a molecularly uniform layer. The thickness and structure of the polymer thin films are investigated by ellipsometry, infrared spectroscopy, and neutron reflectometry. The results show that deposition of PGMA-b-PVDMA provides a useful route to control film thickness while preserving azlactone groups that can be further modified with biotin-poly(ethylene glycol)amine to generate designer surfaces. The method described herein offers guidance for creating highly functional surfaces, films, or coatings through the use of dually reactive block copolymers and postpolymerization modification.
Energy Technology Data Exchange (ETDEWEB)
Tyagi, Charu; Tomar, Lomas [Centre for Biomedical Engineering, Indian Institute of Technology, Delhi 110016 (India); Singh, Harpal [Centre for Biomedical Engineering, Indian Institute of Technology, Delhi 110016 (India)], E-mail: tyagicharu11@rediffmail.com
2009-01-26
Glycidyl methacrylate and N-vinyl-2-pyrrolidone (GMA-co-NVP) copolymers with various GMA:NVP ratios were synthesized by solution polymerization technique in toluene using 2,2'-azobisisobutyronitrile (AIBN) as free radical initiator and dip coated onto polypropylene strips. The copolymer composition in polymeric coatings was confirmed by proton NMR spectroscopy. Various techniques like FTIR, SEM and contact angle were used for surface characterization of the polymer coatings. These polymer coated strips were evaluated and standardized for their application in dot-ELISA in two steps. In first step, specificity, sensitivity and reproducibility of the assay on developed polymer coated strips was evaluated through a model system using rabbit anti-goat IgG, goat anti-rabbit IgG and goat anti-rabbit IgG HRP (horseradish peroxidase)-conjugate. Polymer coating with GMA-NVP mol% ratio of 78:22 was able to detect rabbit anti-goat IgG antibody at a concentration as low as 2 ng mL{sup -1} with 1% BSA as blocking agent using antispecies IgG peroxidase conjugate diluted 1500 times. In the second step, the sensitivity and specificity of the developed system was established with human blood and finally used to identify the source of mosquito blood meal which is an important parameter in epidemiological studies, particularly in determining the role of mosquito in malaria transmission. The time duration of standardized assay with developed polymer coated strips was cut down to one hour compared to the 3-4 h required in usual dot-ELISA.
Czech Academy of Sciences Publication Activity Database
Zasońska, Beata Anna; Čadková, M.; Kovářová, A.; Bílková, Z.; Korecká, L.; Horák, Daniel
2015-01-01
Roč. 7, č. 44 (2015), s. 24926-24931 ISSN 1944-8244 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:61389013 Keywords : glycidyl methacrylate * nanospheres * thionine Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 7.145, year: 2015
Directory of Open Access Journals (Sweden)
Aprilia Nur Tasfiyati
2016-03-01
Full Text Available In this study, the organic polymer monolith was developed as a weak anion exchanger column in high performance liquid chromatography for DNA separation. Methacrylate-based monolithic column was prepared in microbore silicosteel column (100 × 0.5 mm i.d. by in-situ polymerization reaction using glycidyl methacrylate as monomer; ethylene dimethacrylate as crosslinker; 1-propanol, 1,4-butanediol, and water as porogenic solvents, with the presence of initiator α,α′-azobisisobutyronitrile (AIBN. The monolith matrix was modified with diethylamine to create weak anion exchanger via ring opening reaction of epoxy groups. The morphology of the monolithic column was studied by SEM. The properties of the monolithic column, such as permeability, mechanical stability, binding capacity and pore size distribution, were characterized in detail. From the results of the characterization, monoliths poly-(GMA-co-EDMA with total monomer percentage (%T 40 and crosslinker percentage (%C 25 was found to be the ideal composition of monomer and crosslinker. It has good mechanical stability and high permeability, adequate molecular recognition sites (represented with binding capacity value of 36 mg ml−1, and has relatively equal proportion of flow-through pore and mesopores (37.2% and 41.1% respectively. Poly-(GMA-co-EDMA with %T 40 and %C 25 can successfully separate oligo(dT12–18 and 50 bp DNA ladder with good resolution.
Czech Academy of Sciences Publication Activity Database
Hlídková, Helena; Kotelnikov, Ilya; Pop-Georgievski, Ognen; Proks, Vladimír; Horák, Daniel
2017-01-01
Roč. 50, č. 4 (2017), s. 1302-1311 ISSN 0024-9297 R&D Projects: GA ČR(CZ) GC16-01128J; GA ČR(CZ) GA16-02702S; GA ČR(CZ) GJ15-09368Y Grant - others:OPPK(XE) CZ.2.16/3.1.00/21545 Program:OPPK Institutional support: RVO:61389013 Keywords : poly(glycidyl methacrylate) * magnetic microspheres * peptides Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 5.835, year: 2016
Grafting of GMA and some comonomers onto chitosan for controlled release of diclofenac sodium.
Sharma, Rajeev Kr; Lalita; Singh, Anirudh P; Chauhan, Ghanshyam S
2014-03-01
In order to develop pH sensitive hydrogels for controlled drug release we have graft copolymerized glycidyl methacrylate (GMA) with comonomers acrylic acid, acrylamide and acrylonitrile, onto chitosan (Ch) by using potassium persulphate (KPS) as free radical initiator in aqueous solution. The optimum percent grafting for GMA was recorded for 1g chitosan at [KPS]=25.00 × 10(-3)mol/L, [GMA]=0.756 × 10(-3)mol/L, reaction temperature=60 °C and reaction time=1h in 20 mL H2O. Binary monomers were grafted for five different concentrations at optimum grafting conditions evaluated for GMA alone onto chitosan. The graft copolymers were characterized by FTIR, XRD, TGA and SEM. The swelling properties of chitosan and graft copolymers were investigated at different pH to define their end uses in sustained release of an anti-inflammatory drug, diclofenac sodium. Percent drug release w.r.t. drug loaded in polymeric sample was studied as function of time in buffer solutions of pH 2.0 and 7.4. In vitro release data was analyzed using Fick's Law. Chitosan grafted with binary monomers, GMA-co-AAm and GMA-co-AN showed very good results for sustained release of drug at 7.4 pH. Copyright © 2014 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Elena Vismara
2013-05-01
Full Text Available High-grade cellulose (97% α-cellulose content of 48% crystallinity index was extracted from the renewable marine biomass waste Posidonia oceanica using H2O2 and organic peracids following an environmentally friendly and chlorine-free process. This cellulose appeared as a new high-grade cellulose of waste origin quite similar to the high-grade cellulose extracted from more noble starting materials like wood and cotton linters. The benefits of α-cellulose recovery from P. oceanica were enhanced by its transformation into cellulose acetate CA and cellulose derivative GMA-C. Fully acetylated CA was prepared by conventional acetylation method and easily transformed into a transparent film. GMA-C with a molar substitution (MS of 0.72 was produced by quenching Fenton’s reagent (H2O2/FeSO4 generated cellulose radicals with GMA. GMA grafting endowed high-grade cellulose from Posidonia with adsorption capability. GMA-C removes β-naphthol from water with an efficiency of 47%, as measured by UV-Vis spectroscopy. After hydrolysis of the glycidyl group to glycerol group, the modified GMA-C was able to remove p-nitrophenol from water with an efficiency of 92%, as measured by UV-Vis spectroscopy. α-cellulose and GMA-Cs from Posidonia waste can be considered as new materials of potential industrial and environmental interest.
Czech Academy of Sciences Publication Activity Database
Belza, T.; Pavlínek, V.; Sáha, P.; Beneš, Milan J.; Horák, Daniel; Quadrat, Otakar
2007-01-01
Roč. 385, č. 1 (2007), s. 1-8 ISSN 0378-4371 R&D Projects: GA MŠk 2B06053 Institutional research plan: CEZ:AV0Z40500505 Keywords : Electrorheology * Suspension * Poly(glycidyl methacrylate-co-(ethylene dimethacrylate) Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.430, year: 2007
The Adsorption of Calmoduline via Nicotinamide Immobilized Poly(HEMA-GMA Cryogels
Directory of Open Access Journals (Sweden)
Kadir Erol
2016-12-01
Full Text Available The separation and purification methods for the isolation of an important biomolecule calmoduline protein is extremely important. Among these methods, the adsorption technique is extremely popular, and the cryogels as adsorbents with the macro porous structure and interconnected flow channels cryogel they have are preferred in this field. In this study, the adsorption of calmoduline via Ca(II immobilized poly (2-hydroxyethyl methacrylate-glycidyl methacrylate, poly (HEMA-GMA, cryogels through changing interaction time, calmoduline initial concentration and temperature conditions. For the characterization of cryogels, the swelling test, Fourier Transform Infrared (FT-IR Spectroscopy, Scanning Electron Microscopy (SEM, surface area (BET, elemental analysis and ICP-OES methods were performed. Nicotinamide molecule was used as Ca (II chelating agent and the adsorption capacity of the cryogels was estimated as 1.812 mg calmoduline / g cryogel. The adsorption models of the adsorption reaction were examined by the Langmuir and Freundlich isotherm models and was determined to be more appropriate for Langmuir isotherm model.
ANIONIC POLYMERIZATION OF ALKYL METHACRYLATES INITIATED BY nBuCu(NCy2)Li
Institute of Scientific and Technical Information of China (English)
Bing-yong Han; Jian-guo Liang; Jian-min Lu; Feng An; Wan-tai Yang
2009-01-01
Anionic polymerization of methyl methacrylate (MMA), n-butyl methacrylate (nBMA) and glycidyl methacrylate (GMA) initiated by nBuCu(NCy2)Li (1) in tetrahydrofuran (THF) at -50℃ to -10℃ was investigated. It was found that the polymerization of MMA and nBMA initiated by 1 proceeded quantitatively in THF to afford PMMA and PBMA with polydispersity index 1.15-1.30 and nearly 100% initiator efficiencies at -10℃. The molecular weights increased linearly with the ratio of [monomer]/[1]. However, a post-polymerization experiment carried out on this system revealed a double polymer peak by GPC when fresh monomer was added after an interval of 10 rain. Polymerization of styrene could be initiated by 1, but the initiator efficiency was low.
Czech Academy of Sciences Publication Activity Database
Horák, Daniel; Benedyk, N.
2004-01-01
Roč. 42, č. 22 (2004), s. 5827-5837 ISSN 0887-624X R&D Projects: GA ČR GA525/02/0287 Institutional research plan: CEZ:AV0Z4050913 Keywords : magnetic * glycidyl methacrylate * dispersion polymerization Subject RIV: CE - Biochemistry Impact factor: 2.773, year: 2004
Directory of Open Access Journals (Sweden)
Siti Zulaikha Mazlan
2017-01-01
Full Text Available Immobilization of laccase on the functionalized methacrylate-acrylate copolymer microspheres was studied. Poly(glycidyl methacrylate-co-n-butyl acrylate microspheres consisting of epoxy groups were synthesized using facile emulsion photocuring technique. The epoxy groups in poly(GMA-co-nBA microspheres were then converted to amino groups. Laccase immobilization is based on covalent binding via amino groups on the enzyme surface and aldehyde group on the microspheres. The FTIR spectra showed peak at 1646 cm−1 assigned to the conformation of the polymerization that referred to GMA and nBA monomers, respectively. After modification of the polymer, intensity of FTIR peaks assigned to the epoxy ring at 844 cm−1 and 904 cm−1 was decreased. The results obtained from FTIR exhibit a good agreement with the epoxy content method. The activity of laccase-immobilized microspheres increased upon increasing the epoxy content. Furthermore, poly(GMA-co-nBA microspheres revealed uniform size below 2 µm that contributes to large surface area of the microspheres to be used as a matrix, thus increasing the enzyme capacity and enzymatic reaction. Immobilized enzyme also shifted to higher pH and temperature compared to free enzyme.
International Nuclear Information System (INIS)
Qian, Xiaolei; Fan, Hua; Wang, Chaozhan; Wei, Yinmao
2013-01-01
Ion-exchange membrane is of importance for the development of membrane chromatography. In this work, a high-capacity anion-exchange membrane was prepared by grafting of glycidyl methacrylate (GMA) onto the surface of regenerated cellulose (RC) membranes via surface-initiated atom transfer radical polymerization (SI-ATRP) and subsequent derivatization with diethylamine. Attenuated total reflectance Fourier-transform infrared (ATR-FTIR), X-ray photoelectron spectroscopy (XPS) and scanning electron microscopy (SEM) were used to characterize changes in the chemical functionality, surface topography and pore morphology of the modified membranes. The static capacity of the prepared anion-exchange membrane was evaluated with bovine serum albumin (BSA) as a model protein. The results indicated that the anion-exchange membrane which could reach a maximum capacity of 96 mg/mL for static adsorption possesses a higher adsorption capacity, and the adsorption capacity increases with the polymerization time. The effect of pH and salt concentration confirmed that the adsorption of BSA followed ion-exchange mechanism. The established method would have potential application in the preparation of anion-exchange membrane.
Reversible adsorption of catalase onto Fe(3+) chelated poly(AAm-GMA)-IDA cryogels.
Aktaş Uygun, Deniz; Uygun, Murat; Akgöl, Sinan; Denizli, Adil
2015-05-01
In this presented study, poly(acrylamide-glycidyl methacrylate) [poly(AAm-GMA)] cryogels were synthesized by cryopolymerization technique at sub-zero temperature. Prepared cryogels were then functionalized with iminodiacetic acid (IDA) and chelated with Fe(3+) ions in order produce the metal chelate affinity matrix. Synthesized cryogels were characterized with FTIR, ESEM and EDX analysis, and it was found that the cryogel had sponge like structure with interconnected pores and their pore diameter was about 200 μm. Fe(3+) chelated poly(AAm-GMA)-IDA cryogels were used for the adsorption of catalase and optimum adsorption conditions were determined by varying the medium pH, initial catalase concentration, temperature and ionic strength. Maximum catalase adsorption onto Fe(3+) chelated poly(AAm-GMA)-IDA cryogel was found to be 12.99 mg/g cryogel at 25 °C, by using pH 5.0 acetate buffer. Adsorbed catalase was removed from the cryogel by using 1.0M of NaCl solution and desorption yield was found to be 96%. Additionally, reusability profile of the Fe(3+) chelated poly(AAm-GMA)-IDA cryogel was also investigated and it was found that, adsorption capacity of the cryogels didn't decrease significantly at the end of the 40 reuses. Catalase activity studies were also tested and it was demonstrated that desorbed catalase retained 70% of its initial activity. Copyright © 2015 Elsevier B.V. All rights reserved.
Poly(Poly(Ethylene Glycol Methyl Ether Methacrylate Grafted Chitosan for Dye Removal from Water
Directory of Open Access Journals (Sweden)
Bryan Tsai
2017-03-01
Full Text Available As the demand for textile products and synthetic dyes increases with the growing global population, textile dye wastewater is becoming one of the most significant water pollution contributors. Azo dyes represent 70% of dyes used worldwide, and are hence a significant contributor to textile waste. In this work, the removal of a reactive azo dye (Reactive Orange 16 from water by adsorption with chitosan grafted poly(poly(ethylene glycol methyl ether methacrylate (CTS-GMA-g-PPEGMA was investigated. The chitosan (CTS was first functionalized with glycidyl methacrylate and then grafted with poly(poly(ethylene glycol methyl ether methacrylate using a nitroxide-mediated polymerization grafting to approach. Equilibrium adsorption experiments were carried out at different initial dye concentrations and were successfully fitted to the Langmuir and Freundlich adsorption isotherm models. Adsorption isotherms showed maximum adsorption capacities of CTS-g-GMA-PPEGMA and chitosan of 200 mg/g and 150 mg/g, respectively, while the Langmuir equations estimated 232 mg/g and 194 mg/g, respectively. The fundamental assumptions underlying the Langmuir model may not be applicable for azo dye adsorption, which could explain the difference. The Freundlich isotherm parameters, n and K, were determined to be 2.18 and 17.7 for CTS-g-GMA-PPEGMA and 0.14 and 2.11 for chitosan, respectively. An “n” value between one and ten generally indicates favorable adsorption. The adsorption capacities of a chitosan-PPEGMA 50/50 physical mixture and pure PPEGMA were also investigated, and both exhibited significantly lower adsorption capacities than pure chitosan. In this work, CTS-g-GMA-PPEGMA proved to be more effective than its parent chitosan, with a 33% increase in adsorption capacity.
Institute of Scientific and Technical Information of China (English)
无
2001-01-01
A new approach for the separation of antithrombin III with high performance affinity chromatography (HPAC) was described. A novel monodisperse,non-porous,cross-linked poly (glycidyl methacrylate) beads (PGMA) were used as the affinity support. With the water-soluble carbodiimide,heparin was linked covalently to amino-PGMA-beads,which was prepared by amination of PGMA. The adsorbent obtained exhibits high binding activity to antithrombin III (ATIII),good resolution and excellent mechanical properties and can be used under high flow rate.
Directory of Open Access Journals (Sweden)
Siti Zulaikha Mazlan
2014-01-01
Full Text Available Magnetic copolymer based on poly(glycidyl methacrylate-co-N-isopropylacrylamide microspheres was prepared by 2,2-dimethoxy-2-phenylacetophenone- (DMPP- photo initiated and poly(vinyl alcohol- (PVA- stabilized single step suspension photopolymerization. The effect of chemical interaction, morphology, and thermal properties by adding 0.1% w/v Fe3O4 in the copolymer was investigated. Infrared analysis (FTIR showed that (C=C band disappeared after copolymerization, indicating that the magnetic copolymer microspheres were successfully synthesized and two important bands at 908 cm−1 and 1550 cm−1 appear. These are associated with the epoxy group stretching of GMA and secondary amide (N–H/C–H deformation vibration of NIPAAm in magnetic microspheres. The X-ray diffraction (XRD result proved the incorporation of Fe3O4 nanoparticles with copolymer microspheres as peak of Fe3O4 was observed. Morphology study revealed that magnetic copolymer exhibited uniform spheres and smoother appearance when entrapped with Fe3O4 nanoparticles. The lowest percentage of Fe3O4 nanoparticles leached from the copolymer microspheres was obtained at pH 7. Finally, thermal property of the copolymer microspheres was improved by adding a small amount of Fe3O4 nanoparticles that has been shown from the thermogram.
Czech Academy of Sciences Publication Activity Database
Macková, Hana; Oukacine, F.; Plichta, Zdeněk; Hrubý, Martin; Kučka, Jan; Taverna, M.; Horák, Daniel
2014-01-01
Roč. 421, 1 May (2014), s. 146-153 ISSN 0021-9797 R&D Projects: GA MŠk 7E12053; GA ČR GAP503/10/0664 EU Projects: European Commission(XE) 246513 - NADINE Institutional support: RVO:61389013 Keywords : glycidyl methacrylate * microspheres * silver Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.368, year: 2014
Xue, Ping; Su, Weiguang; Gu, Yaohua; Liu, Haifeng; Wang, Julan
2015-03-01
Magnetic hydrophilic polymeric microspheres containing oxirane groups were prepared by inverse suspension polymerization of glycidyl methacrylate (GMA), N, N‧-methylene bisacrylamide (MBAA) and N-vinyl pyrrolidone (NVP) in the existence of formamide, which were denoted as magnetic poly(GMA-MBAA-NVP) microspheres. The magnetic poly(GMA-MBAA-NVP) microspheres were characterized by scanning electron microscopy (SEM), FT-IR spectroscopy, X-ray diffraction (XRD), vibrating sample magnetometer (VSM) and so on. The results showed that poly(GMA-MBAA-NVP) microspheres possessed well spherical shape, narrow size distribution, abundant porous structure, reactive oxirane groups and superparamagnetic properties. Formamide used in the present work served as a modifier, a dispersant and a porogen to form final porous polymer microspheres. The penicillin G acylase (PGA) was covalently immobilized onto the magnetic microspheres through the reaction between the amino groups of enzyme and the oxirane groups on the microspheres for producing 6-aminopenicillanic acid (6-APA). The effects of GMA/NVP ratio and crosslink density on the activity of immobilized PGA were investigated. The highest apparent activity, enzyme loading and coupling yield of immobilized PGA were 821 IU/g, 65.3 mg/g and 42.3% respectively when the mass ratio of GMA/NVP was 1:1 and crosslink density was 60%. Compared with the free PGA, immobilized PGA showed a wider range of pH value and reaction temperature. The relative activity and reaction rate of immobilized PGA remained almost constant after 20 recycles. The magnetic poly(GMA-MBAA-NVP) microspheres would be very promising carriers for immobilizing enzymes in industrial application.
In vitro blood and fibroblast responses to BisGMA-TEGDMA/bioactive glass composite implants.
Abdulmajeed, Aous A; Kokkari, Anne K; Käpylä, Jarmo; Massera, Jonathan; Hupa, Leena; Vallittu, Pekka K; Närhi, Timo O
2014-01-01
This in vitro study was designed to evaluate both blood and human gingival fibroblast responses to bisphenol A-glycidyl methacrylate-triethyleneglycol dimethacrylate (BisGMA-TEGDMA)/bioactive glass (BAG) composite, aimed to be used as composite implant abutment surface modifier. Three different types of substrates were investigated: (a) plain polymer (BisGMA 50 wt%-TEGDMA 50 wt%), (b) BAG-composite (50 wt% polymer + 50 wt% fraction of BAG-particles, <50 μm), and (c) plain BAG plates (100 wt% BAG). The blood response, including the blood-clotting ability and platelet adhesion morphology were evaluated. Human gingival fibroblasts were plated and cultured on the experimental substrates for up to 10 days, then the cell proliferation rate was assessed using AlamarBlue assay™. The BAG-composite and plain BAG substrates had a shorter clotting time than plain polymer substrates. Platelet activation and aggregation were most extensive, qualitatively, on BAG-composite. Analysis of the normalized cell proliferation rate on the different surfaces showed some variations throughout the experiment, however, by day 10 the BAG-composite substrate showed the highest (P < 0.001) cell proliferation rate. In conclusion, the presence of exposed BAG-particles enhances fibroblast and blood responses on composite surfaces in vitro.
Czech Academy of Sciences Publication Activity Database
Tocchio, A.; Horák, Daniel; Babič, Michal; Trchová, Miroslava; Veverka, Miroslav; Beneš, Milan J.; Šlouf, Miroslav; Fojtík, A.
2009-01-01
Roč. 47, č. 19 (2009), s. 4982-4994 ISSN 0887-624X R&D Projects: GA AV ČR(CZ) KAN401220801; GA ČR GA203/09/1242; GA ČR GA203/09/0857 Institutional research plan: CEZ:AV0Z40500505; CEZ:AV0Z10100521 Keywords : coatings * core - shell polymers * glycidyl methacrylate Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.971, year: 2009
Gao, Baojiao; Lei, Haibo; Jiang, Liding; Zhu, Yong
2007-06-15
Crosslinking copolymer microbeads with a diameter range of 100-150 microm were synthesized by suspension copolymerization of glycidyl methacrylate (GMA), acrylamide (AM) and N,N'-methylene bisacrylamide (MBA). Subsequently, polyethyleneimine (PEI) was grafted on the surfaces of the terpolymer microbeads GMA/AM/MBA via the ring-opening reaction of the epoxy groups, and the grafting microbeads PEI-GMA/AM/MBA were prepared. In this paper, the adsorption property of the grafting microbeads for bilirubin was mainly investigated, and the effects of various factors, such as pH value, ionic strength and grafting degree of PEI on the surface of grafting microbeads and the adsorption capacity of the grafting microbeads for bilirubin were examined. The batch adsorption experiment results show that by right of the action of grafted polyamine macromolecules PEI, the grafting microbeads PEI-GMA/AM/MBA have quite strong adsorption ability for bilirubin; the isotherm adsorption conforms to Freundlich equation. The pH value of the medium affects the adsorption capacity greatly, As in the nearly neutral solutions with pH 6, the grafting microbeads have the strongest adsorption ability for bilirubin, whereas in acidic and basic solutions their adsorption ability is weak. The ionic strength hardly affects the adsorption ability of the grafting microbeads. The grafting degree of PEI on the surfaces of the grafting microbeads also has a great effect on the adsorption capacity, and higher the grafting degree of PEI on the surface of the microbead PEI-GMA/AM/MBA, the stronger is the adsorption ability of the microbeads.
Czech Academy of Sciences Publication Activity Database
Kuan, W.-C.; Horák, Daniel; Plichta, Zdeněk; Lee, W.-C.
2014-01-01
Roč. 34, 1 January (2014), s. 193-200 ISSN 0928-4931 R&D Projects: GA ČR GCP207/12/J013 Institutional support: RVO:61389013 Keywords : magnetic * poly(glycidyl methacrylate) * microspheres Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.088, year: 2014
Energy Technology Data Exchange (ETDEWEB)
Grasselli, M [Buenos Aires Univ. (Argentina). Facultad de Farmacia y Bioquimica; Yoshii, Fumio [Japan Atomic Energy Research Inst., Takasaki, Gunma (Japan). Takasaki Radiation Chemistry Research Establishment
1999-07-01
Glycidyl methacrylate (GMA) and N,N-dimethylacrylamide (DMAA) have been co-grafted on hollow fiber membranes of macroporous polyethylene. Grafted copolymers have been obtained with different ratios of the monomers (molar ratio between 0 and 2 DMAA/GMA). The properties of the modified membranes are studied.
International Nuclear Information System (INIS)
Grasselli, M.; Yoshii, Fumio
1999-01-01
Glycidyl methacrylate (GMA) and N,N-dimethylacrylamide (DMAA) have been co-grafted on hollow fiber membranes of macroporous polyethylene. Grafted copolymers have been obtained with different ratios of the monomers (molar ratio between 0 and 2 DMAA/GMA). The properties of the modified membranes are studied
Energy Technology Data Exchange (ETDEWEB)
Xue, Ping; Su, Weiguang, E-mail: weiguangsu@nxu.edu.cn; Gu, Yaohua; Liu, Haifeng; Wang, Julan
2015-03-15
Magnetic hydrophilic polymeric microspheres containing oxirane groups were prepared by inverse suspension polymerization of glycidyl methacrylate (GMA), N, N′-methylene bisacrylamide (MBAA) and N-vinyl pyrrolidone (NVP) in the existence of formamide, which were denoted as magnetic poly(GMA-MBAA-NVP) microspheres. The magnetic poly(GMA-MBAA-NVP) microspheres were characterized by scanning electron microscopy (SEM), FT-IR spectroscopy, X-ray diffraction (XRD), vibrating sample magnetometer (VSM) and so on. The results showed that poly(GMA-MBAA-NVP) microspheres possessed well spherical shape, narrow size distribution, abundant porous structure, reactive oxirane groups and superparamagnetic properties. Formamide used in the present work served as a modifier, a dispersant and a porogen to form final porous polymer microspheres. The penicillin G acylase (PGA) was covalently immobilized onto the magnetic microspheres through the reaction between the amino groups of enzyme and the oxirane groups on the microspheres for producing 6-aminopenicillanic acid (6-APA). The effects of GMA/NVP ratio and crosslink density on the activity of immobilized PGA were investigated. The highest apparent activity, enzyme loading and coupling yield of immobilized PGA were 821 IU/g, 65.3 mg/g and 42.3% respectively when the mass ratio of GMA/NVP was 1:1 and crosslink density was 60%. Compared with the free PGA, immobilized PGA showed a wider range of pH value and reaction temperature. The relative activity and reaction rate of immobilized PGA remained almost constant after 20 recycles. The magnetic poly(GMA-MBAA-NVP) microspheres would be very promising carriers for immobilizing enzymes in industrial application. - Highlights: • The magnetic poly(GMA-MBAA-NVP) microspheres were successfully synthesized. • Formamide served as a modifier, a dispersant and a porogen to form microspheres. • The magnetic microspheres were highly efficient carriers for immobilizing PGA. • Immobilized PGA
Controlled protein adsorption on PMOXA/PAA based coatings by thermally induced immobilization
Mumtaz, Fatima; Chen, Chaoshi; Zhu, Haikun; Pan, Chao; Wang, Yanmei
2018-05-01
In this work, poly(2-methyl-2-oxazoline-random-glycidyl methacrylate) (PMOXA-r-GMA) and poly(acrylic acid)-block-poly(glycidyl methacrylate) (PAA-b-PGMA) copolymers were synthesized via cationic ring-opening polymerization (CROP) of 2-methyl-2-oxazoline (MOXA) and reversible addition-fragmentation chain transfer (RAFT) polymerization of acrylic acid (AA) followed by their random and block copolymerization with glycidyl methacrylate (GMA), respectively, and then characterized carefully. PMOXA/PAA based coatings were then prepared by simply spin coating the mixture of PMOXA-r-GMA and PAA-b-PGMA copolymer solutions onto silicon/glass substrates followed by annealing at 110 °C. The coatings were rigorously characterized by using X-ray photoelectron spectroscopy (XPS), the static water contact angle (WCA) test, ellipsometry and atomic force microscopy (AFM). The results demonstrated that the coating based mixed PMOXA/PAA brushes with desired surface composition could be attained by simply maintaining their percentage in the mixture of PMOXA-r-GMA and PAA-b-PGMA copolymer solutions. Finally, the switchable behavior of PMOXA/PAA based coatings toward bovine serum albumin (BSA) adsorption was investigated by fluorescein isothiocyanate-labelled BSA (FITC-BSA) assay and quartz crystal microbalance with dissipation monitoring (QCM-D), which indicated that the coating based mixed PMOXA/PAA brushes could control BSA adsorption/desorption from very low to high amount (>90% desorption) through adjusting the composition of PMOXA-r-GMA and PAA-b-PGMA solution used in preparing PMOXA/PAA based coatings upon pH and ionic strength change. Furthermore, PMOXA/PAA based coatings displayed efficient repeatability of reversible BSA adsorption/desorption cycles.
Synthesis and Properties of Reactive Interfacial Agents for Polycaprolactone-Starch Blends
Sugih, Asaf K.; Drijfhout, Jan. P.; Picchioni, Francesco; Janssen, Leon P. B. M.; Heeres, Hero J.
2009-01-01
The synthesis of two reactive interfacial agents for starch-polycaprolactone (PCL) blends, PCL-g-glycidyl methacrylate (PCL-g-GMA) and PCL-g-diethyl maleate (PCL-g-DEM) is described. The compounds were prepared by reacting a low molecular weight PCL. (M(w) 3000) with GMA or DEM in the presence of
Synthesis of acrylic prepolymer
International Nuclear Information System (INIS)
Hussin bin Mohd Nor; Dahlan bin Haji Mohd; Mohamad Hilmi bin Mahmood.
1988-04-01
An acrylic prepolymer was synthesized from glycidyl methacrylate (GMA), butyl methacrylate (BMA), methyl methacrylate (MMA) and acrylic acid (AA). Butyl acetate (BAc), benzoyl peroxide (BzO), 4-methoxyphenol (MPh) and triethylamine (TEA) were used as solvent, initiator, inhibitor and catalyst respectively. Observations of the synthesis leading to the formation of acrylic prepolymer are described. (author)
Energy Technology Data Exchange (ETDEWEB)
Bach, Long Giang; Islam, Md. Rafiqul [Department of Imaging System Engineering, Pukyong National University, Busan 608-737 (Korea, Republic of); Lee, Doh Chang [Department of Chemical and Biomolecular Engineering, KAIST Institute for the Nanocentury (KINC), Korea Advanced Institute of Science and Technology (KAIST), Daejeon 305-701 (Korea, Republic of); Lim, Kwon Taek, E-mail: ktlim@pknu.ac.kr [Department of Imaging System Engineering, Pukyong National University, Busan 608-737 (Korea, Republic of)
2013-10-15
A novel approach for the synthesis of poly(glycidyl methacrylate) grafted CdSe quantum dot (QDs) (PGMA-g-CdSe) was developed. The PGMA-g-CdSe nanohybrids were synthesized by the surface-initiated atom transfer radical polymerization of glycidyl methacrylate from the surface of the strategic initiator, CdSe-BrIB QDs prepared by the interaction of 2-bromoisobutyryl bromide (BrIB) and CdSe-OH QDs. The structure, morphology, and optical property of the PGMA-g-CdSe nanohybrids were analyzed by FT-IR, XPS, TGA, XRD, TEM, and PL. The as-synthesized PGMA-g-CdSe nanohybrids having multi-epoxide groups were employed for the direct coupling of biotin via ring-opening reaction of the epoxide groups to afford the Biotin-f-PGMA-g-CdSe nanobioconjugate. The covalent immobilization of biotin onto PGMA-g-CdSe was confirmed by FT-IR, XPS, and EDX. Biocompatibility and imaging properties of the Biotin-f-PGMA-g-CdSe were investigated by MTT bioassay and PL analysis, respectively. The cell viability study suggested that the biocompatibility was significantly enhanced by the functionalization of CdSe QDs by biotin and PGMA.
International Nuclear Information System (INIS)
Bach, Long Giang; Islam, Md. Rafiqul; Lee, Doh Chang; Lim, Kwon Taek
2013-01-01
A novel approach for the synthesis of poly(glycidyl methacrylate) grafted CdSe quantum dot (QDs) (PGMA-g-CdSe) was developed. The PGMA-g-CdSe nanohybrids were synthesized by the surface-initiated atom transfer radical polymerization of glycidyl methacrylate from the surface of the strategic initiator, CdSe-BrIB QDs prepared by the interaction of 2-bromoisobutyryl bromide (BrIB) and CdSe-OH QDs. The structure, morphology, and optical property of the PGMA-g-CdSe nanohybrids were analyzed by FT-IR, XPS, TGA, XRD, TEM, and PL. The as-synthesized PGMA-g-CdSe nanohybrids having multi-epoxide groups were employed for the direct coupling of biotin via ring-opening reaction of the epoxide groups to afford the Biotin-f-PGMA-g-CdSe nanobioconjugate. The covalent immobilization of biotin onto PGMA-g-CdSe was confirmed by FT-IR, XPS, and EDX. Biocompatibility and imaging properties of the Biotin-f-PGMA-g-CdSe were investigated by MTT bioassay and PL analysis, respectively. The cell viability study suggested that the biocompatibility was significantly enhanced by the functionalization of CdSe QDs by biotin and PGMA.
New membranes obtained by grafted irradiated PVDF foils
International Nuclear Information System (INIS)
Mazzei, R.; García Bermúdez, G.; Camporotondi, D.E.; Arbeitman, C.
2012-01-01
The present work describes a new method to produce membranes of poly(Acrylic-acid-Xmonomer) using the grafting procedure. PVDF foils irradiated with Ar + beam with energies between 30 and 150 keV were employed as substratum. Different combinations of monomers in water solutions were used: acrylic acid (AAc); acrylic acid–glycidyl methacrylate (AAc–GMA); acrylic acid–styrene (AAc–S), acrylic acid-N-isopropyl acrylamide (AAc–NIPAAm) and acrylic acid-N-isopropyl acrylamide–glycidyl methacrylate (AAc-NIPAAm–GMA). A large percentage of grafting results for specific values of: ion fluence and energy, AAc and sulfuric acid concentration, and different substrata PVDF polymorphous (alpha or beta). At a particular time of the grafting process, the poly(AAc-Xmonomer) membranes detach from the substratum and continue their grafting in the solution. This method is useful to produce increased replicated membranes of the irradiated original surface.
International Nuclear Information System (INIS)
Barsbay, Murat; Güven, Olgun; Kodama, Yasko
2016-01-01
This study presents the functionalization of poly(glycidyl methacrylate) (PGMA) grafted cellulose filter paper by a model compound, ethylenediamine (EDA), through the epoxy groups of PGMA. Cellulose based copolymers were prepared via the radiation-induced and RAFT-mediated graft polymerization. The samples were characterized by ATR–FTIR spectroscopy, X-ray photoelectron spectroscopy (XPS), elemental analysis, contact angle measurements and scanning electron microscopy (SEM). An efficient modification density of around 1 mmol EDA/mg copolymer was attained within ca. 8 h, indicating that chemical composition of well-defined copolymers may further be tuned by appropriately selecting the reactive agents for use in many emerging fields. - Highlights: • Ethylenediamine (EDA) was immobilized to cellulose-g-PGMA copolymers. • FTIR, XPS, SEM, EA and CA measurements were used for characterization. • The useful qualities of the RAFT were combined with the versatility of PGMA.
Carrasco-Correa, Enrique Javier; Ramis-Ramos, Guillermo; Herrero-Martínez, José Manuel
2013-07-12
Epinephrine-bonded polymeric monoliths for capillary electrochromatography (CEC) were developed by nucleophilic substitution reaction of epoxide groups of poly(glycidyl-methacrylate-co-ethylenedimethacrylate) (poly(GMA-co-EDMA)) monoliths using epinephrine as nucleophilic reagent. The ring opening reaction under dynamic conditions was optimized. Successful chemical modification of the monolith surface was ascertained by in situ Raman spectroscopy characterization. In addition, the amount of epinephrine groups that was bound to the monolith surface was evaluated by oxidation of the catechol groups with Ce(IV), followed by spectrophotometric measurement of unreacted Ce(IV). About 9% of all theoretical epoxide groups of the parent monolith were bonded to epinephrine. The chromatographic behavior of the epinephrine-bonded monolith in CEC conditions was assessed with test mixtures of alkyl benzenes, aniline derivatives and substituted phenols. In comparison to the poly(GMA-co-EDMA) monoliths, the epinephrine-bonded monoliths exhibited a much higher retention and slight differences in selectivity. The epinephrine-bonded monolith was further modified by oxidation with a Ce(IV) solution and compared with the epinephrine-bonded monoliths. The resulting monolithic stationary phases were evaluated in terms of reproducibility, giving RSD values below 9% in the parameters investigated. Copyright © 2013 Elsevier B.V. All rights reserved.
Czech Academy of Sciences Publication Activity Database
Horák, Daniel; Pollert, Emil; Trchová, Miroslava; Kovářová, Jana
2009-01-01
Roč. 45, č. 4 (2009), s. 1009-1016 ISSN 0014-3057 R&D Projects: GA AV ČR 1QS100100553; GA AV ČR KAN200200651 Institutional research plan: CEZ:AV0Z40500505; CEZ:AV0Z10100521; CEZ:AV0Z1010921 Keywords : glycidyl methacrylate * perovskite * magnetic Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.310, year: 2009
Energy Technology Data Exchange (ETDEWEB)
Dong, Tingting [Key Laboratory of Green Process and Engineering, State Key Laboratory of Biochemical Engineering, Institute of Process Engineering, Chinese Academy of Sciences, Beijing 100190 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Yang, Liangrong, E-mail: lryang@ipe.ac.cn [Key Laboratory of Green Process and Engineering, State Key Laboratory of Biochemical Engineering, Institute of Process Engineering, Chinese Academy of Sciences, Beijing 100190 (China); Pan, Feng; Xing, Huifang; Wang, Li; Yu, Jiemiao [Key Laboratory of Green Process and Engineering, State Key Laboratory of Biochemical Engineering, Institute of Process Engineering, Chinese Academy of Sciences, Beijing 100190 (China); Qu, Hongnan [Key Laboratory of Green Process and Engineering, State Key Laboratory of Biochemical Engineering, Institute of Process Engineering, Chinese Academy of Sciences, Beijing 100190 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Qingdao Institute of Bioenergy and Bioprocess Technology, Chinese Academy of Sciences, Qingdao 266101 (China); Rong, Meng [Key Laboratory of Green Process and Engineering, State Key Laboratory of Biochemical Engineering, Institute of Process Engineering, Chinese Academy of Sciences, Beijing 100190 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Liu, Huizhou, E-mail: hzliu@ipe.ac.cn [Key Laboratory of Green Process and Engineering, State Key Laboratory of Biochemical Engineering, Institute of Process Engineering, Chinese Academy of Sciences, Beijing 100190 (China)
2017-04-01
A series of ethanediamine (EDA) – modified magnetic poly-(glycidyl methacrylate) (m-PGMA-EDA)microspheres with different amine density were synthesized and their cadmium saturation adsorption capacities were examined. The results showed that the cadmium saturation adsorption capacity increased with the immobilized amine density. However, they did not show strong positive linear correlation in the whole range of amine density examined. The molar ratio of amine groups to the adsorbed cadmium decreased with the increase of amine density and eventually reached a minimum value about 4. It suggested that low immobilized amine density led to low coordination efficiency of the amine. It is hypothesized that the immobilized amine groups needed to be physically close enough to form stable amine-metal complex. When the amine density reached to a critical value 1.25 m mol m{sup −2}, stable amine-cadmium complex (4:1 N/Cd) was proposed to form. To illustrate the coordination mechanism (structure and number) of amine and Cd, FT-IR spectra of m-PGMA-EDA and m-PGMA-EDA-Cd , and X-ray photoelectron spectroscopy (XPS) of PGMA–EDA and PGMA-EDA-Cd were examined and analyzed. - Highlights: • A series of magnetic poly-(glycidyl methacrylate) (m-PGMA-EDA)microspheres with different amine density were synthesized and their cadmium saturation adsorption capacities were examined. • The molar ratio of amine groups to adsorbed cadmium decreased with the increase of amine density and eventually reached a minimum value about 4. • when the amine density reached high enough, 4:1 N/Cd complex was proposed to form, and the hydroxyl also participated in the chelating with Cd.
International Nuclear Information System (INIS)
Teo Ming Ting; Paveswari Sithambaranathan
2017-01-01
Kinetic behaviour of graft copolymerisation of glycidyl methacrylate onto nylon-6 fibres in solvent- and emulsion- media was investigated. The order for the dependence of the initial rate of grafting on the monomer concentration for solvent and emulsion grafting systems were found to be 1.65 and 1.57, respectively. The order of dependence of the initial rate of grafting on the absorbed dose was found to be 1.55 for solvent and 0.62 emulsion grafting systems. The results showed that grafting in both systems is controlled by diffusion mechanism and the degree of grafting can be effectively tuned by variation of the grafting parameters. (author)
New membranes obtained by grafted irradiated PVDF foils
Energy Technology Data Exchange (ETDEWEB)
Mazzei, R. [Unidad de Actividades Tecnologicas y Agropecuarias, Laboratorio de Polimeros, Comision Nacional de Energia Atomica, Buenos Aires (Argentina); Universidad Tecnologica Nacional Facultad Regional, Buenos Aires (Argentina); Garcia Bermudez, G. [Gerencia de Investigacion y Aplicaciones, Laboratorio Tandar, Comision Nacional de Energia Atomica, Buenos Aires (Argentina); Escuela de Ciencia y Tecnologia, Universidad Nacional de General San Martin, Buenos Aires (Argentina); Consejo Nacional de Investigaciones Cientificas y Tecnicas, Buenos Aires (Argentina); Camporotondi, D.E., E-mail: camporotondi@cae.cnea.gov.ar [Unidad de Actividades Tecnologicas y Agropecuarias, Laboratorio de Polimeros, Comision Nacional de Energia Atomica, Buenos Aires (Argentina); Arbeitman, C. [Gerencia de Investigacion y Aplicaciones, Laboratorio Tandar, Comision Nacional de Energia Atomica, Buenos Aires (Argentina); Consejo Nacional de Investigaciones Cientificas y Tecnicas, Buenos Aires (Argentina); and others
2012-09-15
The present work describes a new method to produce membranes of poly(Acrylic-acid-Xmonomer) using the grafting procedure. PVDF foils irradiated with Ar{sup +} beam with energies between 30 and 150 keV were employed as substratum. Different combinations of monomers in water solutions were used: acrylic acid (AAc); acrylic acid-glycidyl methacrylate (AAc-GMA); acrylic acid-styrene (AAc-S), acrylic acid-N-isopropyl acrylamide (AAc-NIPAAm) and acrylic acid-N-isopropyl acrylamide-glycidyl methacrylate (AAc-NIPAAm-GMA). A large percentage of grafting results for specific values of: ion fluence and energy, AAc and sulfuric acid concentration, and different substrata PVDF polymorphous (alpha or beta). At a particular time of the grafting process, the poly(AAc-Xmonomer) membranes detach from the substratum and continue their grafting in the solution. This method is useful to produce increased replicated membranes of the irradiated original surface.
Energy Technology Data Exchange (ETDEWEB)
Kuan, Wei-Chih [Department of Chemical Engineering, Systems Biology and Tissue Engineering Research Center, National Chung Cheng University, Minhisung 621, Taiwan (China); Horák, Daniel, E-mail: horak@imc.cas.cz [Institute of Macromolecular Chemistry, Academy of Sciences of the Czech Republic, Heyrovsky Sq. 2, 162 06 Prague 6 (Czech Republic); Plichta, Zdeněk [Institute of Macromolecular Chemistry, Academy of Sciences of the Czech Republic, Heyrovsky Sq. 2, 162 06 Prague 6 (Czech Republic); Lee, Wen-Chien [Department of Chemical Engineering, Systems Biology and Tissue Engineering Research Center, National Chung Cheng University, Minhisung 621, Taiwan (China)
2014-01-01
Magnetic poly(glycidyl methacrylate)-based macroporous microspheres with an average particle size of 4.2 μm were prepared using a modified multi-step swelling polymerization method and by introducing amino functionality on their surfaces. Antibody molecules were oxidized on their carbohydrate moieties and bound to the amino-containing magnetic microspheres via a site-directed procedure. CD133-positive cells could be effectively captured from human cancer cell lines (HepG2, HCT116, MCF7, and IMR-32) by using magnetic microspheres conjugated to an anti-human CD133 antibody. After further culture, the immunocaptured CD133-expressing cells from IMR-32 proliferated and gradually detached from the magnetic microspheres. Flow-cytometric analysis confirmed the enrichment of CD133-expressing cells by using the antibody-bound magnetic microspheres. Such microspheres suitable for immunocapture are very promising for cancer diagnosis because the CD133-expressing cells in cancer cell lines have been suggested to be cancer stem cells. - Highlights: • Multi-step swelling polymerization produced poly(glycidyl methacrylate) microspheres. • Anti-human CD133 antibodies were bound to the amino-containing magnetic microspheres. • CD133-positive cells were effectively captured from human cancer cell lines. • Immunocaptured CD133-expressing cells proliferated and were detached from microspheres. • Enrichment of CD133-expressing cells was confirmed by flow-cytometric analysis.
Studies of properties of rubber wood with impregnation of polymer
Indian Academy of Sciences (India)
Impregnation of rubber wood has been carried out under different conditions by using styrene as grafting monomer and glycidyl methacrylate (GMA) as crosslinker. Properties such as dimensional stability, water absorption, hardness, tensile strength, flexural strength, etc of the impregnated wood have been checked and ...
Methacrylate and acrylate allergy in dental personnel.
Aalto-Korte, Kristiina; Alanko, Kristiina; Kuuliala, Outi; Jolanki, Riitta
2007-11-01
Methacrylates are important allergens in dentistry. The study aimed to analyse patch test reactivity to 36 acrylic monomers in dental personnel in relation to exposure. We reviewed the test files at the Finnish Institute of Occupational Health from 1994 to 2006 for allergic reactions to acrylic monomers in dental personnel and analysed the clinical records of the sensitized patients. 32 patients had allergic reactions to acrylic monomers: 15 dental nurses, 9 dentists, and 8 dental technicians. The dentists and dental nurses were most commonly exposed to 2-hydroxyethyl methacrylate (2-HEMA), triethyleneglycol dimethacrylate (TREGDMA), and 2,2-bis[4-(2-hydroxy-3-methacryloxypropoxy) phenyl]propane (bis-GMA). 8 dentists and 12 dental nurses were allergic to 2-HEMA. The remaining dentist was positive to bis-GMA and other epoxy acrylates. The remaining 3 dental nurses reacted to diethyleneglycol diacrylate (DEGDA) or triethyleneglycol diacrylate (TREGDA), but not to monofunctional and multifunctional methacrylates. Our dental technicians were mainly exposed and sensitized to methyl methacrylate (MMA) and ethyleneglycol dimethacrylate (EGDMA). 1 technician reacted only to 2-HEMA, and another to ethyl methacrylate (EMA) and ethyl acrylate (EA). 2-HEMA was the most important allergen in dentists and dental nurses, and MMA and EGDMA in dental technicians. Reactions to bis-GMA, DEGDA, TREGDA, EMA and EA were relevant in some patients.
Gelation of photopolymerized hyaluronic acid grafted with glycidyl methacrylate
International Nuclear Information System (INIS)
Prado, S.S.; Weaver, J.M.; Love, B.J.
2011-01-01
Experiments have tracked the ambient gelation of a series of hydrophilic hyaluronic acid (HA) resins grafted with glycidyl methacrylate (GM) and photopolymerized as a function of dose. The resin mixtures range in GMHA concentration between 0.5 and 1.5% w/w in phosphate buffered saline (PBS). Illuminated at 20 mW/cm 2 , the dynamic viscosity (η(t)) has been tracked and characterized using the Boltzmann log-sigmoidal model. A gelled viscosity of ∼ 10 Pa s was determined at 0.5% w/w which rose to ∼ 50 Pa s at or above 1% w/w. More curing agent marginally increased the gel viscosity at each concentration. Time constants associated with viscosity advancement were shortest at [GMHA] = 1.0%; higher concentrations are attributed with lower quantum efficiency when illuminated. Subsequent frequency sweeps replicated already published work using similar GHMA concentrations in PBS. G' values ranged from 100 to 500 Pa over the formulation range with expected sensitivity to GMHA and curing agent concentration. Overall, the sigmoidal model represented this advancing viscosity data well, and further analysis of the physical significance of these model parameters may help in understanding photopolymerization of this complicated formulation more broadly. Highlights: → The ambient dynamic viscosity of photopolymerized GMHA gels has been measured. → 2 physical parameters and two time constants were extracted from the sigmoidal model. → Higher crosslinker content for a fixed GMHA concentration led to higher gel viscosity. → The time to toggle between the initial and final viscosity ranged between 5 and 10 s. → Dynamic frequency sweep tests on cured gels also revealed G' values between 100 and 500 Pa.
PEGylation of magnetic poly(glycidyl methacrylate) microparticles for microfluidic bioassays
International Nuclear Information System (INIS)
Kucerova, Jana; Svobodova, Zuzana; Knotek, Petr; Palarcik, Jiri; Vlcek, Milan; Kincl, Miloslav; Horak, Daniel; Autebert, Julien; Viovy, Jean-Louis; Bilkova, Zuzana
2014-01-01
In this study, magnetic poly(glycidyl methacrylate) microparticles containing carboxyl groups (PGMA-COOH) were coated using highly hydrophilic polymer poly(ethylene glycol) (PEG). PEG was used to reduce nonspecific interactions with proteins and cells while decreasing adhesion of particles to the walls of a microfluidic devices from poly(dimethylsiloxane) (PDMS) and cyclic olefin copolymer (COC). Zeta potential measurement, infrared spectroscopy, scanning electron microscopy, anti-PEG ELISA assay, and bioaffinity interactions between biotin and streptavidin-HRP successfully proved the presence of PEG on the surface of microspheres. Both neat and PEGylated microspheres were then incubated with the inert protein bovine serum albumin or cells to evaluate the rate of nonspecific adsorption (NSA). PEG with Mr of 30,000 Da was responsible for 45% reduction in NSA of proteins and 74% for cells compared to neat particles. The microspheres' behavior in PDMS and COC microchannels was then evaluated. Aggregation and adhesion of PEGylated microspheres significantly decreased compared to neat particles. Finally, the model enzyme horseradish peroxidase was immobilized on the microspheres through the heterobifunctional PEG chain. The possibility for subsequent covalent coupling of the ligand of interest was confirmed. Such PEGylated microparticles can be efficiently used in PDMS microchips as a carrier for bioaffinity separation or of enzyme for catalysis. - Highlights: • Magnetic polymer microspheres with highly hydrophilic PEG coating were prepared. • PEG reduced microsphere adhesion in microchannels versus neat particles. • Suitability of methods for detecting PEG on magnetic microspheres was investigated. • PEG on microsphere surfaces decreased nonspecific adsorption of proteins and cells
PEGylation of magnetic poly(glycidyl methacrylate) microparticles for microfluidic bioassays
Energy Technology Data Exchange (ETDEWEB)
Kucerova, Jana; Svobodova, Zuzana [Department of Biological and Biochemical Sciences, Faculty of Chemical Technology, University of Pardubice, Studentska 573, 53210 Pardubice (Czech Republic); Knotek, Petr [Joint Laboratory of Solid State Chemistry of IMC and University of Pardubice, Faculty of Chemical Technology, University of Pardubice, Studentska 573, 53210 Pardubice (Czech Republic); Palarcik, Jiri [Institute of Environmental and Chemical Engineering, Faculty of Chemical Technology, University of Pardubice, Studentska 573, 53210 Pardubice (Czech Republic); Vlcek, Milan; Kincl, Miloslav; Horak, Daniel [Institute of Macromolecular Chemistry, Academy of Sciences of the Czech Republic, Heyrovsky Sq. 2, 16206 Prague 6 (Czech Republic); Autebert, Julien; Viovy, Jean-Louis [Macromolecules and Microsystems in Biology and Medicine, Institute Curie, UMR 168, 26 Rue d' Ulm, 75005 Paris (France); Bilkova, Zuzana, E-mail: zuzana.bilkova@upce.cz [Department of Biological and Biochemical Sciences, Faculty of Chemical Technology, University of Pardubice, Studentska 573, 53210 Pardubice (Czech Republic)
2014-07-01
In this study, magnetic poly(glycidyl methacrylate) microparticles containing carboxyl groups (PGMA-COOH) were coated using highly hydrophilic polymer poly(ethylene glycol) (PEG). PEG was used to reduce nonspecific interactions with proteins and cells while decreasing adhesion of particles to the walls of a microfluidic devices from poly(dimethylsiloxane) (PDMS) and cyclic olefin copolymer (COC). Zeta potential measurement, infrared spectroscopy, scanning electron microscopy, anti-PEG ELISA assay, and bioaffinity interactions between biotin and streptavidin-HRP successfully proved the presence of PEG on the surface of microspheres. Both neat and PEGylated microspheres were then incubated with the inert protein bovine serum albumin or cells to evaluate the rate of nonspecific adsorption (NSA). PEG with Mr of 30,000 Da was responsible for 45% reduction in NSA of proteins and 74% for cells compared to neat particles. The microspheres' behavior in PDMS and COC microchannels was then evaluated. Aggregation and adhesion of PEGylated microspheres significantly decreased compared to neat particles. Finally, the model enzyme horseradish peroxidase was immobilized on the microspheres through the heterobifunctional PEG chain. The possibility for subsequent covalent coupling of the ligand of interest was confirmed. Such PEGylated microparticles can be efficiently used in PDMS microchips as a carrier for bioaffinity separation or of enzyme for catalysis. - Highlights: • Magnetic polymer microspheres with highly hydrophilic PEG coating were prepared. • PEG reduced microsphere adhesion in microchannels versus neat particles. • Suitability of methods for detecting PEG on magnetic microspheres was investigated. • PEG on microsphere surfaces decreased nonspecific adsorption of proteins and cells.
GLYCOL METHACRYLATE EMBEDDING OF ALGINATE-POLYLYSINE MICROENCAPSULATED PANCREATIC-ISLETS
FRITSCHY, WM; GERRITS, PO; WOLTERS, GHJ; PASMA, A; VANSCHILFGAARDE, R
A method for processing and embedding alginate-polylysine microencapsulated pancreatic tissue in glycol methacrylate resin (GMA) is described. Fixation in 4% phosphate buffered formaldehyde, processing in ascending concentrations of glycol methacrylate monomer and embedding in Technovit 7100 results
Kim, L U; Kim, J W; Kim, C K
2006-09-01
To prepare a dental composite that has a low amount of curing shrinkage and excellent mechanical strength, various 2,2-bis[4-(2-hydroxy-3-methacryloyloxy propoxy) phenyl] propane (Bis-GMA) derivatives were synthesized via molecular structure design, and afterward, properties of their mixtures were explored. Bis-GMA derivatives, which were obtained by substituting methyl groups for hydrogen on the phenyl ring in the Bis-GMA, exhibited lower curing shrinkage than Bis-GMA, whereas their viscosities were higher than that of Bis-GMA. Other Bis-GMA derivatives, which contained a glycidyl methacrylate as a molecular end group exhibited reduced curing shrinkage and viscosity. Methoxy substitution for hydroxyl groups on the Bis-GMA derivatives was performed for the further reduction of the viscosity and curing shrinkage. Various resin mixtures, which had the same viscosity as the commercial one, were prepared, and their curing shrinkage was examined. A resin mixture containing 2,2-bis[3,5-dimethyl, 4-(2-methoxy-3-methacryloyloxy propoxy) phenyl] propane] (TMBis-M-GMA) as a base resin and 4-tert-butylphenoxy-2-methyoxypropyl methacrylate (t-BP-M-GMA) as a diluent exhibited the lowest curing shrinkage among them. The composite prepared from this resin mixture also exhibited the lowest curing shrinkage along with enhanced mechanical properties.
Energy Technology Data Exchange (ETDEWEB)
Bereli, Nilay; Sener, Guelsu; Altintas, Evrim Banu; Yavuz, Handan [Department of Chemistry, Biochemistry Division, Hacettepe University, Ankara (Turkey); Denizli, Adil, E-mail: denizli@hacettepe.edu.tr [Department of Chemistry, Biochemistry Division, Hacettepe University, Ankara (Turkey)
2010-01-30
Depletion of high abundant proteins like albumin and immunoglobulin G (IgG) can be beneficial in the analysis of serum proteins. For this purpose, Cibacron Blue F3GA and iminodiacetic acid (IDA)-Cu{sup 2+} containing poly(glycidyl methacrylate) (PGMA) beads (1.6 {mu}m in diameter) were embedded into the poly(hydroxyethyl methacrylate) (PHEMA) cryogel. The PGMA beads were prepared by dispersion polymerization. The PGMA beads were modified with Cibacron Blue F3GA and iminodiacetic acid (IDA)-Cu{sup 2+} for simultaneous albumin and IgG depletion, respectively. The PHEMA cryogel was synthesized by free radical polymerization in the presence of the modified PGMA beads. The PHEMA and PHEMA/PGMA composite cryogels were characterized by swelling measurements and scanning electron microscopy (SEM). Protein depletion studies were carried out in a continuous experimental set-up in a stacked column. Albumin adsorption capacity of the PGMA-Cibacron Blue F3GA beads embedded PHEMA cryogel (PHEMA/PGMA-Cibacron Blue F3GA) was 342 mg/g and IgG adsorption capacity of the PGMA-IDA-Cu{sup 2+} beads embedded PHEMA cryogel (PHEMA/PGMA-IDA-Cu{sup 2+}) was 257 mg/g. The composite cryogels depleted albumin and IgG from human serum with 89.4% and 93.6% efficiency, respectively. High desorption values (over 90% for both modified cryogels) were achieved with 0.05 M phosphate buffer containing1.0 M NaCl.
Idil, Neslihan; Perçin, Işık; Karakoç, Veyis; Yavuz, Handan; Aksöz, Nilüfer; Denizli, Adil
2015-10-01
The aim of this study was to prepare Concanavalin A (Con A) immobilized magnetic poly(glycidyl methacrylate) (mPGMA) beads for prostate specific antigen (PSA) binding and to study binding capacities of the beads using lectin-glycoprotein interactions. Firstly, iron oxide nanoparticles were synthesized by co-precipitation method and then, beads were synthesized by dispersion polymerization in the presence of iron oxide nanoparticles. Con A molecules were both covalently immobilized onto the beads directly and through the spacer arm (1,6-diaminohexane-HDMA). The total PSA and free PSA binding onto the mPGMA-HDMA-Con A beads were higher than that of the mPGMA-Con A beads. Maximum PSA binding capacity was observed as 91.2 ng/g. Approximately 45% of the bound PSA was eluted by using 0.1 M mannose as elution agent. The mPGMA-HDMA-Con A beads could be reused without a remarkable decrease in the binding capacities after 5 binding-desorption cycles. Serum fractions were analyzed using SDS-PAGE. The mPGMA-HDMA-Con A beads could be useful for the detection of PSA and suggested as a model system for other glycoprotein biomarkers. Copyright © 2015 Elsevier B.V. All rights reserved.
Sorption of Uranium Ions from Their Aqueous Solution by Resins Containing Nanomagnetite Particles
Directory of Open Access Journals (Sweden)
Mahmoud O. Abd El-Magied
2016-01-01
Full Text Available Magnetic amine resins composed of nanomagnetite (Fe3O4 core and glycidyl methacrylate (GMA/N,N′-methylenebisacrylamide (MBA shell were prepared by suspension polymerization of glycidyl methacrylate with N,N′-methylenebisacrylamide in the presence of nanomagnetite particles and immobilized with different amine ligands. These resins showed good magnetic properties and could be easily retrieved from their suspensions using an external magnetic field. Adsorption behaviors of uranium ions on the prepared resins were studied. Maximum sorption capacities of uranium ions on R-1 and R-2 were found to be 92 and 158 mg/g. Uranium was extracted successfully from three granite samples collected from Gabal Gattar pluton, North Eastern Desert, Egypt. The studied resins showed good durability and regeneration using HNO3.
International Nuclear Information System (INIS)
Takacs, E.; Wojnarovits, L.; Borsa, J.
2011-01-01
Complete text of publication follows. Sustainable development needs renewable raw materials applied wherever possible. Cellulose is the most abundant biopolymer on earth; various modifications of its properties for special uses are important issues of the research. Some contaminations in wastewaters, e.g. pesticides, are hydrophobic materials; their adsorption on hydrophilic cellulose substrates is very limited. Cotton cellulose was grafted by glycidyl methacrylate in simultaneous grafting using gamma irradiation initiation. Water uptake of cellulose significantly decreased while adsorption of phenol and a pesticide molecule (2,4-dichlorophenoxyacetic acid: 2,4-D) increased upon grafting. As the figure shows on untreated sample even negative 2,4-D adsorption occurred, due to the selective adsorption of water from the solution; the adsorption did not approach its saturation value even in a 30 hours time period investigated. Saturation of phenol adsorption was achieved after 5-6 hours; adsorption equilibrium data of phenol fitted the Langmuir isotherm.
Tan, Jianbo; Liu, Dongdong; Huang, Chundong; Li, Xueliang; He, Jun; Xu, Qin; Zhang, Li
2017-08-01
Herein, a novel photoinitiated polymerization-induced self-assembly formulation via photoinitiated reversible addition-fragmentation chain transfer dispersion polymerization of glycidyl methacrylate (PGMA) in ethanol-water at room temperature is reported. It is demonstrated that conducting polymerization-induced self-assembly (PISA) at low temperatures is crucial for obtaining colloidal stable PGMA-based diblock copolymer nano-objects. Good control is maintained during the photo-PISA process with a high rate of polymerization. The polymerization can be switched between "ON" and "OFF" in response to visible light. A phase diagram is constructed by varying monomer concentration and degree of polymerization. The PGMA-based diblock copolymer nano-objects can be further cross-linked by using a bifunctional primary amine reagent. Finally, silver nanoparticles are loaded within cross-linked vesicles via in situ reduction, exhibiting good catalytic properties. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Effect of compatibilizer on impact and morphological analysis of recycled HDPE/PET blends
Energy Technology Data Exchange (ETDEWEB)
Salleh, Mohd Nazry [School of Applied Physics, Faculty of Science and Technology, Universiti Kebangsaan Malaysia, 43600 Bangi, Selangor, Malaysia and School of Materials Engineering, Universiti Malaysia Perlis, 02600 Jejawi, Perlis (Malaysia); Ahmad, Sahrim; Ghani, Mohd Hafizuddin Ab; Chen, Ruey Shan [School of Applied Physics, Faculty of Science and Technology, Universiti Kebangsaan Malaysia, 43600 Bangi, Selangor (Malaysia)
2013-11-27
Blends based on recycled high density polyethylene (rHDPE) and recycled polyethylene terephthalate (rPET) were prepared using a corotating twin screw extruder. PET and HDPE are incompatible polymers and their blends showed poor properties. Compatibilization is a step to obtain blends with good mechanical properties and in this work, ethylene glycidyl methacrylate copolymer (E-GMA) was used as a compatibilizing agent. The effect of blends based on rHDPE and rPET with and without a compatibilizer, E-GMA were examined. From the studies clearly showed that the addition of 5% E-GMA increased the impact strength. SEM analysis of rHDPE/rPET blends confirmed the morphological interaction and improved interfacial bonding between two phases.
Controlled release of potassium chloride from radiation-polymerized copolymer matrices
International Nuclear Information System (INIS)
Yoshida, Masaru; Kumakura, Minoru; Kaetsu, Isao
1979-01-01
Release behavior of potassium chloride (KCl) from the flat circular copolymer composites, obtained by radiation-induced polymerization at low temperatures, was studied. The release rate agreed with the first-order kinetics based on the Noyes-Whitney equation in relation to the swelling of the composites. Release profiles of KCl from copolymer composites was affected by monomer composition between hydroxyethyl acrylate (HEA) and polyfunctional glass-forming monomers such as 2-hydroxyethyl methacrylate (HEMA), diethylene glycol dimethacrylate (DGDA), and trimethylolpropane trimethacrylate (TMPT) owing to change of swelling property of copolymers. The release rate decreased at HEA-poor composition in any system. In the case of hydrophobic comonomer system such as glycidyl methacrylate (GMA) and DGDA, release profile of KCl showed a minimum at 50% GMA-50% DGDA monomer composition. (author)
Frederiks, W. M.; Bosch, K. S.
1993-01-01
Freeze-substituted rat liver embedded in glycol methacrylate (GMA) has been used to demonstrate the activities of several enzymes. The following enzymes could be detected in GMA-sections by the indicated histochemical procedure(s): 5'-nucleotidase (lead salt, cerium-diaminobenzidine), alkaline
Islam, Aminul; Kumar, Suneel; Zaidi, Noushi; Ahmad, Hilal
2016-12-15
An ethylenediamine functionalized glycidyl methacrylate (GMA) based terpolymeric chelating resin was synthesized for the separation and preconcentration of Cd(II) and Zn(II) by SPE from bread, rice and fruit juice prior to FAAS determination. The resin was characterized by FT-IR, TGA/DTA, SEM, BET analysis and EDS. Synthesized resin shows a good capacity of 53.96mgg(-1) for Cd(II) and 24.19mgg(-1) for Zn(II) at pH 8.0. Five isotherm equilibrium models were studied to explain the sorption phenomenon out of which Langmuir, Dubinin-Radushkevich, Scatchard and Temkin models were found to be the best fitted. The limit of detection (LOD) and limit of quantification (LOQ) were observed to be 1.5 and 5.1μgL(-1) for Cd and 1.2 and 4.1μgL(-1) for Zn. The reliability of the method was investigated by the analysis of SRM and the recovery of analytes from various spiked food samples. Copyright © 2016 Elsevier Ltd. All rights reserved.
Chen, Liang; Xu, Changqi; Wang, Yong; Shi, Jian; Yu, Qingsong
2012-01-01
The purpose of this research was to investigate the influence of the glyoxylic acid (GA) modification of hydroxyapatite (HAP) nanofibers on their dispersion in bisphenol A glycidyl methacrylate (BisGMA)/triethylene glycol dimethacrylate (TEGDMA) dental composites and also investigate the mechanical properties, water absorption, and water solubility of the resulting dental resins and composites. Scanning/Transmission electron microscopy (STEM) images showed that microsized HAP nanofiber bundles could be effectively broken down to individual HAP nanofibers with an average length of ~15 μm after the surface modification process. Fourier transform infrared spectroscopy (FT-IR), X-ray photoelectron spectroscopy (XPS) and thermal gravimetric analysis (TGA) characterization confirmed glyoxylic acid was chemically grafted on the HAP nanofiber surface, hypothetically by reacting with the amine group on HAP nanofiber surface. The enhanced dispersion of HAP nanofibers in dental matrix led to increased biaxial flexural strength (BFS) compared with the corresponding dental resins and composites filled with untreated HAP nanofibers. In addition, impregnation of small mass fractions of the glyoxylic acid modified HAP nanofibers into the BisGMA/TEGDMA dental resins (5wt%, 10wt%) or composites (2wt%, 3wt%) could also substantially improve the BFS in comparison with the controls(pure resins or dental composites filled with silica particles alone). Larger mass fractions could not further increase the mechanical property or even degrade the BFS values. Water behavior testing results indicated that the addition of glyoxylic acid modified HAP nanofibers resulted in higher water absorption and water solubility values which is not preferred for clinical application. In summary, well dispersed HAP nanofibers and their dental composites with enhanced mechanical property have been successfully fabricated but the water absorption and water solubility of such dental composites need to be
International Nuclear Information System (INIS)
Chen Liang; Yu Qingsong; Li Hao; Xu Changqi; Wang Yong; Shi Jian
2012-01-01
The purpose of this research was to investigate the influence of the glyoxylic acid (GA) modification of hydroxyapatite (HAP) nanofibers on their dispersion in bisphenol A glycidyl methacrylate (BisGMA)/triethylene glycol dimethacrylate (TEGDMA) dental composites and also to investigate the mechanical properties, water absorption and water solubility of the resulting dental resins and composites. Scanning/transmission electron microscopy images showed that microsized HAP nanofiber bundles could be effectively broken down into individual HAP nanofibers with an average length of ∼15 µm after the surface modification process. Fourier transform infrared spectroscopy, x-ray photoelectron spectroscopy and thermal gravimetric analysis characterization confirmed that GA was chemically grafted on the HAP nanofiber surface, hypothetically by reacting with the amine group on the HAP nanofiber surface. The enhanced dispersion of HAP nanofibers in the dental matrix led to increased biaxial flexural strength (BFS) compared with the corresponding dental resins and composites filled with untreated HAP nanofibers. In addition, impregnation of small mass fractions of the GA-modified HAP nanofibers into the BisGMA/TEGDMA dental resins (5 wt%, 10 wt%) or composites (2 wt%, 3 wt%) could also substantially improve the BFS in comparison with the controls (pure resins or dental composites filled with silica particles alone). Larger mass fractions could not increase the mechanical property further or even degraded the BFS values. Water behavior testing results indicated that the addition of the GA-modified HAP nanofibers resulted in higher water absorption and water solubility values, which are not preferred for clinical application. In summary, well-dispersed HAP nanofibers and their dental composites with enhanced mechanical properties have been successfully fabricated, but the water absorption and water solubility of such dental composites need to be further improved. (paper)
Directory of Open Access Journals (Sweden)
Sandić Zvjezdana P.
2014-01-01
Full Text Available In this paper, macroporous glycidyl methacrylate and ethylene glycol dimethacrylate copolymer functionalized with diethylene triamine [PGME-deta], was evaluated as Reactive Black 5 (RB5 sorbent. Batch RB5 removal from aqueous solution by PGME-deta was investigated by varying pH, contact time, sorbent dosage, initial dye concentration and temperature. The sorption is pH sensitive having maximum at pH 2 (dye removal of 85%, decreasing with the increase of pH (dye removal of 24% at pH=11 after 60 min. Sorption kinetics was fitted to chemical-reaction and particle-diffusion models (pseudo-first-order, pseudo-second-order, intraparticle diffusion and Mckay models. The pseudo-second-order kinetic model accurately predicted the RB5 amount sorbed under all investigated operating conditions, while the intraparticle diffusion was the dominant rate-limiting mechanism. The diffusion mechanism was more prevalent with the decrease in temperature and the increase in concentration. The isotherm data was best fitted with the Langmuir model, indicating homogeneous distribution of active sites on PGME-deta and monolayer sorption, with the maximum sorption capacity of 353 mg g-1. The calculated sorption rates improved with increasing temperature and an activation energy close to 40 kJ mol-1 was determined, suggesting that chemisorption was also rate-controlling. [Projekat Ministarstva nauke Republike Srbije, br. III 43009, br. TR 37021 i br. III 45001
Pimpha, Nuttaporn; Chaleawlert-umpon, Saowaluk; Chruewkamlow, Nuttapol; Kasinrerk, Watchara
2011-03-15
Novel immunomagnetic particles have been prepared for separation of CD4(+) lymphocytes. The magnetic nanoparticles with a diameter of approximately 5-6 nm were first synthesized by co-precipitation from ferrous and ferric iron solutions and subsequently encapsulated with poly(glycidyl methacrylate) (PGMA) by precipitation polymerization. Monoclonal antibody specific to CD4 molecules expressed on CD4(+) lymphocytes was conjugated to the surface of magnetic PGMA particles through covalent bonding between epoxide functional groups on the particle surface and primary amine groups of the antibodies. The generated immunomagnetic particles have successfully separated CD4(+) lymphocytes from whole blood with over 95% purity. The results indicated that these particles can be employed for cell separation and provide a strong potential to be applied in various biomedical applications including diagnosis, and monitoring of human diseases. Copyright © 2010 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Maksin, Danijela D.; Nastasović, Aleksandra B.; Milutinović-Nikolić, Aleksandra D.; Suručić, Ljiljana T.; Sandić, Zvjezdana P.; Hercigonja, Radmila V.; Onjia, Antonije E.
2012-01-01
Highlights: ► Methacrylate based copolymers grafted with diethylene triamine as Cr(VI) sorbents. ► Chemisorption and pore diffusion are characteristics of this sorption system. ► Langmuir isotherm provided best fit and maximum adsorption capacity was 143 mg g −1 . ► Cr(VI) sorption onto amino-functionalized copolymer was endothermic and spontaneous. ► A simple, efficient and cost-effective hexavalent chromium removal method. - Abstract: Two porous and one non-porous crosslinked poly(glycidyl methacrylate-co-ethylene glycol dimethacrylate) [abbreviated PGME] were prepared by suspension copolymerization and functionalized with diethylene triamine [abbreviated PGME-deta]. Samples were characterized by elemental analysis, mercury porosimetry, scanning electron microscopy with energy-dispersive X-ray spectroscopy, and transmission electron microscopy. Kinetics of Cr(VI) sorption by PGME-deta were investigated in batch static experiments, in the temperature range 25–70 °C. Sorption was rapid, with the uptake capacity higher than 80% after 30 min. Sorption behavior and rate-controlling mechanisms were analyzed using five kinetic models (pseudo-first order, pseudo-second order, Elovich, intraparticle diffusion and Bangham model). Kinetic studies showed that Cr(VI) adsorption adhered to the pseudo-second-order model, with definite influence of pore diffusion. Equilibrium data was tested with Langmuir, Freundlich and Tempkin adsorption isotherm models. Langmuir model was the most suitable indicating homogeneous distribution of active sites on PGME-deta and monolayer sorption. The maximum adsorption capacity from the Langmuir model, Q max , at pH 1.8 and 25 °C was 143 mg g −1 for PGME2-deta (sample with the highest amino group concentration) while at 70 °C Q max reached the high value of 198 mg g −1 . Thermodynamic parameters revealed spontaneous and endothermic nature of Cr(VI) adsorption onto PGME-deta.
Energy Technology Data Exchange (ETDEWEB)
Rittich, Bohuslav [Masaryk University, Faculty of Science, Institute of Experimental Biology, Tvrdeho 14, CZ-611 37 Brno (Czech Republic); Brno University of Technology, Faculty of Chemistry, Institute of Food Science and Biotechnology, Purkynova 464/118, CZ-612 00 Brno (Czech Republic)], E-mail: rittich@sci.muni.cz; Spanova, Alena [Masaryk University, Faculty of Science, Institute of Experimental Biology, Tvrdeho 14, CZ-611 37 Brno (Czech Republic); Brno University of Technology, Faculty of Chemistry, Institute of Food Science and Biotechnology, Purkynova 464/118, CZ-612 00 Brno (Czech Republic); Salek, Petr [Brno University of Technology, Faculty of Chemistry, Institute of Food Science and Biotechnology, Purkynova 464/118, CZ-612 00 Brno (Czech Republic); Nemcova, Petra [Masaryk University, Faculty of Science, Institute of Experimental Biology, Tvrdeho 14, CZ-611 37 Brno (Czech Republic); Trachtova, Stepanka [Brno University of Technology, Faculty of Chemistry, Institute of Food Science and Biotechnology, Purkynova 464/118, CZ-612 00 Brno (Czech Republic); Horak, Daniel [Institute of Macromolecular Chemistry, Academy of Sciences of the Czech Republic, Heyrovsky Sq. 2, CZ-162 06 Prague (Czech Republic)
2009-05-15
Carboxyl group-containing magnetic nonporous poly(2-hydroxyethyl methacrylate-co-glycidyl methacrylate) (P(HEMA-co-GMA)) and magnetic glass microspheres were used for the isolation of bacterial DNA. P(HEMA-co-GMA) microspheres were prepared by the dispersion polymerization in toluene/2-methylpropan-1-ol mixture in the presence of magnetite nanoparticles obtained by coprecipitation of Fe(II) and Fe(III) salts with ammonium hydroxide. Carboxyl groups were then introduced by oxidation of the microspheres with potassium permanganate. The most extensive DNA recovery was achieved at PEG 6000 concentrations of 12% or 16% and 2 M NaCl. The method proposed was used for bacterial DNA isolation from different dairy products containing Bifidobacterium and Lactobacillus cells. The presence of target DNA and the quality of isolated DNA were checked by polymerase chain reaction (PCR) amplification with specific primers.
THE EFFECTS OF GLYCOL METHACRYLATE AS A DEHYDRATING AGENT ON THE DIMENSIONAL CHANGES OF LIVER-TISSUE
GERRITS, PO; HOROBIN, RW; STOKROOS, [No Value
The dimensional changes of liver sections during the course of processing with glycol methacrylate (GMA) or with ethanol are described. Tissue processing with ethanol served as a control. During prolonged processing steps (24 h each), linear shrinkage of tissue specimens dehydrated with GMA at room
International Nuclear Information System (INIS)
Warangkhana, Phromma; Rathanawan, Magaraphan; Jana Sadhan, C.
2015-01-01
The ternary blends of poly(lactic acid) (PLA), poly(ethylene-co-vinyl alcohol) (EVOH), and poly(ethylene-co-glycidyl methacrylate) (EGMA) were prepared. The role of EGMA as a compatibilizer was evaluated. The weight ratio of PLA:EVOH was 80:20 and the EGMA loadings were varied from 5-20 phr. The blends were characterized as follows: thermal properties by differential scanning calorimetry, morphology by scanning electron microscopy, and mechanical properties by pendulum impact tester, and universal testing machine. The glass transition temperature of PLA blends did not change much when compared with that of PLA. The blends of PLA/EGMA and EVOH/EGMA showed EGMA dispersed droplets where the latter led to poor impact properties. However, the tensile elongation at break and tensile toughness substantially increased upon addition of EGMA to blends of PLA and EVOH. It was noted in tensile test samples that both PLA and EVOH domains fibrillated significantly to produce toughness
Energy Technology Data Exchange (ETDEWEB)
Warangkhana, Phromma; Rathanawan, Magaraphan, E-mail: rathanawan.k@chula.ac.th [Chulalongkorn University, Petroleum and Petrochemical College - Bangkok (Thailand); Jana Sadhan, C., E-mail: janas@uakron.edu [The University of Akron, Department of Polymer Engineering, Ohio (United States)
2015-05-22
The ternary blends of poly(lactic acid) (PLA), poly(ethylene-co-vinyl alcohol) (EVOH), and poly(ethylene-co-glycidyl methacrylate) (EGMA) were prepared. The role of EGMA as a compatibilizer was evaluated. The weight ratio of PLA:EVOH was 80:20 and the EGMA loadings were varied from 5-20 phr. The blends were characterized as follows: thermal properties by differential scanning calorimetry, morphology by scanning electron microscopy, and mechanical properties by pendulum impact tester, and universal testing machine. The glass transition temperature of PLA blends did not change much when compared with that of PLA. The blends of PLA/EGMA and EVOH/EGMA showed EGMA dispersed droplets where the latter led to poor impact properties. However, the tensile elongation at break and tensile toughness substantially increased upon addition of EGMA to blends of PLA and EVOH. It was noted in tensile test samples that both PLA and EVOH domains fibrillated significantly to produce toughness.
Moyna, Áine; Connolly, Damian; Nesterenko, Ekaterina; Nesterenko, Pavel N; Paull, Brett
2013-03-01
Lauryl methacrylate-co-ethylene dimethacrylate monoliths were polymerised within fused silica capillaries and subsequently photo-grafted with varying amounts of glycidyl methacrylate (GMA). The grafted monoliths were then further modified with iminodiacetic acid (IDA), resulting in a range of chelating ion-exchange monoliths of increasing capacity. The IDA functional groups were attached via ring opening of the epoxy group on the poly(GMA) structure. Increasing the amount of attached poly(GMA), via photo-grafting with increasing concentrations of GMA, from 15 to 35%, resulted in a proportional and controlled increase in the complexation capacity of the chelating monoliths. Scanning capacitively coupled contactless conductivity detection (sC(4)D) was used to characterise and verify homogenous distribution of the chelating ligand along the length of the capillaries non-invasively. Chelation ion chromatographic separations of selected transition and heavy metals were carried out, with retention factor data proportional to the concentration of grafted poly(GMA). Average peak efficiencies of close to 5,000 N/m were achieved, with the isocratic separation of Na, Mg(II), Mn(II), Co(II), Cd(II) and Zn(II) possible on a 250-mm-long monolith. Multiple monolithic columns produced to the same recipes gave RSD data for retention factors of ions). The monolithic chelating ion-exchanger was applied to the separation of alkaline earth and transition metal ions spiked in natural and potable waters.
Wenceslau, Adriana Cristina; Universidade Estadual de Maringá - UEM; Rubira, Adley Forti; Universidade Estadual de Maringá - UEM; Muniz, Edvani Curti; UEM, Maringá, Paraná
2011-01-01
IPN hydrogels based on chemically modified poly(vinyl alcohol) (or PVA-Ma), with different degrees of substitution (DS), and poly(N-isopropylacrylamide) (or PNIPAAm) were obtained and characterized through measures of LCST, swelling ratio and mechanical properties. Linear PVA-Ma with several DS were obtained through the chemical reaction of PVA with glycidyl methacrylate (GMA). The DS of various PVA-Ma were determined through 1H NMR spectroscopy. Two steps were used for preparation the PVA-Ma...
Sanus, Galip Zihni; Kucukyuruk, Baris; Biceroglu, Huseyin; Isler, Cihan; Tanriverdi, Taner; Bas, Ahmet; Albayram, Sait; Kurkcu, Mehmet; Oz, Buge
2014-07-01
Promising clinical results were reported in watertight closure of anterior skull base defects (ASBDs) with bisphenol-a-glycidyl-dimethacrylate (bis-GMA)-based materials to prevent the cerebrospinal fluid leaks. However, interrelation of these materials with surrounding bones in histologic level, referred to as the osteointegration, has not been reported in the anterior skull base. In addition, an illustrative case with an ASBD that was repaired using a bis-GMA composite has been presented. Twenty New Zealand rabbits were divided into 4 groups: control and sham groups consisted of 2 and 6 rabbits, respectively. The "skull base defect" group (n = 6) underwent a unifrontal craniectomy and an iatrogenic ASBD followed by creating a dural defect to obtain a cerebrospinal fluid leak. Similar bony and dural defects were acquired in the "repair with bis-GMA based allograft" group (n = 6), but the bony defect was closed with bis-GMA-based allograft. All animals in the "skull base defect" group died in 3 weeks after surgery. There were no animal losses in the "repair with bis-GMA based allograft" group at the sixth month. Histologic evaluation revealed complete osteointegration of bis-GMA composite with surrounding bones. bis-GMA based allograft achieved a watertight repair of the ASBD. Histologic findings of this study showed that bis-GMA composite is a reliable material to be used in the closure of anterior skull base bony defects.
Energy Technology Data Exchange (ETDEWEB)
Karaman, Mustafa, E-mail: karamanm@selcuk.edu.tr [Department of Chemical Engineering, Selçuk University, Konya, 42075 (Turkey); Advanced Technology Research & Application Center, Selçuk University, Konya, 42075 (Turkey); Uçar, Tuba [Department of Chemical Engineering, Selçuk University, Konya, 42075 (Turkey)
2016-01-30
Graphical abstract: - Highlights: • Thin films of poly(hexafluorobutyl acrylate-glycidyl methacrylate) can be deposited by PECVD. • The coated surfaces are hydrophobic due to the long fluorinated side chains. • The hydrophobicity of the coating is observed to be stable under harsh conditions. • Film durability is attributed to the mechanical strength of the films due to their epoxide functionality. - Abstract: Thin films of poly(2,2,3,4,4,4 hexafluorobutyl acrylate-glycidyl methacrylate) (P(HFBA-GMA) were deposited on different surfaces using an inductively coupled RF plasma reactor. Fluorinated polymer was used to impart hydrophobicity, whereas epoxy polymer was used for improved durability. The deposition at a low plasma power and temperature was suitable for the functionalization of fragile surfaces such as textile fabrics. The coated rough textile surfaces were found to be superhydrophobic with water contact angles greater than 150° due to the high retention of long fluorinated side chains. The hydrophobicity of the surfaces was observed to be stable after many exposures to ultrasonification tests, which is attributed to the mechanical durability of the films due to their epoxide functionality. FTIR and XPS analyses of the deposited films confirmed that the epoxide functionality of the polymers increased with increasing glycidyl methacrylate fraction in the reactor inlet. The modulus and hardness values of the films also increase with increasing epoxide functionality.
Mazlan, Siti Zulaikha; Hanifah, Sharina Abu
2014-09-01
Immobilization of laccase on the modified copolymer methacrylate-acrylate microspheres was studied. A poly (glycidyl methacrylate-co-n-butyl acrylate) microsphere consists of epoxy groups were synthesized using suspension photocuring technique. The epoxy group in poly (GMA-nBA) microspheres were converted into amino groups with aldehyde group. Laccase immobilization is based on having the amino groups on the enzyme surface and aldehyde group on the microspheres via covalent binding. Fourier transform infrared spectroscopy (FT-IR) analysis proved the successful surface modification on microspheres. The FTIR spectrum shows the characteristic peaks at 1646 cm-1 assigned to the conformation of the polymerization that took place between monomer GMA and nBA respectively. In addition, after modification, FTIR peaks that assigned to the epoxy ring (844 cm-1 and 904 cm-1) were decreased. The results obtained from FTIR method signify good agreement with the epoxy content method. Hence, the activity of the laccase-immobilized microspheres increased upon increasing the epoxy content. Furthermore, poly (GMA-nBA) exhibited uniform microspheres with below 2 μm surface. Immobilized enzyme showed a broader pH profile and higher temperature compared native enzyme.
Synthesis and characterization of new functionalized polymer-Fe3O4 nanocomposite particles
Directory of Open Access Journals (Sweden)
A. Bukowska
2017-01-01
Full Text Available In this study, Fe3O4 nanoparticles (NPs were functionalized with copolymer or terpolymer bearing glycidyl methacrylate (GMA moieties making them suitable for potential applications as drug delivery systems (DDS. For this purpose, the surface of magnetic nanoparticles was first coated with 3-(trimethoxysilyl propyl methacrylate (MPS by a silanization reaction to introduce reactive methacrylate groups onto the surface. Subsequently, monomers were grafted onto the surface of modified-MPS particles via two polymerization methods: seed emulsion (GMA, divinylbenzene, DVB, and styrene, S and distillation – precipitation (GMA and DVB. The obtained nanocomposite particles were characterized by FTIR (Fourier transform infrared spectroscopy, DR UV-Vis (diffuse reflectance ultraviolet – visible spectroscopy, TEM (transmission electron microscopy combined with EDS (energy dispersive X-ray spectroscopy analysis and DLS (dynamic light scattering. FTIR spectroscopy showed that indeed a polymer – Fe3O4@MPS composite was obtained. TEM and EDS analysis showed that the seed emulsion method resulted in nanosized, 100 nm Fe3O4@MPS core/polymer shell NPs, forming long chains. On the contrary, the distillation – precipitation method caused the formation of an inverted structure, i.e. polymer core coated by a Fe3O4@MPS shell, which exhibited a very coarse size distribution varying from several hundreds to over 2 µm.
Bandari, Rajendar; Höche, Thomas; Prager, Andrea; Dirnberger, Klaus; Buchmeiser, Michael R
2010-04-19
Monolithic polymeric supports have been prepared by electron-beam-triggered free-radical polymerization using a mixture of glycidyl methacrylate and trimethylolpropane triacrylate in 2-propanol, 1-dodecanol, and toluene. Under appropriate conditions, phase separation occurred, which resulted in the formation of a porous monolithic matrix that was characterized by large (convective) pores in the 30 μm range as well as pores of 7 nm were hydrolyzed by using poly(styrenesulfonic acid) (Mw = 69,400 g mol(-1), PDI=2.4). The remaining epoxy groups inside pores of nanoparticles 2 nm in diameter were formed. The palladium-nanoparticle-loaded monoliths were used in both Heck- and Suzuki-type coupling reactions achieving turnover numbers of up to 167,000 and 63,000, respectively. Copyright © 2010 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
International Nuclear Information System (INIS)
Ferreira, Maiara S.; Sartori, Mariana N.; Oliveira, Rene R.; Guven, Olgun; Moura, Esperidiana A.B.
2014-01-01
Graphical abstract: - Highlights: • HDPE reinforced with short piassava fiber composites were prepared by melt-mixing processing. • Glycidyl methacrylate (GMA) was tested as a radiation cross-linking agent. • The materials were irradiated with 100 and 200 kGy using a 1.5 MeV electron beam accelerator, at room temperature in presence of air. • The better interfacial adhesion between fiber and HDPE matrix was observed for composites with GMA addition irradiated with radiation dose of 200 kGy. - Abstract: The effects of electron-beam radiation treatment on fiber-matrix adhesion and mechanical properties of short piassava fibers reinforced high density polyethylene (HDPE) matrix were studied. Glycidyl methacrylate (GMA) was added at 2.5% and 5.0% (on piassava fiber wt) as a cross-linking agent and the effects upon the properties of the resulting composites treated by electron-beam radiation were also examined. HDPE reinforced with short piassava fiber composites was prepared by melt-mixing processing, using a twin screw extruder machine. The materials were irradiated with 100 and 200 kGy using a 1.5 MeV electron beam accelerator, at room temperature in presence of air. Material samples were submitted to mechanical and thermo-mechanical tests and SEM analyses. Correlation between properties was discussed. The comparison of mechanical and thermo-mechanical properties of the composites showed that electron-beam radiation treatment produced a significant improvement in mechanical properties, when compared with the non-irradiated composite sample and neat HDPE. Scanning electron microscopy (SEM) studies of the composite failure surfaces indicated that there was an improved adhesion between fiber and matrix. Examination of the failure surfaces indicated dependence of the interfacial adhesion upon the radiation dose and GMA content. Better interfacial adhesion between fiber and HDPE matrix was observed for composites with 5.0% GMA addition and treated with electron
Energy Technology Data Exchange (ETDEWEB)
Ferreira, Maiara S.; Sartori, Mariana N.; Oliveira, Rene R. [Nuclear and Energy Research Institute, IPEN-CNEN/SP, Av. Prof. Lineu Prestes 2242, zip code 05508-000 São Paulo, SP (Brazil); Guven, Olgun [Hacettepe University, Department of Chemistry, Polymer Chemistry Division, Beytepe, zip code 06800 Ankara (Turkey); Moura, Esperidiana A.B., E-mail: eabmoura@ipen.br [Nuclear and Energy Research Institute, IPEN-CNEN/SP, Av. Prof. Lineu Prestes 2242, zip code 05508-000 São Paulo, SP (Brazil)
2014-08-15
Graphical abstract: - Highlights: • HDPE reinforced with short piassava fiber composites were prepared by melt-mixing processing. • Glycidyl methacrylate (GMA) was tested as a radiation cross-linking agent. • The materials were irradiated with 100 and 200 kGy using a 1.5 MeV electron beam accelerator, at room temperature in presence of air. • The better interfacial adhesion between fiber and HDPE matrix was observed for composites with GMA addition irradiated with radiation dose of 200 kGy. - Abstract: The effects of electron-beam radiation treatment on fiber-matrix adhesion and mechanical properties of short piassava fibers reinforced high density polyethylene (HDPE) matrix were studied. Glycidyl methacrylate (GMA) was added at 2.5% and 5.0% (on piassava fiber wt) as a cross-linking agent and the effects upon the properties of the resulting composites treated by electron-beam radiation were also examined. HDPE reinforced with short piassava fiber composites was prepared by melt-mixing processing, using a twin screw extruder machine. The materials were irradiated with 100 and 200 kGy using a 1.5 MeV electron beam accelerator, at room temperature in presence of air. Material samples were submitted to mechanical and thermo-mechanical tests and SEM analyses. Correlation between properties was discussed. The comparison of mechanical and thermo-mechanical properties of the composites showed that electron-beam radiation treatment produced a significant improvement in mechanical properties, when compared with the non-irradiated composite sample and neat HDPE. Scanning electron microscopy (SEM) studies of the composite failure surfaces indicated that there was an improved adhesion between fiber and matrix. Examination of the failure surfaces indicated dependence of the interfacial adhesion upon the radiation dose and GMA content. Better interfacial adhesion between fiber and HDPE matrix was observed for composites with 5.0% GMA addition and treated with electron
Improvement of cytocompatibility of polylactide by filling with marine algae powder
Energy Technology Data Exchange (ETDEWEB)
Wu, Tung-Yi [Department of Materials Science and Engineering, National Taiwan University of Science and Technology, Taipei 10607, Taiwan (China); Yang, Ming-Chien, E-mail: myang@mail.ntust.edu.tw [Department of Materials Science and Engineering, National Taiwan University of Science and Technology, Taipei 10607, Taiwan (China); Hsu, Yi-Chiang [Graduate Institute of Medical Science, College of Health Sciences, Chang Jung Christian University, Tainan 71101, Taiwan (China); Innovative Research Center of Medicine, College of Health Sciences, Chang Jung Christian University, Tainan 71101, Taiwan (China)
2015-05-01
This work evaluated the cytocompatibility, thermal and mechanical properties of composites of polylactide (PLA) and marine algae powder (MAP). To improve the thermal and mechanical properties of PLA–MAP composites, glycidyl methacrylate (GMA) was used as the compatibilizer for the blending of PLA and MAP. The PLA-g-GMA/MAP composites exhibited superior mechanical properties, attributing to higher compatibility between the polymer and MAP, comparing to PLA/MAP composites. The dispersion of MAP in the PLA-g-GMA matrix was highly homogeneous as a result of etherification. The lower melt torque of the PLA-g-GMA/MAP composites also made them more processable than PLA/MAP. To assess the cytocompatibility, normal human foreskin fibroblasts (FBs) were seeded onto each type of the composites. Results of FB proliferation, collagen production, and cytotoxicity assays indicated greater cytocompatibility for the PLA/MAP composites than for the PLA-g-GMA/MAP composites. Furthermore, both PLA/MAP and PLA-g-GMA/MAP composites were more cytocompatible than pure PLA. - Highlights: • PLA was grafted with GMA to form ether bond with marine algae powder (MAP). • Composites of PLA-g-GMA and MAP exhibited cytocompatibility with fibroblasts. • PLA-g-GMA/MAP composites exhibited mechanical properties superior to PLA/MAP. • PLA-g-GMA/MAP composites were more processable than PLA/MAP.
Improvement of cytocompatibility of polylactide by filling with marine algae powder
International Nuclear Information System (INIS)
Wu, Tung-Yi; Yang, Ming-Chien; Hsu, Yi-Chiang
2015-01-01
This work evaluated the cytocompatibility, thermal and mechanical properties of composites of polylactide (PLA) and marine algae powder (MAP). To improve the thermal and mechanical properties of PLA–MAP composites, glycidyl methacrylate (GMA) was used as the compatibilizer for the blending of PLA and MAP. The PLA-g-GMA/MAP composites exhibited superior mechanical properties, attributing to higher compatibility between the polymer and MAP, comparing to PLA/MAP composites. The dispersion of MAP in the PLA-g-GMA matrix was highly homogeneous as a result of etherification. The lower melt torque of the PLA-g-GMA/MAP composites also made them more processable than PLA/MAP. To assess the cytocompatibility, normal human foreskin fibroblasts (FBs) were seeded onto each type of the composites. Results of FB proliferation, collagen production, and cytotoxicity assays indicated greater cytocompatibility for the PLA/MAP composites than for the PLA-g-GMA/MAP composites. Furthermore, both PLA/MAP and PLA-g-GMA/MAP composites were more cytocompatible than pure PLA. - Highlights: • PLA was grafted with GMA to form ether bond with marine algae powder (MAP). • Composites of PLA-g-GMA and MAP exhibited cytocompatibility with fibroblasts. • PLA-g-GMA/MAP composites exhibited mechanical properties superior to PLA/MAP. • PLA-g-GMA/MAP composites were more processable than PLA/MAP
International Nuclear Information System (INIS)
Ma, Liang; Wang, Mozhen; Ge, Xuewu
2013-01-01
To improve the compatibility between ethylene-methyl acrylate-glycidyl methacrylate random terpolymer (E-MA-GMA) elastomer and poly(ethylene terephthalate) (PET), thereby enhance the toughening effect of E-MA-GMA on PET, γ-radiation-induced graft copolymerization technique was used to graft methyl acrylate (MA) monomer onto PET. The produced PET-g-PMA copolymer can be used as a self-compatibilizer in PET/E-MA-GMA blend since the copolymer contains the same segments, respectively, with PET and E-MA-GMA. The impact strength of PET/E-MA-GMA blend increased nearly by 30% in the presence of less than 0.1 wt% PET-g-PMA compared with that of the neat PET/elastomer blend, without loss of the tensile strength of the blends. This work proposed a potential application of radiation-induced grafting copolymerization technique on the in-situ compatibilization of PET/elastomer blends so as to improve the integral mechanical properties of PET based engineering plastic. - Highlights: • PMA was grafted onto PET resins by γ-ray radiation-induced copolymerization. • The obtained PET-g-PMA can improve the compatibility between PET and E-MA-GMA. • A small amount of PET-g-PMA can enhance the impact strength of PET/E-MA-GMA blend
Energy Technology Data Exchange (ETDEWEB)
Choi, Seong-Ho; Jeong, Young Han; Ryoo, Jae Jeong; Lee, Kwang-Pill [Department of Chemistry Graduate School, Kyungpook National University, Taegu (Korea)
2000-07-01
Ion-exchange membranes modified with triethylamine [-N(CH{sub 2}CH{sub 3}){sub 3}] and phosphoric acid (-PO{sub 3}H) groups were prepared by radiation-induced grafting of glycidyl methacrylate (GMA) onto polyolefin nonwavon fabric (PNF) and subsequent chemical modification of poly (GMA) graft chains. The physical and chemical properties of the GMA-grafted PNF and the PNF modified with ion-exchange groups were investigated by SEM and XPS. The ion-exchange capacities of the cation- and anion-exchange membrane were 0.20 and 1.24mmol/g, respectively. The content of cation- and anion exchange group increased with increasing grafting yield (d.g.=100%). Electrical resistance of PNF modified with TEA and -PO{sub 3}H group decreased with increasing ion-exchange group capacities. Application of the graft-type ion-exchange membranes as separators for electrodialysis enabled use to reduce the time required to achieve 85.5% desalination of the 0.5M NaCl solution. (author)
Directory of Open Access Journals (Sweden)
Arun Kumar Gupta
2012-01-01
Full Text Available The effect of surface treated sisal fiber on the mechanical, thermal, flammability, and morphological properties of sisal fiber (SF reinforced recycled polypropylene (RPP composites was investigated. The surface of sisal fiber was modified with different chemical reagent such as silane, glycidyl methacrylate (GMA, and O-hydroxybenzene diazonium chloride (OBDC to improve the compatibility with the matrix polymer. The experimental results revealed an improvement in the tensile strength to 11%, 20%, and 31.36% and impact strength to 78.72%, 77%, and 81% for silane, GMA, and OBDC treated sisal fiber reinforced recycled Polypropylene (RPP/SF composites, respectively, as compared to RPP. The thermogravimetric analysis (TGA, differential scanning calorimeter (DSC, and heat deflection temperature (HDT results revealed improved thermal stability as compared with RPP. The flammability behaviour of silane, GMA, and OBDC treated SF/RPP composites was studied by the horizontal burning rate by UL-94. The morphological analysis through scanning electron micrograph (SEM supports improves surface interaction between fiber surface and polymer matrix.
International Nuclear Information System (INIS)
Jin Gu; Yao Qizhi; Zhang Shanzi; Zhang Lei
2008-01-01
In this study, human serum albumin (HSA) was covalently immobilized onto the inner surface of microporous poly(tetrafluoroethylene) (MPTFE) capillaries for direct bilirubin removal from human plasma. To obtain active binding sites for HSA, the MPTFE capillaries were chemically functionalized by using a coating of poly(vinyl alcohol) (PVA)-glycidyl methacrylate (GMA) copolymers. Characterization of grafted MPTFE capillaries was verified by XPS, Fourier transform infrared spectroscopy (FT-IR), scanning electronic microscopy (SEM). Non-specific adsorption on the PVA-GMA coated capillary remains low (< 0.38 mg bilirubin/g), and higher affinity adsorption capacity, of up to 73.6 mg bilirubin/g polymer was obtained after HSA is immobilized. Blood compatibility of the grafted MPTFE capillary was evaluated by SEM and platelet rich plasma (PRP) contacting experiments. The experimental data on blood compatibility indicated that PVA-coated and PVA-GMA-HSA coated PTFE capillary showed a sharp suppress on platelets adhesion. The proposed method has the potential of serving in bilirubin removal in clinical application
Synthesis and evaluation of novel siloxane-methacrylate monomers used as dentin adhesives.
Ge, Xueping; Ye, Qiang; Song, Linyong; Misra, Anil; Spencer, Paulette
2014-09-01
The objectives of this study were to synthesize two new siloxane-methacrylate (SM) monomers for application in dentin adhesives and to investigate the influence of different functionality of the siloxane-containing monomers on the adhesive photopolymerization, water sorption, and mechanical properties. Two siloxane-methacrylate monomers (SM1 and SM2) with four and eight methacrylate groups were synthesized. Dentin adhesives containing BisGMA, HEMA and the siloxane-methacrylate monomers were photo-polymerized. The experimental adhesives were compared with the control adhesive (HEMA/BisGMA, 45/55, w/w) and characterized with regard to degree of conversion (DC), water miscibility of the liquid resin, water sorption and dynamic mechanical analysis (DMA). The experimental adhesives exhibited improved water miscibility as compared to the control. When cured in the presence of 12 wt% water to simulate the wet environment of the mouth, the SM-containing adhesives showed DC comparable to the control. The experimental adhesives showed higher rubbery modulus than the control under dry conditions. Under wet conditions, the mechanical properties of the formulations containing SM monomer with increased functionality were comparable with the control, even with more water sorption. The concentration and functionality of the newly synthesized siloxane-methacrylate monomers affected the water miscibility, water sorption and mechanical properties of the adhesives. The experimental adhesives show improved water compatibility compared with the control. The mechanical properties were enhanced with an increase of the functionality of the siloxane-containing monomers. The results provide critical structure/property relationships and important information for future development of durable, versatile siloxane-containing dentin adhesives. Published by Elsevier Ltd.
International Nuclear Information System (INIS)
Madrid, Jordan F.; Ueki, Yuji; Seko, Noriaki
2013-01-01
A metal ion adsorbent was developed from a nonwoven fabric trunk material composed of both natural and synthetic polymers. A pre-irradiation technique was used for emulsion grafting of glycidyl methacrylate (GMA) onto an electron beam irradiated abaca/polyester nonwoven fabric (APNWF). The dependence of degree of grafting (Dg), calculated from the weight of APNWF before and after grafting, on absorbed dose, reaction time and monomer concentration were evaluated. After 50 kGy irradiation with 2 MeV electron beam and subsequent 3 h reaction with an emulsion consisting of 5% GMA and 0.5% polyoxyethylene sorbitan monolaurate (Tween 20) surfactant in deionized water at 40 °C, a grafted APNWF with a Dg greater than 150% was obtained. The GMA-grafted APNWF was further modified by reaction with ethylenediamine (EDA) in isopropyl alcohol at 60 °C to introduce amine functional groups. After a 3 h reaction with 50% EDA, an amine group density of 2.7 mmole/gram adsorbent was achieved based from elemental analysis. Batch adsorption experiments were performed using Cu 2+ and Ni 2+ ions in aqueous solutions with initial pH of 5 at 30 °C. Results show that the adsorption capacity of the grafted adsorbent for Cu 2+ is four times higher than Ni 2+ ions. - Highlights: • An amine type adsorbent from abaca/polyester nonwoven fabric was synthesized. • Pre-irradiation method was used in grafting glycidyl methacrylate on nonwoven fabric. • Radiation-induced grafting was performed with monomer in emulsion state. • The calculated adsorption capacity for Cu 2+ is four times higher than Ni 2+ ions. • Grafted adsorbent can remove Cu 2+ faster than a chemically similar commercial resin
Wu, Sai; Du, Wang; Duan, Yiyuan; Zhang, Deteng; Liu, Yixiao; Wu, Bingbing; Zou, Xiaohui; Ouyang, Hongwei; Gao, Changyou
2018-05-30
The gradient localization of biological cues is of paramount importance to guide directional migration of cells. In this study, poly(2-hydroxyethyl methacrylate-co-glycidyl methacrylate)-block- poly(2-hydroxyethyl methacrylate) (P(HEMA-co-GMA)-b-PHEMA) brushes with a uniform underneath P(HEMA-co-GMA) layer and a gradient thickness of PHEMA blocks were prepared by using surface-initiated atom-transfer radical polymerization and a dynamically controlled polymerization process. The polymer chains were subsequently functionalized with the cell-adhesive arginine-glycine-aspartic acid (RGD) peptides by reaction with the glycidyl groups, and their structures and properties were characterized by X-ray photoelectron spectrometry (XPS), quartz crystal microbalance with dissipation (QCM-D) and air contact angle. Adhesion and migration processes of smooth muscle cells (SMCs) were then studied. Compared with those on the sufficiently exposed RGD surface, the cell adhesion and mobility were well maintained when the RGD peptides were localized at 18.9 nm depth, whereas the adhesion, spreading and migration rate of SMCs were significantly impaired when the RGD peptides were localized at a depth of 38.4 nm. On the RGD depth gradient surface, the SMCs exhibited preferential orientation and enhanced directional migration toward the direction of reduced thickness of the second PHEMA brushes. Half of the cells were oriented within ± 30° to the x-axis direction, and 72% of the cells moved directionally at the optimal conditions. Cell adhesion strength, arrangement of cytoskeleton, and gene and protein expression levels of adhesion-related proteins were studied to corroborate the mechanisms, demonstrating that the cell mobility is regulated by the complex and synergetic intracellular signals resulted from the difference in surface properties. Cell migration is of paramount importance for the processes of tissue repair and regeneration. So far, the gradient localization of
Yılmaz, Onur; Özkan, ćiǧdem Kılıçarislan; Yılmaz, Catalina N.; Yorgancıoǧlu, Ali; Özgünay, Hasan; Karavana, Hüseyin Ata
2017-12-01
Copolymers bearing reactive functional groups with controlled molecular weights are of importance since they can be used in many fields such as composites, coatings, membranes, catalysis, biology, optoelectronics, pharmaceuticals, etc. In the present study low molecular weight copolymers based on butyl acrylate (BA) and methyl methacrylate (MMA) in combination with reactive functional monomers of vinyl trietoxysilane (VTES), 3-trimetoxysilylpropyl methacrylate (TMSPMA) and glycidyl methacrylate (GMA) were synthesized via RAFT mini-emulsion technique using 2-cyano 2-propyldodecyldithiocarbonate as CTA agent. The results showed that the average molecular weights of copolymers were close to the theoretical values. On the other hand, PDI values were found to be higher than conventional RAFT polymers. The particle sizes of the latexes were small with very homogenous distributions and good stability. FTIR, H-NMR and TGA results verified the success of copolymer syntheses.
Yang, Shengchao; Ye, Fanggui; Lv, Qinghui; Zhang, Cong; Shen, Shufen; Zhao, Shulin
2014-09-19
Metal-organic framework (MOF) HKUST-1 nanoparticles have been incorporated into poly(glycidyl methacrylate-co-ethylene dimethacrylate) (HKUST-1-poly(GMA-co-EDMA)) monoliths to afford stationary phases with enhanced chromatographic performance of small molecules in the reversed phase capillary liquid chromatography. The effect of HKUST-1 nanoparticles in the polymerization mixture on the performance of the monolithic column was explored in detail. While the bare poly(GMA-co-EDMA) monolith exhibited poor resolution (RsHKUST-1 nanoparticles to the polymerization mixture provide high increased resolution (Rs≥1.3) and high efficiency ranged from 16,300 to 44,300plates/m. Chromatographic performance of HKUST-1-poly(GMA-co-EDMA) monolith was demonstrated by separation of various analytes including polycyclic aromatic hydrocarbons, ethylbenzene and styrene, phenols and aromatic acids using a binary polar mobile phase (CH3CN/H2O). The HKUST-1-poly(GMA-co-EDMA) monolith displayed enhanced hydrophobic and π-π interaction characteristics in the reversed phase separation of test analytes compared to the bare poly(GMA-co-EDMA) monolith. The experiment results showed that HKUST-1-poly(GMA-co-EDMA) monoliths are an alternative to enhance the chromatographic separation of small molecules. Copyright © 2014 Elsevier B.V. All rights reserved.
Photodegradable neutral-cationic brush block copolymers for nonviral gene delivery.
Hu, Xianglong; Li, Yang; Liu, Tao; Zhang, Guoying; Liu, Shiyong
2014-08-01
We report on the fabrication of a photodegradable gene-delivery vector based on PEO-b-P(GMA-g-PDMAEMA) neutral-cationic brush block copolymers that possess cationic poly(N,N-dimethylaminoethyl methacrylate) (PDMAEMA) brushes for DNA compaction, poly(ethylene oxide) (PEO) as a hydrophilic block, and poly(glycidyl methacrylate) (PGMA) as the backbone. The PEO-b-P(GMA-g-PDMAEMA) copolymers were synthesized through the combination of reversible addition-fragmentation transfer (RAFT) polymerization and postmodification. A photocleavable PEO-based macroRAFT agent was first synthesized; next, the PEO-b-PGMA block copolymer was prepared by RAFT polymerization of GMA; this was followed by a click reaction to introduce the RAFT initiators on the side chains of the PGMA block; then, RAFT polymerization of DMAEMA afforded the PEO-b-P(GMA-g-PDMAEMA) copolymer. The obtained neutral-cationic brush block copolymer could effectively complex plasmid DNA (pDNA) into nanoparticles at an N/P ratio (i.e., the number of nitrogen residues per DNA phosphate) of 4. Upon UV irradiation, pDNA could be released owing to cleavage of the pDNA-binding cationic PDMAEMA side chains as well as the nitrobenzyl ester linkages at the diblock junction point. In addition, in vitro gene transfection results demonstrated that the polyplexes could be effectively internalized by cells with good transfection efficiency, and the UV irradiation protocol could considerably enhance the efficiency of gene transfection. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Structure/property relationships in methacrylate/dimethacrylate polymers for dental applications
Mehlem, Jeremy John
Since its invention Bis-GMA or one of its analogs has been the main component of the polymer portion of composites for dental restorations. The need for dilution of Bis-GMA and its analogs to optimize its properties has long been recognized. Bis-GMA is a highly viscous monomer. This high viscosity leads to early vitrification, which limits conversion during cure. This viscosity also limits filler loading. Vitrification at low conversions leads to heterogeneous systems composed of low and high cross-link density phases. The low cross-link density phases behave as defects in the system; therefore, if the amount of low cross-link density phases in the system can be reduced and a more uniform network structure can be achieved, then the mechanical properties of the resin can be improved. Since the increase in viscosity during cure causes vitrification, it is logical that a system with a low initial viscosity will delay the onset of vitrification. Reactive diluents such as triethylene glycol dimethacrylate (TEGDMA) are effective at lower levels. However, large amounts negatively affect matrix properties by increasing polymerization shrinkage and water sorption. Shrinkage has been cited as one of the main deficiencies in dental composites. The goal of this project is to improve upon standard viscosity modifying comonomers such as triethylene glycol dimethacrylate. The comonomers that were explored were phenyloxyethyl methacrylate, cyclohexyl methacrylate, and tert-butylcylcohexyl methacrylate. Multicomponent systems based on analogs of ethylene glycol dimethacrylates with different length ethyl glycol chains were also examined. The substitution of monomethacrylates for TEGDMA as a comonomer resulted in enhanced or negligible affects on the mechanical properties of Bis-MEPP based polymer systems while reducing polymerization shrinkage. 129Xenon NMR and TappingMode(TM) AFM were used to characterize the heterogeneity of dimethacrylates systems during their cure cycle as well
Abbadessa, A; Blokzijl, M M; Mouser, V H M; Marica, P; Malda, J; Hennink, W E; Vermonden, T
2016-09-20
The aim of this study was to design a hydrogel system based on methacrylated chondroitin sulfate (CSMA) and a thermo-sensitive poly(N-(2-hydroxypropyl) methacrylamide-mono/dilactate)-polyethylene glycol triblock copolymer (M15P10) as a suitable material for additive manufacturing of scaffolds. CSMA was synthesized by reaction of chondroitin sulfate with glycidyl methacrylate (GMA) in dimethylsulfoxide at 50°C and its degree of methacrylation was tunable up to 48.5%, by changing reaction time and GMA feed. Unlike polymer solutions composed of CSMA alone (20% w/w), mixtures based on 2% w/w of CSMA and 18% of M15P10 showed strain-softening, thermo-sensitive and shear-thinning properties more pronounced than those found for polymer solutions based on M15P10 alone. Additionally, they displayed a yield stress of 19.2±7.0Pa. The 3D printing of this hydrogel resulted in the generation of constructs with tailorable porosity and good handling properties. Finally, embedded chondrogenic cells remained viable and proliferating over a culture period of 6days. The hydrogel described herein represents a promising biomaterial for cartilage 3D printing applications. Copyright © 2016 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Marinović Sanja R.
2014-01-01
Full Text Available Macroporous nanocomposite of poly (glycidyl methacrylate-co-ethylene glycol dimethacrylate and acid modified bentonite was prepared by radical suspension copolymerization. Nanocomposite was functionalized with diethylene triamine (deta, by ring-opening reaction of the pendant epoxy groups. Functionalization was performed in order to enable phenol derivatives sorption. This new, not sufficiently investigated material, with developed porous structure was denoted CP-SA-deta. In this study, the influence of temperature on 4-nitrophenol (4NP sorption on CP-SA-deta was investigated. The chemisorption was estimated as dominant process since activation energy of sorption of 4NP of 54.8 kJ mol-1 was obtained. After determining the optimal sorption conditions for 4NP, the sorption of 2-nitrophenol (2NP and 2-chloro 4-nitrophenol (2Cl4NP on CP-SA-deta was investigated with respect to pH, initial concentration and contact time. The 2NP sorption was seldom tested, while according to our knowledge, the 2Cl4NP sorption was not investigated. The isotherm data were best fitted with Langmuir model, while the sorption dynamics obeyed the pseudo-second-order kinetic model for all derivatives. [Projekat Ministarstva nauke Republike Srbije, br. III 45001 i br. III 43009
Chambers, Stuart D.; Holcombe, Thomas W.; Švec, František; Frechet, Jean
2011-01-01
been prepared and their chromatographic performance have been tested for the separation of small molecules in the reversed phase. While addition of the C60-fullerene monomer to the glycidyl methacrylate-based monolith enhanced column efficiency 18-fold
Controlled grafting of vinylic monomers on polyolefins: a robust mathematical modeling approach.
Saeb, Mohammad Reza; Rezaee, Babak; Shadman, Alireza; Formela, Krzysztof; Ahmadi, Zahed; Hemmati, Farkhondeh; Kermaniyan, Tayebeh Sadat; Mohammadi, Yousef
2017-01-01
Experimental and mathematical modeling analyses were used for controlling melt free-radical grafting of vinylic monomers on polyolefins and, thereby, reducing the disturbance of undesired cross-linking of polyolefins. Response surface, desirability function, and artificial intelligence methodologies were blended to modeling/optimization of grafting reaction in terms of vinylic monomer content, peroxide initiator concentration, and melt-processing time. An in-house code was developed based on artificial neural network that learns and mimics processing torque and grafting of glycidyl methacrylate (GMA) typical vinylic monomer on high-density polyethylene (HDPE). Application of response surface and desirability function enabled concurrent optimization of processing torque and GMA grafting on HDPE, through which we quantified for the first time competition between parallel reactions taking place during melt processing: (i) desirable grafting of GMA on HDPE; (ii) undesirable cross-linking of HDPE. The proposed robust mathematical modeling approach can precisely learn the behavior of grafting reaction of vinylic monomers on polyolefins and be placed into practice in finding exact operating condition needed for efficient grafting of reactive monomers on polyolefins.
Ezaki, Naofumi; Watanabe, Yoshifumi; Mori, Hideharu
2015-10-27
As surfactants for preparation of nonaqueous microcapsule dispersions by the emulsion solvent evaporation method, three copolymers composed of stearyl methacrylate (SMA) and glycidyl methacrylate (GMA) with different monomer sequences (i.e., random, block, and block-random) were synthesized by reversible addition-fragmentation chain transfer (RAFT) polymerization. Despite having the same comonomer composition, the copolymers exhibited different functionality as surfactants for creating emulsions with respective dispersed and continuous phases consisting of methanol and isoparaffin solvent. The optimal monomer sequence for the surfactant was determined based on the droplet sizes and the stabilities of the emulsions created using these copolymers. The block-random copolymer led to an emulsion with better stability than obtained using the random copolymer and a smaller droplet size than achieved with the block copolymer. Modification of the epoxy group of the GMA unit by diethanolamine (DEA) further decreased the droplet size, leading to higher stability of the emulsion. The DEA-modified block-random copolymer gave rise to nonaqueous microcapsule dispersions after evaporation of methanol from the emulsions containing colored dyes in their dispersed phases. These dispersions exhibited high stability, and the particle sizes were small enough for application to the inkjet printing process.
Nocca, G; De Palma, F; Minucci, A; De Sole, P; Martorana, G E; Callà, C; Morlacchi, C; Gozzo, M L; Gambarini, G; Chimenti, C; Giardina, B; Lupi, A
2007-03-01
Methacrylic compounds such as 2-hydroxyethyl methacrylate (HEMA), triethylene glycol dimethacrylate (TEGDMA) and bisphenol A glycerolate (1 glycerol/phenol) dimethacrylate (Bis-GMA) are largely present in auto- or photopolymerizable composite resins. Since the polymerization reaction is never complete, these molecules are released into the oral cavity tissues and biological fluids where they could cause local adverse effects. The aim of this work was to verify the hypothesis that the biological effects of HEMA, TEGDMA and Bis-GMA - at a non-cytotoxic concentration - depend on the interaction with mitochondria and exert consequent alterations of energy metabolism, GSH levels and the related pathways in human promyelocytic cell line (HL-60). The biological effects of methacrylic monomers were determined by analyzing the following parameters: GSH concentration, glucose-6-phosphate dehydrogenase (G6PDH) and glutathione reductase (GR) activity, oxygen and glucose consumption and lactate production along with cell differentiation and proliferation. All monomers induced both cellular differentiation and decrease in oxygen consumption. Cells treated with TEGDMA and Bis-GMA showed a significant enhancement of glucose consumption and lactate production. TEGDMA and HEMA induced GSH depletion stimulating G6PDH and GR activity. All the monomers under study affect the metabolism of HL-60 cells and show differentiating activity. Since alterations in cellular metabolism occurred at compound concentrations well below cytotoxic levels, the changes in energy metabolism and glutathione redox balance could be considered as potential mechanisms for inducing clinical and sub-clinical adverse effects and thus providing useful parameters when testing biocompatibility of dental materials.
Chambers, Stuart D.
2011-12-15
Monolithic poly(glycidyl methacrylate-co-ethylene dimethacrylate) and poly(butyl methacrylate-co-ethylene dimethacrylate) capillary columns, which incorporate the new monomer [6,6]-phenyl-C 61-butyric acid 2-hydroxyethyl methacrylate ester, have been prepared and their chromatographic performance have been tested for the separation of small molecules in the reversed phase. While addition of the C60-fullerene monomer to the glycidyl methacrylate-based monolith enhanced column efficiency 18-fold, to 85 000 plates/m at a linear velocity of 0.46 mm/s and a retention factor of 2.6, when compared to the parent monolith, the use of butyl methacrylate together with the carbon nanostructured monomer afforded monolithic columns with an efficiency for benzene exceeding 110 000 plates/m at a linear velocity of 0.32 mm/s and a retention factor of 4.2. This high efficiency is unprecedented for separations using porous polymer monoliths operating in an isocratic mode. Optimization of the chromatographic parameters affords near baseline separation of 6 alkylbenzenes in 3 min with an efficiency of 64 000 plates/m. The presence of 1 wt % or more of water in the polymerization mixture has a large effect on both the formation and reproducibility of the monoliths. Other factors such as nitrogen exposure, polymerization conditions, capillary filling method, and sonication parameters were all found to be important in producing highly efficient and reproducible monoliths. © 2011 American Chemical Society.
Zhang, Weizhou; Wang, Kai; Yan, Wei; Guo, Weihong
2017-10-01
New toughened poly(butylene terephthalate) (PBT)/poly(ethylene terephthalate) (PET) (40/60 wt%) blends were obtained by melting with Glycidyl methacrylate grafted poly(ethylene octane) copolymer (POE-g-GMA), varying the POE-g-GMA content up to 20 wt%, in a twin-screw extruder, followed by injection molding. The influence of POE-g-GMA on the properties of the PBT/PET blends was investigated by mechanical testing, Fourier transform infrared (FT-IR) analysis, gel fractions analysis, dynamic mechanical analysis (DMA), differential scanning calorimetry (DSC) and scanning electronic microscopy (SEM). The mechanical testing results indicated that the incorporation of POE-g-GMA led to increases in the notched impact strength and decreases in the tensile strength, flexural strength, and flexural modulus. When POE-g-GMA content reached 20 wt%, the notched impact strength (8.0 kJ m-2) was achieved for the PBT/PET/POE-g-GMA blends. FT-IR results proved that some PBT/PET/POE-g-GMA copolymers were produced, which improved the compatibility between POE-g-GMA and the PBT/PET matrix. The extent of crosslinking was observed by gel fraction measurements. DMA results further testified chain-extending and micro-crosslink reactions occurred between POE-g-GMA and PBT/PET blends. In addition, the reactions induced by POE-g-GMA affected the crystallization behavior of PBT/PET blends obviously, as observed from DSC results. By means of SEM observation of the impact fracture surface morphology, and the discussion of the micro-crosslink reaction process between the epoxide-containing elastomers and PBT/PET matrix, the toughening mechanism was proposed to be taken into account the shear yielding of PBT/PET matrix and cavitation of elastomer particles.
Energy Technology Data Exchange (ETDEWEB)
Neti, Venkata S. [Chemical; Das, Sadananda [Chemical; Brown, Suree [Department; Janke, Christopher J. [Materials; Kuo, Li-Jung [Marine; Gill, Gary A. [Marine; Dai, Sheng [Chemical; Department; Mayes, Richard T. [Chemical
2017-09-14
Brush-on-brush structures are proposed as one method to overcome support effects in grafted polymers. Utilizing glycidyl methacrylate (GMA) grafted on polyethylene (PE) fibers using radiation-induced graft polymerization (RIGP) provides a hydrophilic surface on the hydrophobic PE. When integrated with atom transfer radical polymerization (ATRP), the grafting of acrylonitrile (AN) and hydroxyethyl acrylate (HEA) can be controlled and manipulated more easily than with RIGP. Poly(acrylonitrile)-co-poly(hydroxyethyl acrylate) chains were grown via ATRP on PE-GMA fibers to generate an adsorbent for the extraction of uranium from seawater. The prepared adsorbents in this study demonstrated promise (159.9 g- U/kg of adsorbent) in laboratory screening tests using a high uranium concentration brine and 1.24 g-U/Kg of adsorbent in the filtered natural seawater in 21-days. The modest capacity in 21- days exceeds previous efforts to generate brush-on-brush adsorbents by ATRP while manipulating the apparent surface hydrophilicity of the trunk material (PE).
Energy Technology Data Exchange (ETDEWEB)
Choi, Seong-Ho; Han Jeong, Young; Jeong Ryoo, Jae; Lee, Kwang-Pill E-mail: kplee@kyungpook.ac.kr
2001-07-01
Ion-exchange membranes modified with the triethylamine [-N(CH{sub 2}CH{sub 3}){sub 3}] and phosphoric acid (-PO{sub 3} H) groups were prepared by radiation-induced grafting of glycidyl methacrylate (GMA) onto the polyolefin nonwavon fabric (PNF) and subsequent chemical modification of poly(GMA) graft chains. The physical and chemical properties of the GMA-grafted PNF and the PNF modified with ion-exchange groups were investigated by SEM, XPS, TGA, and DSC. Furthermore, electrochemical properties such as specific electric resistance, transport number of K{sup +}, and desalination were examined. The grafting yield increased with increasing reaction time and reaction temperature. The maximum grafting yield was obtained with 40% (vol.%) monomer concentration in dioxane at 60 deg. C. The content of the cation- and anion-exchange group increased with increasing grafting yield. Electrical resistance of the PNF modified with TEA and -PO{sub 3} H group decreased, while the water uptake (%) increased with increasing ion-exchange group capacities. Transport number of the PNF modified with ion-exchange group were the range of ca. 0.82-0.92. The graft-type ion-exchange membranes prepared by radiation-induced graft copolymerization were successfully applied as separators for electrodialysis. (author)
Directory of Open Access Journals (Sweden)
Sidan Tian
2016-06-01
Full Text Available The development of novel theranostic nanovectors is of particular interest in treating formidable diseases (e.g., cancers. Herein, we report a new tumor-targetable theranostic agent based on core crosslinked (CCL micelles, possessing tumor targetable moieties and fluorescence and magnetic resonance (MR dual imaging modalities. An azide-terminated diblock copolymer, N3-POEGMA-b-P(DPA-co-GMA, was synthesized via consecutive atom transfer radical polymerization (ATRP, where OEGMA, DPA, and GMA are oligo(ethylene glycolmethyl ether methacrylate, 2-(diisopropylaminoethyl methacrylate, and glycidyl methacrylate, respectively. The resulting diblock copolymer was further functionalized with DOTA(Gd (DOTA is 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetrakisacetic acid or benzaldehyde moieties via copper(I-catalyzed alkyne-azide cycloaddition (CuAAC chemistry, resulting in the formation of DOTA(Gd-POEGMA-b-P(DPA-co-GMA and benzaldehyde-POEGMA-b-P(DPA-co-GMA copolymers. The resultant block copolymers co-assembled into mixed micelles at neutral pH in the presence of tetrakis[4-(2-mercaptoethoxyphenyl]ethylene (TPE-4SH, which underwent spontaneous crosslinking reactions with GMA residues embedded within the micellar cores, simultaneously switching on TPE fluorescence due to the restriction of intramolecular rotation. Moreover, camptothecin (CPT was encapsulated into the crosslinked cores at neutral pH, and tumor-targeting pH low insertion peptide (pHLIP, sequence: AEQNPIYWARYADWLFTTPLLLLDLALLVDADEGTCG moieties were attached to the coronas through the Schiff base chemistry, yielding a theranostic nanovector with fluorescence and MR dual imaging modalities and tumor-targeting capability. The nanovectors can be efficiently taken up by A549 cells, as monitored by TPE fluorescence. After internalization, intracellular acidic pH triggered the release of loaded CPT, killing cancer cells in a selective manner. On the other hand, the nanovectors labeled with DOTA
Salmi, Zakaria; Benzarti, Karim; Chehimi, Mohamed M
2013-11-05
We describe a simple, off-the-beaten-path strategy for making clay/polymer nanocomposites through tandem diazonium salt interface chemistry and radical photopolymerization. Prior to photopolymerization, sodium montmorillonite (MMT) was ion exchanged with N,N'-dimethylbenzenediazonium cation (DMA) from the tetrafluoroborate salt precursor. DMA acts as a hydrogen donor for benzophenone in solution; this pair of co-initiators permits us to photopolymerize glycidyl methacrylate (GMA) between the lamellae of the diazonium-modified clay, therefore providing intercalated MMT-PGMA nanocomposites with an onset of exfoliation. This work conclusively provides a new approach for bridging reactive and functional polymers to layered nanomaterials via aryl diazonium salts in a simple, fast, efficient cation-exchange approach.
Supertoughened renewable PLA reactive multiphase blends system: phase morphology and performance.
Zhang, Kunyu; Nagarajan, Vidhya; Misra, Manjusri; Mohanty, Amar K
2014-08-13
Multiphase blends of poly(lactic acid) (PLA), ethylene-methyl acrylate-glycidyl methacrylate (EMA-GMA) terpolymer, and a series of renewable poly(ether-b-amide) elastomeric copolymer (PEBA) were fabricated through reactive melt blending in an effort to improve the toughness of the PLA. Supertoughened PLA blend showing impact strength of ∼500 J/m with partial break impact behavior was achieved at an optimized blending ratio of 70 wt % PLA, 20 wt % EMA-GMA, and 10 wt % PEBA. Miscibility and thermal behavior of the binary blends PLA/PEBA and PLA/EMA-GMA, and the multiphase blends were also investigated through differential scanning calorimetric (DSC) and dynamic mechanical analysis (DMA). Phase morphology and fracture surface morphology of the blends were studied through scanning electron microscopy (SEM) and atomic force microscopy (AFM) to understand the strong corelation between the morphology and its significant effect on imparting tremendous improvement in toughness. A unique "multiple stacked structure" with partial encapsulation of EMA-GMA and PEBA minor phases was observed for the PLA/EMA-GMA/PEBA (70/20/10) revealing the importance of particular blend composition in enhancing the toughness. Toughening mechanism behind the supertoughened PLA blends have been established by studying the impact fractured surface morphology at different zones of fracture. Synergistic effect of good interfacial adhesion and interfacial cavitations followed by massive shear yielding of the matrix was believed to contribute to the enormous toughening effect observed in these multiphase blends.
International Nuclear Information System (INIS)
Shin, Boo Young; Kim, Jae Hong
2015-01-01
Polyamide (PA6) has been modified by electron-beam initiated mediator process to improve drawbacks of PA6. Glycidyl methacrylate (GMA) was chosen as a reactive mediator for modification process of PA6. The mixture of the PA6 and GMA was prepared by using a twin-screw extruder, and then the mixture was exposed to electron-beam irradiation at various doses at room temperature. The modified PA6 were characterized by observing rheological and mechanical properties and compared virgin PA6. Thermal properties, water absorption, and gel fraction were also investigated. Tight gel was not found even when PA6 was irradiated at 200 kGy. Complex viscosity and storage modulus of PA6 were remarkably increased by electron-beam irradiation with medium of GMA. Maximum increase in complex viscosity was 75 times higher than virgin PA6 at 0.1 rad/s when it was irradiated at 200 kGy with the GMA. Mechanical properties were also improved without scarifying of processability. The reaction mechanisms for the mediation process with the reactive mediator of GMA were estimated to elucidate the cause of significantly enhanced rheological and mechanical properties without loss of thermoplasticity. - Highlights: • PA6 was modified by the electron-beam initiated mediation process. • Maximum increase in complex viscosity of modified PA6 was 75 times higher than virgin PA6 at 0.1 rad/s. • Mechanical properties were improved without scarifying of processability. • The GMA as a mediator played a key role in the electron-beam initiated mediation process
Institute of Scientific and Technical Information of China (English)
杨晓林; 黄建龙; 高保娇; 门吉英
2015-01-01
以甲基丙烯酸缩水甘油酯(GMA)和甲基丙烯酸甲酯(MMA)的交联共聚微球 GMA/MMA 为基质,经过几步大分子反应在微球表面合成与固载了 N-羟基邻苯二甲酰亚胺(NHPI),形成固载有 NHPI 的聚合物微球GMA/MMA-NHPI。将 GMA/MMA-NHPI 与 Co(OAc)2组成共催化体系,用于分子氧氧化苯甲醇的反应过程。研究结果表明,GMA/MMA-NHPI与Co(OAc)2所构成的共催化体系在温和条件(65℃和常压氧气)下可有效地实现苯甲醇的分子氧氧化过程,将其深度氧化为苯甲酸,显示出较好的催化活性和高的选择性(苯甲酸的选择性为96%)。主催化剂GMA/MMA-NHPI固载的NHPI与助催化剂Co(OAc)2适宜的摩尔比为20:1;主催化剂所含NHPI的摩尔分数为底物的10%时催化剂的用量比较适宜。固体催化剂GMA/MMA-NHPI还具有良好的再循环使用性能。%Crosslinked polymeric microspheres GMA/MMA of glycidyl methacrylate (GMA) and methyl methacrylate (MMA) were prepared, and then N-hydroxyphthalimide (NHPI) was synthesized and immobilized on GMA/MMA microspheres through several polymer reaction steps, resulting in the functionalized microspheres GMA/MMA-NHPI. The solid catalyst GMA/MMA-NHPI in combination with Co(OAc)2 was used in aerobic oxidation of benzyl alcohol. Experimental results showed that the composite catalyst consisting of GMA/MMA-NHPI and Co(OAc)2 could effectively catalyze aerobic oxidation of benzyl alcohol by molecular oxygen under mild conditions (65℃ and normal pressure). Benzyl alcohol was deeply oxidized to benzoic acid. Although benzyl alcohol conversion rate was not very high, catalytic activity was satisfactory and benzoic acid selectivity was as high as 96%. The appropriate molar ratio of immobilized NHPI on GMA/MMA-NHPI microspheres to Co(OAc)2 was 20:1, and the appropriate amount of GMA/MMA-NHPI was 10% (mol) of the substrate. The solid catalyst GMA/MMA-NHPI microspheres showed good recycling and reusing
Preparation of Laccase Immobilized Cryogels and Usage for Decolorization
Directory of Open Access Journals (Sweden)
Murat Uygun
2013-01-01
Full Text Available Poly(methyl methacrylate-co-glycidyl methacrylate (poly(MMA-co-GMA cryogels were synthesized by radical cryopolymerization technique. Then, laccase enzyme was covalently attached to the cryogel and characterized by using swelling studies and SEM and EDX analyses. Kinetic properties and optimum conditions of the immobilized and free laccase were studied and it was found that of the immobilized laccase was lower than that of free laccase. of the immobilized laccase was increased upon immobilization. Optimum pH was found to be 4.0 for each type of laccase, while optimum temperature was shifted to the warmer region after the immobilization. It was also found that thermal stability of the immobilized laccase was higher than that of free laccase. Immobilized laccase could be used for 10 times successive reuse with no significant decrease in its activity. Also, these laccase immobilized cryogels were successfully used for the decolorization of seven different dyes.
Precisely printable and biocompatible silk fibroin bioink for digital light processing 3D printing.
Kim, Soon Hee; Yeon, Yeung Kyu; Lee, Jung Min; Chao, Janet Ren; Lee, Young Jin; Seo, Ye Been; Sultan, Md Tipu; Lee, Ok Joo; Lee, Ji Seung; Yoon, Sung-Il; Hong, In-Sun; Khang, Gilson; Lee, Sang Jin; Yoo, James J; Park, Chan Hum
2018-04-24
Although three-dimensional (3D) bioprinting technology has gained much attention in the field of tissue engineering, there are still several significant engineering challenges to overcome, including lack of bioink with biocompatibility and printability. Here, we show a bioink created from silk fibroin (SF) for digital light processing (DLP) 3D bioprinting in tissue engineering applications. The SF-based bioink (Sil-MA) was produced by a methacrylation process using glycidyl methacrylate (GMA) during the fabrication of SF solution. The mechanical and rheological properties of Sil-MA hydrogel proved to be outstanding in experimental testing and can be modulated by varying the Sil-MA contents. This Sil-MA bioink allowed us to build highly complex organ structures, including the heart, vessel, brain, trachea and ear with excellent structural stability and reliable biocompatibility. Sil-MA bioink is well-suited for use in DLP printing process and could be applied to tissue and organ engineering depending on the specific biological requirements.
Wang, Xiaoyan; Zhou, Zuoming; Jing, Guohua
2013-02-01
Magnetic poly(styrene-glycidyl methacrylate) porous microspheres (MPPM) with high magnetic contents were prepared by surfactant reverse micelles and emulsion polymerization of monomers, in which the well-dispersed Fe(3)O(4) nanoparticles were modified by polyethylene glycol (PEG) and oleic acid (OA) respectively. The characterizations showed that both of the OA-MPPM and the PEG-MPPM were ferromagnetic, however, the OA-MPPM was used to immobilize the bacteria for more advantages. Therefore, the effects of monomer ratio, surfactant, crosslinker and amount of Fe(3)O(4) on the structure, morphology and magnetic contents of the OA-MPPM were investigated. Then, the OA-MPPM was utilized to immobilize Klebsiella sp. FD-3, an iron-reducing bacterium for Fe(III)EDTA reduction applied in NO(x) removal. Compared with free bacteria, the immobilized FD-3 showed a better tolerance to the unbeneficial pH and temperature conditions. Copyright © 2012 Elsevier Ltd. All rights reserved.
Effect of modified polypropylene on the interfacial bonding of polymer–aluminum laminated films
International Nuclear Information System (INIS)
Liang, Chang-Sheng; Lv, Zhong-Fei; Bo, Yang; Cui, Jia-Yang; Xu, Shi-Ai
2015-01-01
Highlights: • Aluminium-polymer composite packing material with high T-peel strength was prepared. • Polypropylene was grafted by acrylic acid, glycidyl methacrylate, maleic anhydride. • Grafted polypropylene greatly improved the T-peel strength. • Chemical bonding plays an important role in improving the adhesion strength. - Abstract: The interfacial bonding between functionalized polymers and chromate–phosphate treated aluminum (Al) foil were investigated in this study. Glycidyl methacrylate (GMA), acrylic acid (AA) and maleic anhydride (MAH) were grafted onto polypropylene (PP) to improve its adhesion strength with the treated Al foil. The interfacial peel strength was evaluated by the T-peel test, and the results showed that modification of PP resulted in a significant improvement in the interfacial peel strength from 1 N/15 mm for pure PP to 10–14 N/15 mm for the modified PP. The surface chemistry, topography and surface energy of the modified PP and Al foil after peeling were characterized by time-of-flight secondary ion mass spectrometry (TOF-SIMS), X-ray photoelectron spectroscopy (XPS), attenuated total reflectance Fourier transform infrared spectroscopy (ATR-FTIR), scanning electron microscopy (SEM) and contact angle measurement. The treated Al foil could react with the functional groups of PP, resulting in the formation of new carboxylates. The new chemical bonding rather than the mechanical interlocking contributed to the improvement of adhesion strength
Radiation synthesis of biocompatible hydrogels of dextran methacrylate
Szafulera, Kamila; Wach, Radosław A.; Olejnik, Alicja K.; Rosiak, Janusz M.; Ulański, Piotr
2018-01-01
The aim of this work was to synthesize biocompatible dextran-based hydrogels through crosslinking initiated by ionizing radiation. A series of derivatives of dextran has been synthesized by coupling of methacrylated glycidyl to the structure of this polysaccharide, yielding dextran methacrylate (Dex-MA) of the degree of methacrylate substitution (DS) up to 1.13 as characterised by FTIR and NMR spectroscopy. Chemically crosslinked hydrogels were formed by electron-beam irradiation of Dex-MA in aqueous solution in the absence of low-molecular-weight additives such as catalysts, monomers or crosslinking agents. Crosslinking of Dex-MA in aqueous solutions of 20 g/l and above was an efficient process, the gels were formed at doses as low as 0.5 kGy (experiments conducted up to 100 kGy) and were characterised by high content of insoluble fraction (70-100%). Due to high crosslinking density the equilibrium degree of swelling of fabricated gels was controlled principally by the initial concentration of Dex-MA solution subjected to irradiation, and it was in the range of 20 to over 100 g of water absorbed by gram of gel. Cytocompatibility of hydrogels was examined using XTT assay through evaluation of the cell viability being in indirect contact with hydrogels. The results indicated that hydrogels of Dex-MA of the average DS below 1 were not cytotoxic. Altogether, our data demonstrate that irradiation of methacrylated dextran in aqueous solution is an efficient method of fabrication of biocompatible hydrogels, which applications in regeneration medicine are anticipated.
Synthesis and Characterization of Core-Shell Acrylate Based Latex and Study of Its Reactive Blends
Directory of Open Access Journals (Sweden)
Ying Nie
2008-03-01
Full Text Available Techniques in resin blending are simple and efficient method for improving the properties of polymers, and have been used widely in polymer modification field. However, polymer latex blends such as the combination of latexes, especially the latexes with water-soluble polymers, were rarely reported. Here, we report a core-shell composite latex synthesized using methyl methacrylate (MMA, butyl acrylate (BA, 2-ethylhexyl acrylate (EHA and glycidyl methacrylate (GMA as monomers and ammonium persulfate and sodium bisulfite redox system as the initiator. Two stages seeded semi-continuous emulsion polymerization were employed for constructing a core-shell structure with P(MMA-co-BA component as the core and P(EHA-co-GMA component as the shell. Results of Transmission Electron Microscopy (TEM and Dynamics Light Scattering (DLS tests confirmed that the particles obtained are indeed possessing a desired core-shell structural character. Stable reactive latex blends were prepared by adding the latex with waterborne melamine-formaldehyde resin (MF or urea-formaldehyde resin (UF. It was found that the glass transition temperature, the mechanical strength and the hygroscopic property of films cast from the latex blends present marked enhancements under higher thermal treatment temperature. It was revealed that the physical properties of chemically reactive latexes with core-shell structure could be altered via the change of crosslinking density both from the addition of crosslinkers and the thermal treatment.
Thermal and Mechanical Properties of Poly(butylene succinate Films Reinforced with Silica
Directory of Open Access Journals (Sweden)
Sangviroon Nanthaporn
2015-01-01
Full Text Available In recent year, bioplastics have become more popular resulting from the growing concerns on environmental issues and the rising fossil fuel price. However, their applications were limited by its mechanical and thermal properties. The aim of this research is thus to improve mechanical and thermal properties of PBS bioplastic films by reinforcing with silica. Due to the poor interfacial interaction between the PBS matrix and silica, glycidyl methacrylate grafted poly(butylene succinate (PBS-g-GMA was used as a compatibilizer in order to improve the interaction between bioplastic films and filler. PBS-g-GMA was prepared in a twin-screw extruder and analyzed by the FTIR spectrometer. PBS and silica were then mixed in a twin-screw extruder and processed into films by a chill-roll cast extruder. The effects of silica loading on thermal and mechanical properties of the prepared bioplastic films were investigated. It was found that the mechanical properties of PBS/silica composite films were improved when 1%wt of silica was added. However, the mechanical properties decreased with increasing silica loading due to the agglomeration of silica particles. The results also show that the silica/PBS films with PBS-g-GMA possessed improved mechanical properties over the films without the compatibilizer.
Madrid, Jordan F.; Ueki, Yuji; Seko, Noriaki
2013-09-01
A metal ion adsorbent was developed from a nonwoven fabric trunk material composed of both natural and synthetic polymers. A pre-irradiation technique was used for emulsion grafting of glycidyl methacrylate (GMA) onto an electron beam irradiated abaca/polyester nonwoven fabric (APNWF). The dependence of degree of grafting (Dg), calculated from the weight of APNWF before and after grafting, on absorbed dose, reaction time and monomer concentration were evaluated. After 50 kGy irradiation with 2 MeV electron beam and subsequent 3 h reaction with an emulsion consisting of 5% GMA and 0.5% polyoxyethylene sorbitan monolaurate (Tween 20) surfactant in deionized water at 40 °C, a grafted APNWF with a Dg greater than 150% was obtained. The GMA-grafted APNWF was further modified by reaction with ethylenediamine (EDA) in isopropyl alcohol at 60 °C to introduce amine functional groups. After a 3 h reaction with 50% EDA, an amine group density of 2.7 mmole/gram adsorbent was achieved based from elemental analysis. Batch adsorption experiments were performed using Cu2+ and Ni2+ ions in aqueous solutions with initial pH of 5 at 30 °C. Results show that the adsorption capacity of the grafted adsorbent for Cu2+ is four times higher than Ni2+ ions.
Guo, Jialiang; Xiao, Yuan; Lin, Yuanjing; Zhang, Qiaoxuan; Chang, Yiqun; Crommen, Jacques; Jiang, Zhengjin
2016-05-15
In order to investigate the effect of the linking spacer on the enantioseparation ability of β-cyclodextrin (β-CD) functionalized polymeric monoliths, three β-CD-functionalized organic polymeric monoliths with different spacer lengths were prepared by using three amino-β-CDs, i.e. mono-6-amino-6-deoxy-β-CD, mono-6-ethylenediamine-6-deoxy-β-CD, mono-6-hexamethylenediamine-6-deoxy-β-CD, as starting materials. These amino-β-CDs reacted with glycidyl methacrylate to produce functional monomers which were then copolymerized with ethylene dimethacrylate. The enantioseparation ability of the three monoliths was evaluated using 14 chiral acidic compounds, including mandelic acid derivatives, nonsteroidal anti-inflammatory drugs, N-derivatized amino acids, and chiral herbicides under optimum chromatographic conditions. Notably, the poly(GMA-NH2-β-CD-co-EDMA) column provides higher enantioresolution and enantioselectivity than the poly(GMA-EDA-β-CD-co-EDMA) and poly(GMA-HDA-β-CD-co-EDMA) columns for most tested chiral analytes. Furthermore, the enantioseparation performance of triazole-linker containing monoliths was compared to that of ethylenediamine-linker containing monoliths. The results indicate that the enantioselectivity of β-CD monolithic columns is strongly related to the length and type of spacer tethering β-CD to the polymeric support. Copyright © 2016 Elsevier B.V. All rights reserved.
Correlating cytotoxicity to elution behaviors of composite resins in term of curing kinetic.
Meng, Junquan; Yang, Huichuan; Cao, Man; Li, Lei; Cai, Qing
2017-09-01
Cytotoxicity of photocurable composite resins is a key issue for their safe use in dental restoration. Curing kinetic and elution behaviors of the composite resin would have decisive effects on its cytotoxicity. In this study, composite resins composed of bisphenol-glycidyl dimethacrylate (Bis-GMA), triethyleneglycol dimethacrylate (TEGDMA), camphorquinone (CQ), N,N-dimethylaminoethyl methacrylate (DMAEMA) and barium glass powders were prepared by setting the photoinitiators CQ/DMAEMA at 0.5wt%, 1wt% or 3wt% of the total weight of Bis-GMA/TEGDMA. The ratio of Bis-GMA/TEGDMA was 6:4, the ratio of CQ/DMAEMA was 1:1, and the incorporated inorganic powder was 75wt%. Then, curing kinetics were studied by using real-time Fourier transform infrared spectroscopy (FTIR) and photo-DSC (differential scanning calorimeter). Elution behaviors in both ethanol solution and deionized water were monitored by using liquid chromatogram/mass spectrometry (LC/MS). Cytotoxicity was evaluated by in vitro culture of L929 fibroblasts. Finally, they were all analyzed and correlated in terms of initiator contents. It was found that the commonly used 0.5wt% of photoinitiators was somewhat insufficient in obtaining composite resin with low cytotoxicity. Copyright © 2017. Published by Elsevier B.V.
Radiation synthesis of biocompatible hydrogels of dextran methacrylate
International Nuclear Information System (INIS)
Szafulera, Kamila; Wach, Radosław A.; Olejnik, Alicja K.; Rosiak, Janusz M.; Ulański, Piotr
2018-01-01
The aim of this work was to synthesize biocompatible dextran-based hydrogels through crosslinking initiated by ionizing radiation. A series of derivatives of dextran has been synthesized by coupling of methacrylated glycidyl to the structure of this polysaccharide, yielding dextran methacrylate (Dex-MA) of the degree of methacrylate substitution (DS) up to 1.13 as characterised by FTIR and NMR spectroscopy. Chemically crosslinked hydrogels were formed by electron-beam irradiation of Dex-MA in aqueous solution in the absence of low-molecular-weight additives such as catalysts, monomers or crosslinking agents. Crosslinking of Dex-MA in aqueous solutions of 20 g/l and above was an efficient process, the gels were formed at doses as low as 0.5 kGy (experiments conducted up to 100 kGy) and were characterised by high content of insoluble fraction (70–100%). Due to high crosslinking density the equilibrium degree of swelling of fabricated gels was controlled principally by the initial concentration of Dex-MA solution subjected to irradiation, and it was in the range of 20 to over 100 g of water absorbed by gram of gel. Cytocompatibility of hydrogels was examined using XTT assay through evaluation of the cell viability being in indirect contact with hydrogels. The results indicated that hydrogels of Dex-MA of the average DS below 1 were not cytotoxic. Altogether, our data demonstrate that irradiation of methacrylated dextran in aqueous solution is an efficient method of fabrication of biocompatible hydrogels, which applications in regeneration medicine are anticipated. - Highlights: • Synthesis of dextran methacrylate with various degrees of substitutions. • Synthesis of dextran-based hydrogels through radiation technique. • Gel faction (GF) and equilibrium degree of swelling (EDS) study. • Cytocompatibility of Dex-MA hydrogels demonstrated (XTT test).
Energy Technology Data Exchange (ETDEWEB)
Devi, Rashmi R; Maji, Tarun K., E-mail: tkm@tezu.ernet.in [Department of Chemical Sciences, Tezpur University, Assam, (India)
2013-11-01
This study concerns the preparation and characterization of wood polymer nanocomposites based on impregnation of styrene acrylonitrile co-polymer-nanoclay intercalating system in presence of glycidyl methacrylate (GMA), a cross linking agent, and vinyl trichloro silane (VTCS) as additives into Simul (Bombex ceiba, L.), a soft wood. The effect of nanoclay and VTCS on the properties of the resultant wood polymer nanocomposites (WPNC) has been evaluated. FTIR spectroscopy shows the interaction among wood, polymers, GMA, nanoclay and VTCS. The penetration of polymer and nanoclay into the wood cell wall is supported by SEM study. The distribution of nanoclay in the SAN polymer matrix present within the wood cell wall has been evidenced by TEM study. TGA results show an improvement in the thermostability of the resultant composites. The inclusion of VTCS enhances the self extinguishing behaviour of the WPNC as revealed by limiting oxygen index (LOI) test. Due to treatment, the resultant WPNC exhibits an improvement in all the properties like water repellency, dimensional stability, hardness, flexural, tensile and thermal stability compared to untreated wood. (author)
Preparation of Sr adsorptive fiber by impregnating with crown ether derivative for 90Sr measurement
International Nuclear Information System (INIS)
Horita, Takuma; Asai, Shiho; Hanzawa, Yukiko; Kitatsuji, Yoshihiro; Konda, Miki; Saito, Kyoichi; Fujiwara, Kunio; Sugo, Takanobu
2017-01-01
A Sr adsorption fiber was prepared for rapid analysis of 90 Sr content in the fiber using radiation-induced emulsion graft polymerization and subsequent chemical modification. A polyethylene fiber with a diameter of 13 μm was first immersed in a methanol solution of an epoxy-group-containing vinyl monomer, glycidyl methacrylate (GMA), and polyoxyethylene sorbitol ester (Tween20) as a surfactant for the graft-polymerization of GMA. Octadecylamine was then bound to a polymer chain extending from the fiber surface, providing hydrophobicity to the polymer chain. Dicyclohexano-18-crown-6 (DCH18C6) was finally impregnated onto the polymer chain via a hydrophobic interaction between the octadecyl moiety of the polymer chain and the cyclohexyl moiety of DCH18C6. The fiber surface structure, characterized by DCH18C6 molecules loosely entangled with polymer chains, allowed for the rapid adsorption of Sr ions at an adsorption rate of approximately 100-times higher than that of a commercially available Sr-selective resin (Sr Resin ® ). (author)
International Nuclear Information System (INIS)
Devi, Rashmi R; Maji, Tarun K.
2013-01-01
This study concerns the preparation and characterization of wood polymer nanocomposites based on impregnation of styrene acrylonitrile co-polymer–nanoclay intercalating system in presence of glycidyl methacrylate (GMA), a cross linking agent, and vinyl trichloro silane (VTCS) as additives into Simul (Bombex ceiba, L.), a soft wood. The effect of nanoclay and VTCS on the properties of the resultant wood polymer nanocomposites (WPNC) has been evaluated. FTIR spectroscopy shows the interaction among wood, polymers, GMA, nanoclay and VTCS. The penetration of polymer and nanoclay into the wood cell wall is supported by SEM study. The distribution of nanoclay in the SAN polymer matrix present within the wood cell wall has been evidenced by TEM study. TGA results show an improvement in the thermostability of the resultant composites. The inclusion of VTCS enhances the self extinguishing behaviour of the WPNC as revealed by limiting oxygen index (LOI) test. Due to treatment, the resultant WPNC exhibits an improvement in all the properties like water repellency, dimensional stability, hardness, flexural, tensile and thermal stability compared to untreated wood. (author)
The internalization of fluorescence-labeled PLA nanoparticles by macrophages.
Li, Fengjuan; Zhu, Aiping; Song, Xiaoli; Ji, Lijun; Wang, Juan
2013-09-10
Rhodamine B (RhB)-labeled PLA nanoparticles were prepared through surface grafting copolymerization of glycidyl methacrylate (GMA) onto PLA nanoparticles during the emulsion/evaporation process. RhB firstly interacts with sodium dodecyl sulfate (SDS) through electrostatic interaction to form hydrophobic complex (SDS-RhB). Due to the high-affinity of SDS-RhB with GMA, hydrophilic RhB can be successfully combined into PLA nanoparticles. The internalization of RhB-labeled PLA nanoparticles by macrophages was investigated with fluorescence microscope technology. The effects of the PLA nanoparticle surface nature and size on the internalization were investigated. The results indicate that the PLA particles smaller than 200 nm can avoid the uptake of phagocytosis. The bigger PLA particles (300 nm) with polyethylene glycol (PEG) surface showed less internalization by macrophage compared with those with poly(ethylene oxide-propylene oxide) copolymer (F127) or poly(vinyl alcohol) (PVA) surface. The "stealth" function of PEG on the PLA nanoparticles from internalization of macrophages due to the low protein adsorption is revealed by electrochemical impedance technology. Copyright © 2013 Elsevier B.V. All rights reserved.
Allylthioketone Mediated Free Radical Polymerization of Methacrylates
Directory of Open Access Journals (Sweden)
Feng Zhong
2017-11-01
Full Text Available By combination of high trapping free radical efficiency of the thioketone and resonance of the allylic radical, a new type of mediating agent, 1,3,3-triphenylprop-2-ene-1-thione (TPPT has been successfully synthesized, and then is used to study controlled free radical polymerization of methacrylates. Very stable TPPT radicals at the end of poly(methyl methacrylate (PMMA are detected in the polymerization of MMA using TPPT and AIBN as the control agent and initiator. The MALDI-TOF MS spectra are used to identify terminal groups of the resultant poly(glycidyl methacrylate (PGMA, and major component of the obtained polymer has the structure, (CH32(CNC-PGMA-C7H9O3. Chain extension reaction tests ascertain formation of the dead polymers during the polymer storage and purification process of the polymers. Owing to very slow fragmentation reaction of the TPPT-terminated polymethacrylate radical and addition reaction of this radical with a primary radical, the growing chain radicals are difficult to be regenerated, leading to an unobvious change of the molecular weight with monomer conversion. The molecular weights of polymers can be controlled by the ratios of monomer/initiator and TPPT/initiator. However, the first order kinetics of the polymerization and the polymers with narrow polydispersity are obtained, and these phenomena are discussed. This study provides useful information on how to design a better controlling agent.
International Nuclear Information System (INIS)
Cavalcanti, Shirley N.; Melo, Tomas J.A. de; Araujo, Edcleide M.; Oliveira, Akidauana D.A.; Lima, Jessica C.C.
2011-01-01
The aim of this study is to evaluate the influence of ethylene/methyl acrylate (EMA) and ethylene/glycidyl methacrylate (E-GMA) copolymers and organoclay on the mechanical properties of polymer PLA-poly (lactic acid), from the system PLA / organoclay. The clay was organophilized with the ionic surfactant praepagem and the mixtures were prepared in a modular twin screw extruder. The behavior of bionanocomposites was evaluated by tensile and impact tests. The results of FTIR and DR-X indicated that the process was efficient organophilization. The mechanical properties showed that the elastic modulus and tensile strength of bionanocomposites obtained decreased compared to PLA. On the other hand there was a gain for resistance to impact, for all systems except for system PLA/OMMT. (author)
Bayramoglu, Gulay; Tekinay, Turgay; Ozalp, V Cengiz; Arica, M Yakup
2015-05-15
Lysozyme is an important polypetide used in medical and food applications. We report a novel magnetic strong cation exchange beads for efficient purification of lysozyme from chicken egg white. Magnetic chitosan (MCHT) beads were synthesized via phase inversion method, and then grafted with poly(glycidyl methacrylate) (p(GMA)) via the surface-initiated atom transfer radical polymerization (SI-ATRP). Epoxy groups of the grafted polymer, were modified into strong cation-exchange groups (i.e., sulfonate groups) in the presence of sodium sulfite. The MCTH and MCTH-g-p(GMA)-SO3H beads were characterized by ATR-FTIR, SEM, and VSM. The sulphonate groups content of the modified MCTH-g-p(GMA)-4 beads was found to be 0.53mmolg(-1) of beads by the potentiometric titration method. The MCTH-g-p(GMA)-SO3H beads were first used as an ion-exchange support for adsorption of lysozyme from aqueous solution. The influence of different experimental parameters such as pH, contact time, and temperature on the adsorption process was evaluated. The maximum adsorption capacity was found to be 208.7mgg(-1) beads. Adsorption of lysozyme on the MCTH-g-p(GMA)-SO3H beads fitted to Langmuir isotherm model and followed the pseudo second-order kinetic. More than 93% of the adsorbed lysozyme was desorbed using Na2CO3 solution (pH 11.0). The purity of the lysozyme was checked by HPLC and SDS gel electrophoresis. In addition, the MCTH-g-p(GMA)-SO3H beads prepared in this work showed promising potential for separation of various anionic molecules. Copyright © 2015 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Shin, Boo Young; Han, Do Hung
2014-01-01
The aim of this study was to compatibilize immiscible polyamide 6 (PA6)/linear low density polyethylene (LLDPE) blend by using electron-beam initiated mediation process. Glycidyl methacrylate (GMA) was chosen as a mediator for cross-copolymerization at the interface between PA6 and LLDPE. The exposure process was carried out to initiate cross-copolymerization by the medium of GMA at the interface between PA and LLDPE. The mixture of the PA6/LLDPE/GMA was prepared by using a twin-screw extruder, and then the mixture was exposed to electron-beam radiation at various doses at room temperature. To investigate the results of this compatibilization strategy, the morphological and mechanical properties of the blend were analyzed. Morphology study revealed that the diameters of the dispersion particles decreased and the interfacial adhesion increased with respect to irradiation doses. The elongation at break of the blends increases significantly with increasing irradiation dose up to 100 kGy while the tensile strength and the modulus increased nonlinearly with increasing irradiation dose. The reaction mechanisms of the mediation process with the GMA mediator at the interface between PA6 and LLDPE were estimated. - Highlights: • PA6/LLDPE blend was compatibilized by the electron-beam initiated mediation process. • Interfacial adhesion was significantly enhanced by the radiation initiated cross-copolymerization. • The elongation at break of blend irradiated at 100 kGy was 4 times higher than PA6. • The GMA as a mediator played a key role in the electron-beam initiated mediation process
Hsieh, Yi-Ho; Shen, Bo-Yuan; Wang, Yao-Horng; Lin, Bojain; Lee, Hung-Maan; Hsieh, Ming-Fa
2018-04-09
Articular cartilage is a structure lack of vascular distribution. Once the cartilage is injured or diseased, it is unable to regenerate by itself. Surgical treatments do not effectively heal defects in articular cartilage. Tissue engineering is the most potential solution to this problem. In this study, methoxy poly(ethylene glycol)-block-poly(ε-caprolactone) (mPEG-PCL) and hydroxyapatite at a weight ratio of 2:1 were mixed via fused deposition modeling (FDM) layer by layer to form a solid scaffold. The scaffolds were further infiltrated with glycidyl methacrylate hyaluronic acid loading with 10 ng/mL of Transforming Growth Factor-β1 and photo cross-linked on top of the scaffolds. An in vivo test was performed on the knees of Lanyu miniature pigs for a period of 12 months. The healing process of the osteochondral defects was followed by computer tomography (CT). The defect was fully covered with regenerated tissues in the control pig, while different tissues were grown in the defect of knee of the experimental pig. In the gross anatomy of the cross section, the scaffold remained in the subchondral location, while surface cartilage was regenerated. The cross section of the knees of both the control and experimental pigs were subjected to hematoxylin and eosin staining. The cartilage of the knee in the experimental pig was partially matured, e.g., few chondrocyte cells were enclosed in the lacunae. In the knee of the control pig, the defect was fully grown with fibrocartilage. In another in vivo experiment in a rabbit and a pig, the composite of the TGF-β1-loaded hydrogel and scaffolds was found to regenerate hyaline cartilage. However, scaffolds that remain in the subchondral lesion potentially delay the healing process. Therefore, the structural design of the scaffold should be reconsidered to match the regeneration process of both cartilage and subchondral bone.
Directory of Open Access Journals (Sweden)
Yi-Ho Hsieh
2018-04-01
Full Text Available Articular cartilage is a structure lack of vascular distribution. Once the cartilage is injured or diseased, it is unable to regenerate by itself. Surgical treatments do not effectively heal defects in articular cartilage. Tissue engineering is the most potential solution to this problem. In this study, methoxy poly(ethylene glycol-block-poly(ε-caprolactone (mPEG-PCL and hydroxyapatite at a weight ratio of 2:1 were mixed via fused deposition modeling (FDM layer by layer to form a solid scaffold. The scaffolds were further infiltrated with glycidyl methacrylate hyaluronic acid loading with 10 ng/mL of Transforming Growth Factor-β1 and photo cross-linked on top of the scaffolds. An in vivo test was performed on the knees of Lanyu miniature pigs for a period of 12 months. The healing process of the osteochondral defects was followed by computer tomography (CT. The defect was fully covered with regenerated tissues in the control pig, while different tissues were grown in the defect of knee of the experimental pig. In the gross anatomy of the cross section, the scaffold remained in the subchondral location, while surface cartilage was regenerated. The cross section of the knees of both the control and experimental pigs were subjected to hematoxylin and eosin staining. The cartilage of the knee in the experimental pig was partially matured, e.g., few chondrocyte cells were enclosed in the lacunae. In the knee of the control pig, the defect was fully grown with fibrocartilage. In another in vivo experiment in a rabbit and a pig, the composite of the TGF-β1-loaded hydrogel and scaffolds was found to regenerate hyaline cartilage. However, scaffolds that remain in the subchondral lesion potentially delay the healing process. Therefore, the structural design of the scaffold should be reconsidered to match the regeneration process of both cartilage and subchondral bone.
International Nuclear Information System (INIS)
Horak, Daniel; Rittich, Bohuslav; Spanova, Alena
2007-01-01
Magnetite nanoparticles about 14nm in diameter were obtained by chemical coprecipitation of Fe(II) and Fe(III) salts with aqueous ammonia in the presence of poly(ethylene glycol) (PEG). Magnetic poly(glycidyl methacrylate) (PGMA) microspheres about 1μm in diameter were prepared by dispersion polymerization of GMA in aqueous ethanol in the presence of PEG-coated magnetite nanoparticles. The microspheres were hydrolyzed and carboxyl groups introduced by oxidation with KMnO 4 . The particles reversibly bound bacterial DNA of Bifidobacterium and Lactobacillus genera in the presence of high concentrations of PEG 6000 and sodium chloride from crude cell lysates of various dairy products (butter milk, cheese, yoghurt, probiotic tablets) or from cell lyophilisates. The presence of Bifidobacterium and Lactobacillus DNA in samples was confirmed by PCR amplification
Energy Technology Data Exchange (ETDEWEB)
Horak, Daniel [Institute of Macromolecular Chemistry, Academy of Sciences of the Czech Republic, Heyrovskeho Sq. 2, 162 06 Prague 6 (Czech Republic)]. E-mail: horak@imc.cas.cz; Rittich, Bohuslav [Masaryk University Brno, Tvrdeho 14, 602 00 Brno (Czech Republic)]. E-mail: rittich@sci.muni.cz; Spanova, Alena [Masaryk University Brno, Tvrdeho 14, 602 00 Brno (Czech Republic)]. E-mail: spanova@sci.muni.cz
2007-04-15
Magnetite nanoparticles about 14nm in diameter were obtained by chemical coprecipitation of Fe(II) and Fe(III) salts with aqueous ammonia in the presence of poly(ethylene glycol) (PEG). Magnetic poly(glycidyl methacrylate) (PGMA) microspheres about 1{mu}m in diameter were prepared by dispersion polymerization of GMA in aqueous ethanol in the presence of PEG-coated magnetite nanoparticles. The microspheres were hydrolyzed and carboxyl groups introduced by oxidation with KMnO{sub 4}. The particles reversibly bound bacterial DNA of Bifidobacterium and Lactobacillus genera in the presence of high concentrations of PEG 6000 and sodium chloride from crude cell lysates of various dairy products (butter milk, cheese, yoghurt, probiotic tablets) or from cell lyophilisates. The presence of Bifidobacterium and Lactobacillus DNA in samples was confirmed by PCR amplification.
Ueki, Yuji; Chandra Dafader, Nirmal; Hoshina, Hiroyuki; Seko, Noriaki; Tamada, Masao
2012-07-01
Radiation-induced graft polymerization of glycidyl methacrylate (GMA) onto non-woven polyethylene (NWPE) fabric was achieved under normal pressure and air atmospheric conditions, without using unique apparatus such as glass ampoules or vacuum lines. To attain graft polymerization under normal pressure and air atmospheric conditions, the effects of the pre-irradiation dose, pre-irradiation atmosphere, pre-irradiation temperature, de-aeration of GMA-emulsion, grafting atmosphere in a reactor, and dissolved oxygen (DO) concentration in GMA-emulsion on the degree of grafting (Dg) were investigated in detail. It was found that the DO concentration had the strongest influence, the pre-irradiation dose, de-aeration of emulsion and grafting atmosphere had a relatively strong impact, and the pre-irradiation atmosphere and pre-irradiation temperature had the least effect on Dg. The optimum DO concentration before grafting was 2.0 mg/L or less. When a polyethylene bottle was used as a reactor instead of a glass ampoule, graft polymerization under normal pressure and air atmospheric conditions could be achieved under the following conditions; the pre-irradiation dose was more than 50 kGy, the volume ratio of GMA-emulsion to air was 50:1 or less, and the DO concentration in GMA-emulsion during grafting was below 2.0 mg/L. Under these grafting conditions, Dg was controlled within a range of up to 362%. The prepared GMA-grafted NWPE (GMA-g-NWPE) fabric was modified with a phosphoric acid to obtain an adsorbent for heavy metal ions. In the column-mode adsorption tests of Pb(II), the adsorption performance of the produced phosphorylated GMA-g-NWPE fabric (fibrous metal adsorbent) was not essentially dependent on the flow rate of the feed. The breakthrough points of 200, 500, and 1000 h-1 in space velocity were 483, 477 and 462 bed volumes, and the breakthrough capacities of the three flow rates were 1.16, 1.15 and 1.16 mmol-Pb(II)/g-adsorbent.
Song, Shixin; Xia, Shan; Jiang, Shangkun; Lv, Xue; Sun, Shulin; Li, Quanming
2018-01-01
A facile strategy is adopted to prepare carboxylic functionalized multiwalled carbon nanotube (c-MWCNT) modified high dielectric constant (high-k) poly(vinylidene fluoride) (PVDF) composites with the aid of methyl methacrylate-co-glycidyl methacrylate copolymer (MG). The MG is miscible with PVDF and the epoxy groups of the copolymer can react with the carboxylic groups of c-MWCNT, which induce the uniform dispersion of c-MWCNT and a form insulator layer on the surface of c-MWCNT. The c-MWCNTs/MG/PVDF composites with 8 vol % c-MWCNT present excellent dielectric properties with high dielectric constant (~448) and low dielectric loss (~2.36) at the frequency of 1 KHz, the dielectric loss is much lower than the c-MWCNT/PVDF composites without MG. The obvious improvement in dielectric properties ascribes to the existence of MG, which impede the direct contact of c-MWCNTs and PVDF and avoid the formation of conductive network. Therefore, we propose a practical and simple strategy for preparing composites with excellent dielectric properties, which are promising for applications in electronics devices. PMID:29495491
Energy Technology Data Exchange (ETDEWEB)
Rehman, Fozia, E-mail: fozia@iqm.unicamp.br [Institute of Chemistry, University of Campinas, UNICAMP, P.O. Box 6154, 13084-971 Campinas, SP (Brazil); Interdisciplinary Research Centre in Biomedical Materials (IRCBM), COMSATS Institute of Information Technology, Lahore (Pakistan); Rahim, Abdur [Interdisciplinary Research Centre in Biomedical Materials (IRCBM), COMSATS Institute of Information Technology, Lahore (Pakistan); Airoldi, Claudio; Volpe, Pedro L.O. [Institute of Chemistry, University of Campinas, UNICAMP, P.O. Box 6154, 13084-971 Campinas, SP (Brazil)
2016-02-01
Mesoporous silica SBA-15 was synthesized and functionalized with bridged polysilsesquioxane monomers obtained by the reaction of 3-aminopropyltriethoxy silane with glycidyl methacrylate in 2:1 ratio. The synthesized mesoporous silica materials were characterized by elemental analysis, infrared spectroscopy, nuclear magnetic resonance spectroscopy, nitrogen adsorption, X-ray diffraction, thermogravimetry and scanning electron microscopy. The nuclear magnetic resonance in the solid state is in agreement with the sequence of carbon distributed in the attached organic chains, as expected for organically functionalized mesoporous silica. After functionalization with organic bridges the BET surface area was reduced from 1311.80 to 494.2 m{sup 2} g{sup −1} and pore volume was reduced from 1.98 to 0.89 cm{sup 3} g{sup −1}, when compared to original precursor silica. Modification of the silica surface with organic bridges resulted in high loading capacity and controlled release of ibuprofen and mesalamine in biological fluids. The Korsmeyer–Peppas model better fits the release data indicating Fickian diffusion and zero order kinetics for synthesized mesoporous silica. The drug release rate from the modified silica was slow in simulated gastric fluid, (pH 1.2) where less than 10% of mesalamine and ibuprofen were released in initial 8 h, while comparatively high release rates were observed in simulated intestinal (pH 6.8) and simulated body fluids (pH 7.2). The preferential release of mesalamine at intestinal pH suggests that the modified silica could be a simple, efficient, inexpensive and convenient carrier for colon targeted drugs, such a mesalamine and also as a controlled drug release system. - Highlights: • Modified SBA-15 silica with long hydrophobic chains was evaluated as drug carrier. • This silica showed improved loading capacity and controlled release of ibuprofen. • Compared to gastric pH high release rate of mesalamine was observed at colonic pH.
International Nuclear Information System (INIS)
Rehman, Fozia; Rahim, Abdur; Airoldi, Claudio; Volpe, Pedro L.O.
2016-01-01
Mesoporous silica SBA-15 was synthesized and functionalized with bridged polysilsesquioxane monomers obtained by the reaction of 3-aminopropyltriethoxy silane with glycidyl methacrylate in 2:1 ratio. The synthesized mesoporous silica materials were characterized by elemental analysis, infrared spectroscopy, nuclear magnetic resonance spectroscopy, nitrogen adsorption, X-ray diffraction, thermogravimetry and scanning electron microscopy. The nuclear magnetic resonance in the solid state is in agreement with the sequence of carbon distributed in the attached organic chains, as expected for organically functionalized mesoporous silica. After functionalization with organic bridges the BET surface area was reduced from 1311.80 to 494.2 m 2 g −1 and pore volume was reduced from 1.98 to 0.89 cm 3 g −1 , when compared to original precursor silica. Modification of the silica surface with organic bridges resulted in high loading capacity and controlled release of ibuprofen and mesalamine in biological fluids. The Korsmeyer–Peppas model better fits the release data indicating Fickian diffusion and zero order kinetics for synthesized mesoporous silica. The drug release rate from the modified silica was slow in simulated gastric fluid, (pH 1.2) where less than 10% of mesalamine and ibuprofen were released in initial 8 h, while comparatively high release rates were observed in simulated intestinal (pH 6.8) and simulated body fluids (pH 7.2). The preferential release of mesalamine at intestinal pH suggests that the modified silica could be a simple, efficient, inexpensive and convenient carrier for colon targeted drugs, such a mesalamine and also as a controlled drug release system. - Highlights: • Modified SBA-15 silica with long hydrophobic chains was evaluated as drug carrier. • This silica showed improved loading capacity and controlled release of ibuprofen. • Compared to gastric pH high release rate of mesalamine was observed at colonic pH. • Modified silica
Directory of Open Access Journals (Sweden)
Maya Grigorievna Lyapina
2016-06-01
Full Text Available Background: A multitude of methacrylic monomers is used in dentistry. Glutaraldehyde (G is used in dental practice and consumer products as a broad-spectrum antimicrobial agent. The purpose of our study is to evaluate the frequency and the risk of concomitant sensitization to some methacrylic monomers (methyl methacrylate (MMA, triethyleneglycol dimethacrylate (TEGDMA, ethyleneglycol dimethacrylate (EGDMA, 2,2-bis-[4-(2-hydroxy-3-methacrylo-xypropoxyphenyl]-propane (Bis-GMA, 2-hydroxy-ethyl methacrylate (2-HEMA and tetrahydrofurfuryl methacrylate (THFMA and glutaraldehyde in students of dentistry, students from the dental technician school, dental professionals and dental patients. Material and Methods: A total of 262 participants were included in the study: students of dentistry, students from the dental technician school, dental professionals, and dental patients as a control group. All were patch-tested with methacrylic monomers and glutaraldehyde. The results were subject to the statistical analysis (p < 0.05. Results: Among the group of dental students, the highest frequency of concomitant sensitization was to TEGDMA and G (15.5%. In the group of patients the highest frequency of concomitant sensitization was to EGDMA and G (16.4%. The frequency of concomitant sensitization among dental professionals was much lower, with the highest rate to TEGDMA and G (7.7%, too. We consider the students from the dental technician school, where the exposure to glutaraldehyde is less likely, to be the group at a lesser risk of concomitant sensitization. Conclusions: Dental students and dental patients could be outlined as groups at the risk of concomitant sensitization to glutaraldehyde and methacrylic monomers. For dental professionals, we assumed an increased risk for concomitant sensitization to TEGDMA and aldehydes that are commonly used in dentistry. We consider the students from the dental technician school to be the group at a lesser risk of
Energy Technology Data Exchange (ETDEWEB)
Sabarudin, Akhmad, E-mail: sabarjpn@ub.ac.id [Division of Nano-materials Science, EcoTopia Science Institute, Nagoya University, Furu-Cho, Chikusa-Ku, Nagoya 464-8603 (Japan); Department of Chemistry, Faculty of Science, Brawijaya University, Jl Veteran Malang 65145 (Indonesia); Huang, Junchao; Shu, Shin; Sakagawa, Shinnosuke [Division of Nano-materials Science, EcoTopia Science Institute, Nagoya University, Furu-Cho, Chikusa-Ku, Nagoya 464-8603 (Japan); Umemura, Tomonari, E-mail: umemura@apchem.nagoya-u.ac.jp [Division of Nano-materials Science, EcoTopia Science Institute, Nagoya University, Furu-Cho, Chikusa-Ku, Nagoya 464-8603 (Japan)
2012-07-29
Highlights: Black-Right-Pointing-Pointer Microbore-scale (1 mm i.d.) anion-exchange monolithic column. Black-Right-Pointing-Pointer Potentially preparative applications. Black-Right-Pointing-Pointer Separation of oligodeoxythymidylic acids and DNA fragments. - Abstract: In this paper, we report on the preparation of a microbore-scale (1 mm i.d.) anion-exchange monolithic column suitable not only for analytical purposes but also for potentially preparative applications. In order to meet the conflicting requirements of high permeability and good mechanical strength, the following two-step procedure was applied. First, an epoxy-containing monolith was synthesized by in situ copolymerization of glycidyl methacrylate (GMA) and ethylene dimethacrylate (EDMA) within the confines of a silicosteel tubing of 1.02 mm i.d. and 1/16 Double-Prime o.d. in the presence of a ternary porogenic mixture of 1-propanol, 1,4-butanediol, and water. The monolithic matrix was subsequently converted into weak anion-exchanger via the ring-opening reaction of epoxy group with diethyl amine. The dynamic binding capacity was 21.4 mg mL{sup -1} for bovine serum albumin (BSA) at 10% breakthrough. The morphology and porous structure of this monolith were assessed by scanning electron microscope (SEM) and inverse size exclusion chromatography (ISEC). To optimize the separation efficiency, the effects of various chromatographic parameters upon the separation of DNA fragments were investigated. The resulting monolithic anion exchanger demonstrated good potential for the separation of both single- and double-stranded DNA molecules using a gradient elution with NaCl in Tris-HCl buffer (20 mM). Oligodeoxythymidylic acids (dT{sub 12}-dT{sub 18}) were successfully resolved at pH 8, while the fragments of 20 bp DNA ladder, 100 bp DNA ladder, and pBR322-HaeIII digest were efficiently separated at pH 9.
Ma, Yanli; He, Ling; Jia, Mengjun; Zhao, Lingru; Zuo, Yanyan; Hu, Pingan
2017-08-15
Three polysiloxane/epoxy hybrids obtained by evolving cage- or linear-structured polysiloxane into poly glycidyl methacrylate (PGMA) matrix are compared used as coatings. One is the cage-structured hybrid of P(GMA/MA-POSS) copolymer obtained by GMA and methacrylisobutyl polyhedral oligomeric silsesquioxane (MA-POSS) via free radical polymerization, the other two are PGMA/NH 2 -POSS and PGMA/NH 2 -PDMS hybrids by cage-structured aminopropyllsobutyl POSS (NH 2 -POSS) or linear-structured diamino terminated poly(dimethylsiloxane) (NH 2 -PDMS) to cure PGMA. The effect of MA-POSS, NH 2 -POSS and NH 2 -PDMS on polysiloxane/epoxy hybrid films is characterized according to their surface morphology, transparency, permeability, adhesive strength and thermo-mechanical properties. Due to caged POSS tending to agglomerate onto the film surface, P(GMA/MA-POSS) and PGMA/NH 2 -POSS films exhibit much more heterogeneous surfaces than PGMA/NH 2 -PDMS film, but the well-compatibility between epoxy matrix and MA-POSS has provided P(GMA/MA-POSS) film with much higher transmittance (98%) than PGMA/NH 2 -POSS film (24%), PGMA/NH 2 -PDMS film (27%) and traditional epoxy resin film (5%). The introduction of polysiloxane into epoxy matrix is confirmed to create hybrids with strong adhesive strength (526-1113N) and high thermos-stability (T g =262-282°C), especially the cage-structured P(GMA/MA-POSS) hybrid (1113N and 282°C), but the flexible PDMS improves PGMA/NH 2 -PDMS hybrid with much higher storage modulus (519MPa) than PGMA/NH 2 -POSS (271MPa), which suggests that PDMS is advantage in improving the film stiffness than POSS cages. However, cage-structured P(GMA/MA-POSS) and PGMA/NH 2 -POSS indicate higher permeability than PGMA/NH 2 -PDMS and traditional epoxy resin. Comparatively, the cage-structured P(GMA/MA-POSS) hybrid is the best coating in transparency, permeability, adhesive strength and thermostability, but linear-structured PGMA/NH 2 -PDMS hybrid behaviors the best coating in
Directory of Open Access Journals (Sweden)
Alejandra Del Valle
2010-05-01
Full Text Available The catalytic activity of diphenylzinc as initiator in the ring opening polymerization of glycidyl methacrylate (GMA and propylene sulfide (PS was analyzed. Diphenylzinc exhibited high activity as initiator in the polymerization of both monomers. The yields and the molecular weights of the obtained polymers depend strongly of the structure of the monomer. The spectroscopic analysis of PMAG show that the substituent group in the monomer influenced strongly the reaction mechanism, suggesting it reaction could be happening through a anionic polymerization mechanism through of the double bond C=C of the substituent group and not by means of the polymerization by opening of the oxiranic ring of the MAG. Ring-opening Polymerization of PS happen and structural analysis by means of 13C-NMR indicate that this polymerization is few selective respect to the opening type (α or β.
Building a robust distributed system: some lessons from R-GMA
International Nuclear Information System (INIS)
Bhatti, P; Duncan, A; Fisher, S M; Jiang, M; Kuseju, A O; Paventhan, A; Wilson, A J
2008-01-01
R-GMA, as deployed by LCG, is a large distributed system. We are currently addressing some design issues to make it highly reliable, and fault tolerant. In validating the new design, there were two classes of problems to consider: one related to the flow of data and the other to the loss of control messages. R-GMA streams data from one place to another; there is a need to consider the behaviour when data is being inserted more rapidly into the system than taken out and more generally how to deal with bottlenecks. In the original R-GMA design the system tried hard to deliver all control messages; those messages that were not delivered quickly were queued for retry later. Badly configured firewalls, network problems or very slow machines could all lead to long queues of messages; many of the messages on the queue should have been replaced by later ones. In the new design no individual control message is critical; the system just needs to know if each message was received successfully. The system should also avoid single points of failure. However this can require complex code resulting in a system that is actually less reliable. We describe how we have dealt with bottlenecks in the flow of data, loss of control messages and the elimination of single points of failure to produce a robust R-GMA design. The work presented, though in the context of R-GMA, is applicable to any large distributed system
International Nuclear Information System (INIS)
Yesil, Sertan
2013-01-01
Highlights: • Mechanical properties of r-PET improved with addition of PEN, elastomers and CNT. • Elastomer size and dispersion played important role in the variation of properties. • Selective localization of CNT affected the mechanical and electrical properties. • E-EA-MAH based samples had higher mechanical properties than E-MA-GMA based ones. - Abstract: In this study, the mechanical, thermomechanical, thermal, electrical properties and the morphology of the composites, based on blends of recycled poly(ethylene terephthalate) (r-PET) and poly(ethylene naphthalate) (PEN) that were mixed with functional elastomers and multi walled carbon nanotube (CNT) were investigated. Two types of functional elastomers; terpolymer of ethylene–ethyl acrylate–maleic anhydride (E-EA-MAH) and terpolymer of ethylene–methyl acrylate–glycidyl methacrylate (E-MA-GMA), were used to ensure the miscibility between PET and PEN during the preparation of the blends and composites. All composite and blend samples were extruded by using a laboratory scale twin screw microcompounder. Test samples were prepared via laboratory scale injection molding machine. According to the results of the thermomechanical tests, usage of both elastomers enhanced the miscibility between r-PET and PEN. Morphological analyses showed that the blends and composites which contain E-EA-MAH exhibited better elastomer phase dispersion with smaller domain sizes when compared with the samples with E-MA-GMA. Samples prepared with E-EA-MAH had better mechanical properties than the ones containing E-MA-GMA due to the better elastomer phase dispersion. Moreover, addition of CNT also improved the mechanical properties of the samples for both elastomer types. In contrast to mechanical test results, samples prepared with E-MA-GMA had higher electrical conductivity values when compared with those of the ones containing E-EA-MAH due to the differences in the selective distribution of CNT particles between the
Chadda, Harshita; Naveen, Sangeetha Vasudevaraj; Mohan, Saktiswaren; Satapathy, Bhabani K; Ray, Alok R; Kamarul, Tunku
2016-07-01
Although the physical and mechanical properties of hydroxyapatite-filled dental restorative composite resins have been examined, the biocompatibility of these materials has not been studied in detail. The purpose of this in vitro study was to analyze the toxicity of acrylate-based restorative composite resins filled with hydroxyapatite and a silica/hydroxyapatite combination. Five different restorative materials based on bisphenol A-glycidyl methacrylate (bis-GMA) and tri-ethylene glycol dimethacrylate (TEGDMA) were developed: unfilled (H0), hydroxyapatite-filled (H30, H50), and silica/hydroxyapatite-filled (SH30, SH50) composite resins. These were tested for in vitro cytotoxicity by using human bone marrow mesenchymal stromal cells. Surface morphology, elemental composition, and functional groups were determined by scanning electron microscopy (SEM), energy-dispersive x-ray spectroscopy (EDX), and Fourier-transformed infrared spectroscopy (FTIR). The spectra normalization, baseline corrections, and peak integration were carried out by OPUS v4.0 software. Both in vitro cytotoxicity results and SEM analysis indicated that the composite resins developed were nontoxic and supported cell adherence. Elemental analysis with EDX revealed the presence of carbon, oxygen, calcium, silicon, and gold, while the presence of methacrylate, hydroxyl, and methylene functional groups was confirmed through FTIR analysis. The characterization and compatibility studies showed that these hydroxyapatite-filled and silica/hydroxyapatite-filled bis-GMA/TEGDMA-based restorative composite resins are nontoxic to human bone marrow mesenchymal stromal cells and show a favorable biologic response, making them potential biomaterials. Copyright © 2016 Editorial Council for the Journal of Prosthetic Dentistry. Published by Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Zhao, Yuchen; Lan, Jinle; Wang, Xiaoyan; Deng, Xuliang; Cai, Qing; Yang, Xiaoping
2014-01-01
In this study, a strategy of using iodine-containing cyclophosphazenes as radiopacifiers for dental composite resin was evaluated. It was hypothesized that cyclophosphazenes bearing both iodine and acrylate group swere able to endow composite resins radiopacity without compromising mechanical properties. The cyclophosphazene compounds were synthesized by subsequently nucleophilic substitution of hexachlorocyclotriphosphazene with hydroxyethyl methacrylate (HEMA) and 4-iodoaniline. Cyclotriphosphazenes containing two different molar ratios of HEMA to 4-iodoaniline (1:5 and 2:4) were obtained, and were identified with 1 H NMR, FT-IR, UV and mass spectroscopy. The iodine-containing cyclophosphazenes were able to dissolve well in bisphenol A glycidyl methacrylate (Bis-GMA)/triethylene glycol dimethacrylate (TEGDMA) resin, and were added at two contents (10 or 15%wt. of the resin). The resins were photo-cured and post-thermal treated before characterizations. The resulting composite resins demonstrated the ability of blocking X-ray. And the addition of HEMA-co-iodoaniline substituted cyclotriphosphazenes caused minor adverse effect on the mechanical properties of the resins because the cyclotriphosphazenes could mix well and react with the resins. The presence of rigid phosphazene rings between resin backbones displayed an effective function of decreasing polymerization shrinkage. In summary, soluble and reactive iodine-containing cyclotriphosphazenes demonstrated advantages over traditional heavy metals or metal oxides in being used as additives for producing radiopaque dental resins. - Highlights: • Iodine-containing cyclotriphosphazenes were prepared via nucleophilic substitution. • The cyclotriphosphazenes endowed Bis-GMA/TEGDMA resins radiopacity. • The cyclotriphosphazenes caused a minor adverse effect on mechanical properties
Denis, Aline B; Diagone, Cristina A; Plepis, Ana M G; Viana, Rommel B
2015-12-05
A method for the extraction and quantification of two residual monomers, bisphenol glycidyl dimethacrylate (Bis-GMA) and triethylene glycol dimethacrylate (TEGDMA), that were evaluated using high efficiency liquid chromatography with UV detection was developed and validated in this study. Three types of solvents were applied in the extraction of the monomers (methanol, ethanol and acetonitrile), where the highest extraction efficiency was obtained using acetonitrile. The different resins were prepared by photoactivation of Bis-GMA and TEGDMA monomers. Additionally, the effects of the addition of two photoinitiators (camphorquinone (CQ) and phenyl propanodione (PPD) and that of a co-initiator (N,N-dimethyl-p-toluidine) were also analyzed. When only the CQ photoinitiator was used, a smaller amount of residual monomers was obtained, whereas a larger amount was obtained with PPD. When the two photoinitiators were used in the same matrix, however, no significant changes were observed in relation to the amount of residual TEGDMA monomers. For the addition of the co-initiator, there were no large changes in the extraction of residual monomers. The effect of the two photoactivation sources (halogen lamp and LED) led to small differences in the elution of the two monomers, although all of the resins differed significantly when photoactivated with a LED. Quantum chemical calculations using Density Functional Theory were carried out to characterize several molecular properties of each monomer. Copyright © 2015 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Kim, M.S.; Choi, S.H.; Lee, K.P.
2002-01-01
Complete text of publication follows. Radiation-induced graft polymerization is a good method for modification of chemical and physical properties of polymeric materials because it can endow properties such as membrane quality, ion exchange, blood compatibility, dyeability, protein adsorption, and immobilization of bioactive materials. Polyethylene microbead is very useful material due to the following advantages; low price, simple purchase, high sensitivity, and simple analysis. On the other hand, the epoxy group of the glycidyl methacrylate (GMA) can easily be converted to the various functional groups such as amines, alcohols, phosphoric acid, sulfonic acid, and amino acid, etc. Cyclodextrin have been applied universally in various industries such as foods, cosmetics, pharmaceutical industry, analytical chemistry, and chemical industry. In order to obtain cyclodextrins, polyethylene microbead with the epoxy group were prepared by radiation-induced graft polymerization of GMA onto polyethylene microbead. The physical and chemical properties of the GMA-induced polyethylene microbeads were investigated by IR, thermal analysis (TGA/DSC), and SEM, respectively. Subsequently, the various amine groups such as diethylamine. diethylenetriamine, triethylamine, triethylenetetramine, and 1,6-hexanediamine were induced onto the epoxy group in polyethylene microbead. Finally, cyclodextrin glucanotransferase were immobilized onto polyethylene microbead with various amines under the various experimental conditions, such as pH, amin content, immobilization time, and etc. The activity of CGTase-immobilized polyethylene microbead was determined by Phenolphthein method. The production of the cyclodextrins from starch is in progress
Surface Modifications of Polymers Induced by Heavy Ions Grafting
Energy Technology Data Exchange (ETDEWEB)
Mazzei, R O; Lombardo, J; Camporotondi, D; Tadey, D; Bermudez, G G [National Atomic Energy Commission, Ezeiza Atomic Centre, Ezeiza (Argentina)
2012-09-15
Polymer surfaces are modified by the application of swift heavy ions etching and grafting procedures. The residual active sites produced by heavy ion beams, remaining after the etching process, were used to start the grafting process. In order to produce tracks on foils of poly(vinylidene fluoride) (PVDF) they were irradiated with {sup 208}Pb of 25.62 MeV/n or with 115 MeV Cl ions. Moreover, foils of polypropylene (PP) were irradiated with {sup 208}Pb of 25.62 MeV/n. Then, they were etched and grafted with N-isopropylacrylamide (NIPAAm) monomers or with acrylic acid (AAc) monomers, respectively. The replica method allowed the observation of the shape of the grafted tracks using transmission electron microscopy (TEM). In addition NIPAAm grafted foils were analyzed using Fourier transform infrared spectroscopy (FTIR). The sulfonation procedure (methodology previously described for perfluorated polymers) was applied on grafted PVDF. A new method is described to produce a thin layer of poly-acrylic-acid (membranes) that grows on the surface of PVDF foils implanted by an Ar{sup +} beam with energies between 30-150 keV. Different combinations of monomers in water solutions were used such as: acrylic acid (AAc); acrylic acid-glycidyl methacrylate (AAc-GMA); acrylic acid-styrene (AAc-S); acrylic acid-N-isopropyl acrylamide (AAc-NIPAAm) and acrylic acid-N-isopropyl acrylamide - glycidyl methacrylate (AAc-NIPAAm-GMA). The experimental results show that for particular values of: ion fluence and energy, AAc concentration, sulphuric acid and PVDF polymorphous (alpha or beta) a huge percentage of grafting was obtained. At certain point of the grafting process the development of the PolyAAc-Xmonomer produce a detachment from the irradiated substrate and continue its grafting outside it. This method produces a membrane that is an increased replica of the original implanted surface. Finally, PVDF films implanted by an Ar{sup +} beam with energies about 100 keV and a fluence of 10
Beigi, Saeed; Yeganeh, Hamid; Atai, Mohammad
2013-07-01
Study and evaluation of fracture toughness, flexural and dynamic mechanical properties, and crosslink density of ternary thiol-ene-methacrylate systems and comparison with corresponding conventional methacrylate system were considered in the present study. Urethane tetra allyl ether monomer (UTAE) was synthesized as ene monomer. Different formulations were prepared based on combination of UTAE, BisGMA/TEGDMA and a tetrathiol monomer (PETMP). The photocuring reaction was conducted under visible light using BD/CQ combination as photoinitiator system. Mechanical properties were evaluated via measuring flexural strength, flexural modulus and fracture toughness. Scanning electron microscopy (SEM) was utilized to study the morphology of the fractured specimen's cross section. Viscoelastic properties of the samples were also determined by dynamic mechanical thermal analysis (DMTA). The same study was performed on a conventional methacrylate system. The data were analyzed and compared by ANOVA and Tukey HSD tests (significance level=0.05). The results showed improvement in fracture toughness of the specimens containing thiol-ene moieties. DMTA revealed a lower glass transition temperature and more homogenous structure for thiol-ene containing specimens in comparison to the system containing merely methacrylate monomer. The flexural modulus and flexural strength of the specimens with higher thiol-ene content were lower than the neat methacrylate system. The SEM micrographs of the fractured surface of specimens with higher methacrylate content were smooth and mirror-like (shiny) which represent brittle fracture. The thiol-ene-methacrylate system can be used as resin matrix of dental composites with enhanced fracture toughness in comparison to the methacrylate analogous. Copyright © 2013 Academy of Dental Materials. Published by Elsevier Ltd. All rights reserved.
Zhao, Wei; Wang, Huan; Li, Yuhong; Li, Chenxi
2018-01-01
This paper explored the method of combining atom transfer radical polymerization (ATRP) technology and hyperbranched polymer principle to prepare the high capacity chelating resin. First, surface-initiated atom transfer radical polymerization (SI-ATRP) method was used to graft glycidyl methacrylate (GMA) on chloromethylated cross-linked styrene-divinylbenzene resin, and then the novel polyamine chelating resin with a kind of hyperbranched structure was prepared through the amination reaction between amino group of (2-aminoethyl) triamine and epoxy group in GMA. This resin had a selective effect on As(V) and Cr(VI) at a relatively low pH and can be used for the disposal of waste water containing As(V) and Cr(VI). It had a relatively strong adsorption effect on Cu(II), Pb(II), Cd(II) and Cr(III) and can be used for the disposal of heavy metal ion waste water. The finding was that, the adsorption capacity of resin on the studied heavy metal ions was higher than that of the chelating resin synthesized by traditional technology and also higher than that of the resin modified by ATRP technology and bifunctional chelator, indicating that the combination of ATRP and hyperbranched polymer concept is an effective method to prepare chelating resin with high capacity. PMID:29515875
Chen, Youning; Zhao, Wei; Wang, Huan; Li, Yuhong; Li, Chenxi
2018-02-01
This paper explored the method of combining atom transfer radical polymerization (ATRP) technology and hyperbranched polymer principle to prepare the high capacity chelating resin. First, surface-initiated atom transfer radical polymerization (SI-ATRP) method was used to graft glycidyl methacrylate (GMA) on chloromethylated cross-linked styrene-divinylbenzene resin, and then the novel polyamine chelating resin with a kind of hyperbranched structure was prepared through the amination reaction between amino group of (2-aminoethyl) triamine and epoxy group in GMA. This resin had a selective effect on As(V) and Cr(VI) at a relatively low pH and can be used for the disposal of waste water containing As(V) and Cr(VI). It had a relatively strong adsorption effect on Cu(II), Pb(II), Cd(II) and Cr(III) and can be used for the disposal of heavy metal ion waste water. The finding was that, the adsorption capacity of resin on the studied heavy metal ions was higher than that of the chelating resin synthesized by traditional technology and also higher than that of the resin modified by ATRP technology and bifunctional chelator, indicating that the combination of ATRP and hyperbranched polymer concept is an effective method to prepare chelating resin with high capacity.
Monmaturapoj, Naruporn; Srion, Autcharaporn; Chalermkarnon, Prasert; Buchatip, Suthawan; Petchsuk, Atitsa; Noppakunmongkolchai, Warobon; Mai-Ngam, Katanchalee
2017-08-01
A composite of 70/30 poly(lactic acid)/hydroxyapatite was systematically prepared using various amounts of glycidyl methacrylate as reactive compatibilizer or Joncryl ADR®-4368 containing nine glycidyl methacrylate functions as a chain extension/branching agent to improve the mechanical and biological properties for suitable usage as internal bone fixation devices. The effect of glycidyl methacrylate/Joncryl on mechanical properties of poly(lactic acid)/hydroxyapatite was investigated through flexural strength. Cell proliferation and differentiation of osteoblast-like MC3T3-E1 cells cultured on the composite samples were determined by Alamar Blue assay and alkaline phosphatase expression, respectively. Result shows that flexural strength tends to decrease, as glycidyl methacrylate content increases except for 1 wt.% glycidyl methacrylate. With an addition of dicumyl peroxide, the flexural strength shows an improvement than that of without dicumyl peroxide probably due to the chemical bonding of the hydroxyapatite and poly(lactic acid) as revealed by FTIR and NMR, whereas the composite with 5 wt.% Joncryl shows the best result, as the flexural strength increases getting close to pure poly(lactic acid). The significant morphology change could be seen in composite with Joncryl where the uniform agglomeration of hydroxyapatite particles oriented in poly(lactic acid) matrix. Addition of the epoxy functional compatibilizers at suitable percentages could also have benefits to cellular attachment, proliferation, differentiation and mineralization. So that, this poly(lactic acid)/hydroxyapatite composite could be a promising material to be used as internal bone fixation devices such as screws, pins and plates.
Directory of Open Access Journals (Sweden)
Juciklécia da Silva Reinaldo
2015-10-01
Full Text Available Abstract In this work, the rheological, mechanical and morphological behavior of immiscible blend poly (methyl methacrylate with elastomeric particles (PMMAelast and post-consumer poly (ethylene terephthalate (PET with and without the use of the interfacial compatibilizer poly (methyl methacrylate-co-glycidyl methacrylate-co-ethyl acrylate (MGE was studied. The significant increase in torque presented in rheological analyses has shown a indication of chemical reactions between the epoxy group of MGE with end groups of PET chains and also with the elastomeric phase of PMMAelast. The increased concentration of PET yielded an increase in maximum strength and elasticity modulus and a decrease in elongation at break. The PMMAelast/PET binary blend (50/50 wt% and PMMAelast/PET/MGE compatibilized blend (65/30/5 wt% showed pronounced results in elongation at break compared to PMMAelast, whereas, in the first results were due to the evidence of a co-continuous morphological structure and in the second, due to the efficiency of the dual reactive interfacial compatibilization of PMMAelast/PET blends. Scanning electron microscopy (SEM and transmission electron microscopy (TEM analyses showed that PMMAelast/PET/MGE blends exhibit complex phase morphology due to the presence of elastomeric particles in the PMMAelast copolymer and in the use of MGE terpolymer.
Wang, Wei; Han, Jinhua; Ying, Jun; Xiang, Lanyi; Xie, Wenfa
2014-09-01
Two types of floating-gate based organic thin-film transistor nonvolatile memories (FG-OTFT-NVMs) were demonstrated, with poly(methyl methacrylate co glycidyl methacrylate) (P(MMA-GMA)) and tetratetracontane (TTC) as the tunneling layer, respectively. Their device performances were measured and compared. In the memory with a P(MMA-GMA) tunneling layer, typical unipolar hole transport was obtained with a relatively small mobility of 0.16 cm2/V s. The unidirectional shift of turn-on voltage (Von) due to only holes trapped/detrapped in/from the floating gate resulted in a small memory window of 12.5 V at programming/erasing voltages (VP/VE) of ±100 V and a nonzero reading voltage. Benefited from the well-ordered molecule orientation and the trap-free surface of TTC layer, a considerably high hole mobility of 1.7 cm2/V s and a visible feature of electrons accumulated in channel and trapped in floating-gate were achieved in the memory with a TTC tunneling layer. High hole mobility resulted in a high on current and a large memory on/off ratio of 600 at the VP/VE of ±100 V. Both holes and electrons were injected into floating-gate and overwritten each other, which resulted in a bidirectional Von shift. As a result, an enlarged memory window of 28.6 V at the VP/VE of ±100 V and a zero reading voltage were achieved. Based on our results, a strategy is proposed to optimize FG-OTFT-NVMs by choosing a right tunneling layer to improve the majority carrier mobility and realize ambipolar carriers injecting and trapping in the floating-gate.
Grafted Cellulose Based Adsorbents for Selective Separation Purposes
Energy Technology Data Exchange (ETDEWEB)
Takacs, E; Wojnarovits, L [Institute of Isotopes, Hungarian Academy of Sciences, Budapest (Hungary)
2012-09-15
The effect of high energy ionizing radiation on cotton-cellulose was studied. It was found that degradation of cellulose started at low doses, below 5 kGy, resulting in decrease in the degree of polymerization. However, the mechanical properties of cotton-cellulose samples only slightly changed with the dose up to 40 kGy. Acrylate type monomers were successfully grafted to cellulose by mutual and by pre-irradiation grafting technique. With both techniques the grafting yield increased with increasing dose and monomer concentration. In the case of pre-irradiation grafting the increase in grafting time also resulted in an increase in grafting percentage. Cotton-cellulose was functionalized using pre-irradiation grafting (PIG) and simultaneous grafting (SG) of glycidyl methacrylate (GMA). The adsorption properties of this material were further enhanced by {beta}-cyclodextrin (CD) immobilization. This molecule is known for its unique ability to form inclusion complexes among others with aromatic compounds like phenols, pesticide, dyes, etc. (author)
International Nuclear Information System (INIS)
Ueki, Yuji; Chandra Dafader, Nirmal; Hoshina, Hiroyuki; Seko, Noriaki; Tamada, Masao
2012-01-01
Radiation-induced graft polymerization of glycidyl methacrylate (GMA) onto non-woven polyethylene (NWPE) fabric was achieved under normal pressure and air atmospheric conditions, without using unique apparatus such as glass ampoules or vacuum lines. To attain graft polymerization under normal pressure and air atmospheric conditions, the effects of the pre-irradiation dose, pre-irradiation atmosphere, pre-irradiation temperature, de-aeration of GMA-emulsion, grafting atmosphere in a reactor, and dissolved oxygen (DO) concentration in GMA-emulsion on the degree of grafting (Dg) were investigated in detail. It was found that the DO concentration had the strongest influence, the pre-irradiation dose, de-aeration of emulsion and grafting atmosphere had a relatively strong impact, and the pre-irradiation atmosphere and pre-irradiation temperature had the least effect on Dg. The optimum DO concentration before grafting was 2.0 mg/L or less. When a polyethylene bottle was used as a reactor instead of a glass ampoule, graft polymerization under normal pressure and air atmospheric conditions could be achieved under the following conditions; the pre-irradiation dose was more than 50 kGy, the volume ratio of GMA-emulsion to air was 50:1 or less, and the DO concentration in GMA-emulsion during grafting was below 2.0 mg/L. Under these grafting conditions, Dg was controlled within a range of up to 362%. The prepared GMA–grafted NWPE (GMA–g-NWPE) fabric was modified with a phosphoric acid to obtain an adsorbent for heavy metal ions. In the column-mode adsorption tests of Pb(II), the adsorption performance of the produced phosphorylated GMA–g-NWPE fabric (fibrous metal adsorbent) was not essentially dependent on the flow rate of the feed. The breakthrough points of 200, 500, and 1000 h −1 in space velocity were 483, 477 and 462 bed volumes, and the breakthrough capacities of the three flow rates were 1.16, 1.15 and 1.16 mmol-Pb(II)/g-adsorbent.
Directory of Open Access Journals (Sweden)
Shuzhen Luo
2016-12-01
Full Text Available With the aim of reducing human exposure to Bisphenol A (BPA derivatives in dentistry, a fluorinated dimethacrylate monomer was synthesized to replace 2,2-bis[4-(2-hydroxy-3-methacryloy-loxypropyl-phenyl]propane (Bis-GMA as the base monomer of dental resin. After mixing with reactive diluent triethyleneglycol dimethacrylate (TEGDMA, fluorinated dimethacrylate (FDMA/TEGDMA was prepared and compared with Bis-GMA/TEGDMA in physicochemical properties, such as double bond conversion (DC, volumetric shrinkage (VS, water sorption (WS and solubility (WSL, flexural strength (FS and modulus (FM. The results showed that, when compared with Bis-GMA based resin, FDMA-based resin had several advantages, such as higher DC, lower VS, lower WS, and higher FS after water immersion. All of these revealed that FDMA had potential to be used as a substitute for Bis-GMA. Of course, many more studies, such as biocompatibility testing, should be undertaken to prove whether FDMA could be applied in clinic.
Barsbay, Murat; Kavaklı, Pınar Akkaş; Güven, Olgun
2010-03-01
A novel polymeric ligand exchanger (PLE) was prepared for the removal of phosphate ions from water. 2,2'-dipyridylamine (DPA), a bidentate ligand forming compound with high coordination capacity with a variety of metal ions was bound to glycidyl methacrylate (GMA) grafted polypropylene/polyethylene (PP/PE) nonwoven fabric synthesized by radiation-induced grafting technique. DPA attachment on epoxy ring of GMA units was tested in different solvents, i.e. methanol, ethanol, dioxane and dimethylsulfoxide (DMSO). The highest amount of modification was achieved in dioxane. In order to prepare the corresponding PLE for the removal of phosphate, DPA-immobilized fabric was loaded with Cu(II) ions. Phosphate adsorption experiments were performed in batch mode at different pH (5-9) and phosphate concentrations. The fabric was found to be effective for the removal of phosphate ions. At every stage of preparation and use, the nonwoven fabric was characterized by thermal (i.e. DSC and TGA) and spectroscopic (FTIR) methods. Competitive adsorption experiments were also carried out using two solutions with different concentration levels at pH 7 to see the effect of competing ions. Phosphate adsorption was found to be effective and selective from solutions having trace amounts of competitive anions. It is expected that the novel PLE synthesized can be used for the removal of phosphate ions in low concentrations over a large range of pH.
International Nuclear Information System (INIS)
Wang, Wei; Han, Jinhua; Ying, Jun; Xiang, Lanyi; Xie, Wenfa
2014-01-01
Two types of floating-gate based organic thin-film transistor nonvolatile memories (FG-OTFT-NVMs) were demonstrated, with poly(methyl methacrylate co glycidyl methacrylate) (P(MMA-GMA)) and tetratetracontane (TTC) as the tunneling layer, respectively. Their device performances were measured and compared. In the memory with a P(MMA-GMA) tunneling layer, typical unipolar hole transport was obtained with a relatively small mobility of 0.16 cm 2 /V s. The unidirectional shift of turn-on voltage (V on ) due to only holes trapped/detrapped in/from the floating gate resulted in a small memory window of 12.5 V at programming/erasing voltages (V P /V E ) of ±100 V and a nonzero reading voltage. Benefited from the well-ordered molecule orientation and the trap-free surface of TTC layer, a considerably high hole mobility of 1.7 cm 2 /V s and a visible feature of electrons accumulated in channel and trapped in floating-gate were achieved in the memory with a TTC tunneling layer. High hole mobility resulted in a high on current and a large memory on/off ratio of 600 at the V P /V E of ±100 V. Both holes and electrons were injected into floating-gate and overwritten each other, which resulted in a bidirectional V on shift. As a result, an enlarged memory window of 28.6 V at the V P /V E of ±100 V and a zero reading voltage were achieved. Based on our results, a strategy is proposed to optimize FG-OTFT-NVMs by choosing a right tunneling layer to improve the majority carrier mobility and realize ambipolar carriers injecting and trapping in the floating-gate.
Development of Novel Absorbents and Membranes by Radiation-Induced Grafting for Selective Purposes
Energy Technology Data Exchange (ETDEWEB)
Hegazy, E A; Abdel-Rehim, H; Hegazy, D; Ali, A A; Kamal, H; Sayed, A [National Center for Radiation Research and Technology, Atomic Energy Egypt, P.O.Box 29, Nasr City, Cairo (Egypt)
2012-09-15
The direct radiation grafting technique was used to graft glycidyl methacrylate (GMA) monomer containing epoxy ring, onto polypropylene fibres. The ring opening of the epoxy ring in GMA by different amino groups was studied to introduce various chelating agents. Some properties of grafted fibres were studied and the possibility of its practical use for water treatment from iron and manganese metals was investigated. The radiation initiated grafting of acrylic acid (AAc) or acrylamide (AAm) monomers onto poly(vinyl alcohol) (PVA), a 2-acrylamide-2-methyl propane sulfonic acid (AMPS) polymer was studied. Cationic/anionic membranes were also prepared by radiation-induced grafting of styrene/methacrylic acid (Sty/MAA) binary monomers onto LDPE films. To impart reactive cationic/anionic characters in the grafted membranes, sulfonation and alkaline treatments for styrene and carboxylic acid groups, respectively, were carried out. The possibility of their applications in the selective removal of some heavy metals was studied. The prepared grafted materials had a great ability to recover the metal ions such as: Ni{sup 2+}, Co{sup 2+}, Cu{sup 2+}, Cd{sup 2+}, Mg{sup 2+}, Zn{sup 2+}, Mn{sup 2+} and Cr{sup 3+} from their solutions. It was found that AMPS content in the grafted copolymers is the main parameter for the selectivity of the copolymer towards metal ions. The higher the AMPS content the higher the selectivity towards Co and Ni ions. In case of LDPE-g-P(STY/MAA), the sulfonation and alkaline treatments are the most effective methods to influence metal absorption and swelling behaviour of the prepared membranes. Graft composition, dose and pH have also a great influence on the membrane characteristics and applicability in wastewater treatments from heavy and toxic metals. Results revealed that the prepared grafted materials with different functionalized groups are promising as ion selective membranes and could be used for wastewater treatment. (author)
GMA200 ATEGG Digital Controls Demonstration.
1979-10-01
radial and axial loads into the air inlet housing and forward frame. c. Combustor/Diffuser The GMA200 combustor/diffuser section consists of an annular...transition flow path of a turbofan engine. 6 IT U’~ --sa b. Compressor A six-stage axial flow compressor assembly consists of subassemblies of the...savings in the highly loaded , high speed unit. The blade is cooled by the application of a variety of cooling techniques including a film-cooled leading
Polyglycidyl methacrylate based immunoaffinity cryogels for insulin adsorption
International Nuclear Information System (INIS)
Memmedova, Türkan; Armutcu, Canan; Uzun, Lokman; Denizli, Adil
2015-01-01
Immunoaffinity chromatography (IAC) is a kind of bioaffinity chromatography which used antibodies or antibody-related molecules as the stationary phase. IAC is used by many applications for analytical, clinical and diagnostic purposes, particularly preferring in analytical purposes on one-step separation and purification of target compounds. Moreover, immunoaffinity chromatography is used in antibody enrichment and separation of cells. IAC columns are usually applied in the antibody experiments due to powerful and selective binding of antibodies and/or their target antigens. Antigen or antibody molecules could be immobilized to the solid support. Therefore, target antibody or cell is purified. Specific bioligands can be immobilized directly on glycidyl based polymeric material with simple acid–base catalyst. In this study, polyglycidyl methacrylate based therefore cryogels were prepared and anti-insulin antibodies were immobilized on porous surface of cryogels. Swelling test, Fourier transform infrared spectroscopy (FTIR), Raman spectroscopy, and scanning electron microscopy (SEM) were conducted to characterize cryogels developed. To optimize separation conditions, effects of pH, initial insulin concentration, flow rate, salt concentration, contact time and temperature on insulin adsorption capacity were examined. The results indicated that the immunoaffinity cryogel developed here could be classified as good alternative with prominent properties such as high reusability and cost-friendly adsorbent and would be one of the primary reports for immunoaffinity purification of insulin molecules in not only lab-scale but also for industrial purposes. - Highlights: • Polyglycidyl methacrylate based cryogels developed as stationary phase • Immunoaffinity cryogels for reusable and cost-friendly insulin adsorption • Increase in worldwide prevalence of diabetes, type 1 or 2 • An exponential increase in the demand on insulin market • Guiding researchers for not
Polyglycidyl methacrylate based immunoaffinity cryogels for insulin adsorption
Energy Technology Data Exchange (ETDEWEB)
Memmedova, Türkan; Armutcu, Canan; Uzun, Lokman, E-mail: lokman@hacettepe.edu.tr; Denizli, Adil
2015-07-01
Immunoaffinity chromatography (IAC) is a kind of bioaffinity chromatography which used antibodies or antibody-related molecules as the stationary phase. IAC is used by many applications for analytical, clinical and diagnostic purposes, particularly preferring in analytical purposes on one-step separation and purification of target compounds. Moreover, immunoaffinity chromatography is used in antibody enrichment and separation of cells. IAC columns are usually applied in the antibody experiments due to powerful and selective binding of antibodies and/or their target antigens. Antigen or antibody molecules could be immobilized to the solid support. Therefore, target antibody or cell is purified. Specific bioligands can be immobilized directly on glycidyl based polymeric material with simple acid–base catalyst. In this study, polyglycidyl methacrylate based therefore cryogels were prepared and anti-insulin antibodies were immobilized on porous surface of cryogels. Swelling test, Fourier transform infrared spectroscopy (FTIR), Raman spectroscopy, and scanning electron microscopy (SEM) were conducted to characterize cryogels developed. To optimize separation conditions, effects of pH, initial insulin concentration, flow rate, salt concentration, contact time and temperature on insulin adsorption capacity were examined. The results indicated that the immunoaffinity cryogel developed here could be classified as good alternative with prominent properties such as high reusability and cost-friendly adsorbent and would be one of the primary reports for immunoaffinity purification of insulin molecules in not only lab-scale but also for industrial purposes. - Highlights: • Polyglycidyl methacrylate based cryogels developed as stationary phase • Immunoaffinity cryogels for reusable and cost-friendly insulin adsorption • Increase in worldwide prevalence of diabetes, type 1 or 2 • An exponential increase in the demand on insulin market • Guiding researchers for not
Omer-Mizrahi, Melany; Margel, Shlomo
2009-01-15
Core polystyrene microspheres of narrow size distribution were prepared by dispersion polymerization of styrene in a mixture of ethanol and 2-methoxy ethanol. Uniform polyglycidyl methacrylate/polystyrene core-shell micrometer-sized particles were prepared by emulsion polymerization at 73 degrees C of glycidyl methacrylate in the presence of the core polystyrene microspheres. Core-shell particles with different properties (size, surface morphology and composition) have been prepared by changing various parameters belonging to the above seeded emulsion polymerization process, e.g., volumes of the monomer glycidyl methacrylate and the crosslinker monomer ethylene glycol dimethacrylate. Magnetic Fe(3)O(4)/polyglycidyl methacrylate/polystyrene micrometer-sized particles were prepared by coating the former core-shell particles with magnetite nanoparticles via a nucleation and growth mechanism. Characterization of the various particles has been accomplished by routine methods such as light microscopy, SEM, FTIR, BET and magnetic measurements.
Energy Technology Data Exchange (ETDEWEB)
Kavakli, P A; Kavakli, C; Guven, O [Department of Chemistry, Hacettepe University, Beytepe, 06800, Ankara (Turkey)
2012-09-15
Nonwoven fabrics made of PE coated PP fibres were irradiated by accelerated electrons in inert atmospheres for grafting of two different monomers, glycidyl methacrylate and dimethylaminoethyl methacrylate. Grafting conditions were optimized by a systematic investigation of the effects of absorbed dose, monomer concentration, grafting reaction temperature and duration. 150% grafted copolymers were later modified by protonation and quaternization of poly(dimethylaminoethyl methacrylate) chains and by Cu(II) loading of dipyridyl amine modified poly(glycidyl methacrylate) graft chains. The PE/PP based adsorbents thus prepared were used for their suitability of removing phosphate and chromate ions from aqueous systems. Adsorption/removal studies were carried out in both batch and continuous flow type systems. The selectivity of adsorption of phosphate ions in the presence of other competing anions were also checked showing the enhanced selectivity for phosphate ions. (author)
Özden-Yenigün, Elif; Menceloğlu, Yusuf Z; Papila, Melih
2012-02-01
Strengthened nanofiber-reinforced epoxy matrix composites are demonstrated by engineering composite electrospun fibers of multi-walled carbon nanotubes (MWCNTs) and reactive P(St-co-GMA). MWCNTs are incorporated into surface-modified, reactive P(St-co-GMA) nanofibers by electrospinning; functionalization of these MWCNT/P(St-co-GMA) composite nanofibers with epoxide moieties facilitates bonding at the interface of the cross-linked fibers and the epoxy matrix, effectively reinforcing and toughening the epoxy resin. Rheological properties are determined and thermodynamic stabilization is demonstrated for MWCNTs in the P(St-co-GMA)-DMF polymer solution. Homogeneity and uniformity of the fiber formation within the electrospun mats are achieved at polymer concentration of 30 wt %. Results show that the MWCNT fraction decreases the polymer solution viscosity, yielding a narrower fiber diameter. The fiber diameter drops from an average of 630 nm to 460 nm, as the MWCNTs wt fraction (1, 1.5, and 2%) is increased. The electrospun nanofibers of the MWCNTs/P(St-co-GMA) composite are also embedded into an epoxy resin to investigate their reinforcing abilities. A significant increase in the mechanical response is observed, up to >20% in flexural modulus, when compared to neat epoxy, despite a very low composite fiber weight fraction (at about 0.2% by a single-layer fibrous mat). The increase is attributed to the combined effect of the two factors the inherent strength of the well-dispersed MWCNTs and the surface chemistry of the electrospun fibers that have been modified with epoxide to enable cross-linking between the polymer matrix and the nanofibers.
Energy Technology Data Exchange (ETDEWEB)
Cellet, Thelma Sley P.; Pereira, Guilherme M.; Fragal, Elizangela H.; Rubira, Adley F., E-mail: thelmaspc@hotmail.com [Universidade Estadual de Maringa (UEM), Maringa, PR (Brazil). Departamento de Quimica; Companhoni, Mychelle V.P.; Nakamura, Celso V.; Ueda-Nakamura, Tania [Universidade Estadual de Maringa (UEM), Maringa, PR (Brazil). Departamento de Ciencias Basicas da Saude
2015-07-01
Chemical modification of polypropylene (PP) films can be explored to prepare innovative materials, for instance materials which can be used in tissue engineering application. The maleimide synthesis onto PP films was made for later polymerizes glycidyl methacrylate (GMA) and to grow up hydroxyapatite nanoparticles (n-HA) by biomimetization method (BM) in metastable simulated body fluid (SBF) for 7, 14 and 21 days. The modification steps were proved by infrared spectroscopy (FTIR) and the n-HA synthesis evidenced by X-ray diffractometry (XRD), scanning electronic microscopy (SEM) and energy dispersive spectroscopy (EDS). PP films exposed to SBF for 14 and 21 days showed n-HA on all over the films surface. The interaction of pre-osteoblasts with the films after 48 hours was evaluated by SEM. The results demonstrate that cells on the surface of n-HA films showed spreading, and number of filopodia similar to the control, wherein the films with greater amount of n-HA appear to have higher filopodia connections between the cells and appear to have its surface covered with higher cell density. (author)
International Nuclear Information System (INIS)
Cellet, Thelma Sley P.; Pereira, Guilherme M.; Fragal, Elizangela H.; Rubira, Adley F.; Companhoni, Mychelle V.P.; Nakamura, Celso V.; Ueda-Nakamura, Tania
2015-01-01
Chemical modification of polypropylene (PP) films can be explored to prepare innovative materials, for instance materials which can be used in tissue engineering application. The maleimide synthesis onto PP films was made for later polymerizes glycidyl methacrylate (GMA) and to grow up hydroxyapatite nanoparticles (n-HA) by biomimetization method (BM) in metastable simulated body fluid (SBF) for 7, 14 and 21 days. The modification steps were proved by infrared spectroscopy (FTIR) and the n-HA synthesis evidenced by X-ray diffractometry (XRD), scanning electronic microscopy (SEM) and energy dispersive spectroscopy (EDS). PP films exposed to SBF for 14 and 21 days showed n-HA on all over the films surface. The interaction of pre-osteoblasts with the films after 48 hours was evaluated by SEM. The results demonstrate that cells on the surface of n-HA films showed spreading, and number of filopodia similar to the control, wherein the films with greater amount of n-HA appear to have higher filopodia connections between the cells and appear to have its surface covered with higher cell density. (author)
Mohamed, Amina L; El-Sheikh, Manal A; Waly, Ahmed I
2014-02-15
Environmental concerns related to fluorinated and organophosphorus compounds led to a consideration of the methods for imparting flame retardancy and water/oil repellency to textiles. A simple and facile method for fabricating the cotton fabric with superhydrophobicity and flame retardancy is described in the present work. Complex coating with amino-functionalized silica nano-particles on epoxy-functionalized cotton accompanied with ZnO nano-particles coating are carried out. In This context, new preparation techniques were used to prepare both aminated silica and ZnO nano-particles. The particle size was investigated using Transition Electron Microscope (TEM) and the chemical structure was investigated using FT-IR analysis and other analytical techniques. Cotton was functionalized with epoxy and carboxyl via grafting cotton with nano-emulsion consisted of mixture of glycidyl methacrylate (GMA) and acrylic acid (AA), and then treated for functional finishing through conventional pad-dry-cure method. The treated fabrics showed good water repellency and excellent flame retardant properties as determined by the standard test methods. Copyright © 2013 Elsevier Ltd. All rights reserved.
Enhancement of interfacial adhesion between starch and grafted poly(ε-caprolactone).
Ortega-Toro, Rodrigo; Santagata, Gabriella; Gomez d'Ayala, Giovanna; Cerruti, Pierfrancesco; Talens Oliag, Pau; Chiralt Boix, M Amparo; Malinconico, Mario
2016-08-20
The use of a modified poly(ε-caprolactone) (gPCL) to enhance polymer miscibility in films based on thermoplastic starch (S) and poly(ε-caprolactone) is reported. PCL was functionalized by grafting with maleic anyhdride (MA) and/or glycidyl methacrylate (GMA) by reactive blending in a batch mixer. gPCL based materials were analysed in terms of their grafting degree, structural and thermal properties. Blends based on starch and PCL (wt. ratio 80:20) with including gPCL (0, 2.5 and 5wt.%), as a compatibilizer, were obtained by extrusion and compression moulding, and their structural, thermal, mechanical and barrier properties were investigated. Blends containing gPCL evidenced better interfacial adhesion between starch and PCL domains, as deduced from both structural (XRD, FTIR, SEM) and bulk properties (DSC, TGA). Moreover, grafted PCL-based compatibilizers greatly improved functional properties of S-PCL blend films, as pointed out from mechanical performance and higher barrier properties, valuable to meet the food packaging requirements. Copyright © 2016 Elsevier Ltd. All rights reserved.
2015-12-10
Laboratory (Ret.), private communication. 33. S. Kou, Welding Metallurgy , 2nd Ed., John Wiley & Sons, Inc., 2003. DOI: 10.1002/0471434027. 34. J. K...Naval Research Laboratory Washington, DC 20375-5320 NRL/MR/6390--15-9665 Temperature Histories of Structural Steel Laser and Hybrid Laser-GMA Welds ...NUMBER OF PAGES 17. LIMITATION OF ABSTRACT Temperature Histories of Structural Steel Laser and Hybrid Laser-GMA Welds Calculated Using Multiple
(1-Adamantyl)methyl glycidyl ether: a versatile building block for living polymerization.
Moers, Christian; Wrazidlo, Robert; Natalello, Adrian; Netz, Isabelle; Mondeshki, Mihail; Frey, Holger
2014-06-01
(1-Adamantyl)methyl glycidyl ether (AdaGE) is introduced as a versatile monomer for oxyanionic polymerization, enabling controlled incorporation of adamantyl moieties in aliphatic polyethers. Via copolymerization with ethoxyethyl glycidyl ether (EEGE) and subsequent cleavage of the acetal protection groups of EEGE, hydrophilic linear polyglycerols with an adjustable amount of pendant adamantyl moieties are obtained. The adamantyl unit permits control over thermal properties and solubility profile of these polymers (LCST). Additionally, AdaGE is utilized as a termination agent in carbanionic polymerization, affording adamantyl-terminated polymers. Using these structures as macroinitiators for the polymerization of ethylene oxide affords amphiphilic, in-chain adamantyl-functionalized block copolymers. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Characterization of methacrylate-based composites containing thio-urethane oligomers.
Bacchi, Atais; Nelson, Morgan; Pfeifer, Carmem S
2016-02-01
To evaluate the ability of thio-urethane oligomers to improve the properties of restorative composite resins. Oligomers were synthesized by combining 1,6-hexanediol-diissocyante (aliphatic) with pentaerythritol tetra-3-mercaptopropionate (PETMP) or 1,3-bis(1-isocyanato-1-methylethyl)benzene (aromatic) with trimethylol-tris-3-mercaptopropionate (TMP), at 1:2 isocyanate:thiol, leaving pendant thiols. Oligomers were added at 0-20 wt% to BisGMA-TEGDMA (70-30 wt%). Silanated inorganic fillers were added (70 wt%). Materials were photoactivated at 800 mW/cm(2) filtered to 320-500 nm. Near-IR was used to follow degree of methacrylate conversion (DC). Mechanical properties were evaluated in three-point bending with 2 mm × 2 mm × 25 mm bars for flexural strength/modulus and toughness (FS/E, and T) according to ISO 4049, and 2 mm × 5 mm × 25 mm notched specimens for fracture toughness (KIC). Polymerization stress (PS) was measured on the Bioman. Results were analyzed with ANOVA/Tukey's test (α=5%). Significant increase in DC was observed in thio-urethane-containing materials especially for the group with 20 wt% of aliphatic version. Materials composed by oligomers also promoted higher FS, E, and KIC in comparison to controls irrespective of thio-urethane type. A significant increase in toughness was detected by ANOVA, but not distinguished in the groups. The PS was significantly reduced by the presence of thio-urethane for almost all groups. The use of thio-urethane oligomer to compose methacrylate-based restorative composite promote increase in DC, FS, E and KIC while significant reduces PS. A simple additive was shown to reduce stress while increasing convrersion and mechanical properties, mainly fracture toughness. This has he potential of increasing the service life of dental composites, without changing current operatory procedures. Copyright © 2015 Academy of Dental Materials. Published by Elsevier Ltd. All rights reserved.
Structure and properties of GMA surfaced armour plates
A. Klimpel; K. Luksa; M. Burda
2010-01-01
Purpose: In the combat vehicles many materials can be used for the armour. Application of the monolithic armour plates in light combat vehicles is limited by the high armour weigh. Introduction of the layered armour plates is a way to limit the vehicle weight. In the paper test results of graded and nanostructural GMA surfaced armour plates are presented.Design/methodology/approach: Metallographic structure, chemical composition and hardness of surfaced layers were investigated in order to ex...
40 CFR 721.10153 - Modified methyl methacrylate, 2-hydroxyethyl methacrylate polymer (generic).
2010-07-01
...-hydroxyethyl methacrylate polymer (generic). 721.10153 Section 721.10153 Protection of Environment...-hydroxyethyl methacrylate polymer (generic). (a) Chemical substance and significant new uses subject to... methacrylate polymer (PMN P-08-6) is subject to reporting under this section for the significant new uses...
The thermal degradation of poly(iso-butyl methacrylate and poly(sec-butyl methacrylate
Directory of Open Access Journals (Sweden)
IVANKA G. POPOVIC
2000-12-01
Full Text Available The non-oxidative thermal degradation of poly(iso-butyl methacrylate and poly(sec-butyl methacrylate was investigated by studying changes in the polymer residue. Due to the different number of b-hydrogens in their ester substituents, these two polymeric isomers behave differently when subjected to elevated temperatures. Poly(iso-butyl methacrylate degrades quantitatively by depolymerisation with zip lengths of the same order of magnitude as those of poly(methyl methacrylate. Poly(sec-butyl methacrylate degrades by a combined degradation mechanism of depolymerisation and de-esterification. De-esterification becomes a significant thermolysis route at temperatures higher than 240°C.
Lamnawar, Khalid; Maazouz, Abderrahim
2008-07-01
Coextrusion technologies are commonly used to produce multilayered composite sheets or films for a large range of applications from food packaging to optics. The contrast of rheological properties between layers can lead to interfacial instabilities during flow. Important theoretical and experimental advances regarding the stability of compatible and incompatible polymers have, during the last decades, been made using a mechanical approach. However, few research efforts have been dedicated to the physicochemical affinity between the neighboring layers. The present study deals with the influence of this affinity on interfacial instabilities for functionalized incompatible polymers. Polyamide (PA6)/polyethylene grafted with glycidyl methacrylate (PE-GMA) was used as a reactive system and PE/PA6 as a non reactive one. Two grades of polyamide (PA6) were used in order to change the viscosity and elasticity ratios between PE (or PE-GMA) and PA6. It was experimentally confirmed, in this case, that weak disturbance can be predicted by considering an interphase of non-zero thickness (corresponding to an interdiffusion/reaction zone) instead of a purely geometrical interface between the two reactive layers. According to the rheological investigations from previous work which the interphase effect can be probed, an experimental strategy was here formulated to optimize the process by listing the parameters that controlled the stability of the reactive multilayer flows. Hence, based on this analysis, guidelines for a stable coextrusion of reactive functionalized polymers can be provided coupling the classical parameters (viscosity, elasticity and layer ratios) and the physicochemical affinity at the polymer/polymer interface.
The study of electron beam curing of coatings pt.2
International Nuclear Information System (INIS)
Pyun, H.C.; Park, W.B.; Kim, K.Y.; Seung, K.W.
1979-01-01
The reaction of methylmethacrylate-methacrylic acid copolymer with glycidyl methacrylate in the presence of trie triethylbenzyl ammonium chloride has been studied and compared with that of methylmethacrylate-glycidylmethacrylate with methacrylic acid. It was found that the addition reaction was in good agreement with second-order kinetics in regards to the structure of copolymers. The plausible reaction mechanism was proposed and elucidated on the basis of experimental data obtained. (author)
Fatty Acid-Based Monomers as Styrene Replacements for Liquid Molding Resins
2005-05-01
fatty acid length and unsaturation level on resin and polymer properties. Fig. 2. The addition of fatty acids ( oleic acid ) to glycidyl methacylate to...the synthetic route used to form the methacrylated fatty acids (MFA). The carboxylic acid of fatty acids undergoes a simple addition reaction with... form methacrylated fatty acid monomer
Energy Technology Data Exchange (ETDEWEB)
Xin, Zhirong, E-mail: xinzhirong2012@126.com [School of Chemistry and Chemical Engineering, Yantai University, Yantai 264005 (China); Du, Shanshan; Zhao, Chunyu; Chen, Hao; Sun, Miao [School of Chemistry and Chemical Engineering, Yantai University, Yantai 264005 (China); Yan, Shunjie [State Key Laboratory of Polymer Physics and Chemistry, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Luan, Shifang, E-mail: sfluan@ciac.ac.cn [State Key Laboratory of Polymer Physics and Chemistry, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China); Yin, Jinghua [State Key Laboratory of Polymer Physics and Chemistry, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China)
2016-03-01
Graphical abstract: - Highlights: • PNVP and PHMG components were covalently immobilized on PP{sub NWF} surface. • PP{sub NWF}-g-PNVP-PHMG possessed bacterial adhesion-resistant and bactericidal capabilities. • PP{sub NWF}-g-PNVP-PHMG obviously suppressed platelet and red blood cell adhesion. - Abstract: A growing number of wound dressing-related nosocomial infections necessitate the development of novel antibacterial strategies. Herein, polypropylene non-woven fabric (PP{sub NWF}) was facilely modified with passive and active antibacterial components, namely photografting polymerization both N-Vinyl-2-pyrrolidone (NVP) and glycidyl methacrylate (GMA) monomers, and the introduction of guanidine polymer through the reaction between active amino groups and epoxy groups. The modified samples were confirmed by attenuated total reflectance Fourier transform infrared spectroscopy (ATR-FTIR), X-ray photoelectron spectroscopy (XPS), respectively. Water contact angle measurement, antibacterial test, platelet and red blood cell adhesion were used to evaluate the hydrophilicity, antibacterial properties and hemocompatibility of the samples. It was found that the antibacterial properties were obviously enhanced, meanwhile significantly suppressing platelet and red blood cell adhesion after the above modification. This PP{sub NWF} samples that possess antifouling and antimicrobial properties, have great potential in wound dressing applications.
A UV-prepared linear polymer electrolyte membrane for dye-sensitized solar cells
Energy Technology Data Exchange (ETDEWEB)
Imperiyka, M., E-mail: imperiyka@gmail.com [Faculty of Arts and Sciences, Kufra Campus, University of Benghazi, Al Kufrah (Libya); Ahmad, A.; Hanifah, S.A. [School of Chemical Sciences and Food Technology, Faculty of Science and Technology, Universiti Kebangsaan Malaysia, 43600 Bangi, Selangor (Malaysia); Polymer Research Center, Faculty of Science and Technology, Universiti Kebangsaan Malaysia, 43600 Bangi, Selangor (Malaysia); Bella, F. [Center for Space Human Robotics @Polito, Istituto Italiano di Tecnologia, Corso Trento 21, 10129 Torino (Italy); Department of Applied Science and Technology – DISAT, Politecnico di Torino, Corso Duca degli Abruzzi 24, 10129 Torino (Italy)
2014-10-01
The effects of LiClO{sub 4} and LiFS{sub 3}SO{sub 3} on poly(glycidyl methacrylate)-based solid polymer electrolyte and its photoelectrochemical performance in a dye sensitized solar cell consisting of FTO/TiO{sub 2}–dye/P(GMA)–LiClO{sub 4}–EC/Pt were investigated. The electrochemical stability of films was studied by cyclic voltammetry (CV). The highest ionic conductivities obtained were 4.2×10{sup −5} and 3.7×10{sup −6} S cm{sup −1} for the film containing 30 wt% LiClO{sub 4} and 25 wt% LiCF{sub 3}SO{sub 3}, respectively. The polymer electrolytes showed electrochemical stability windows up to 3 V and 2.8 V for LiClO{sub 4} and LiCF{sub 3}SO{sub 3}, respectively. The assembled dye-sensitized solar cell showed a sunlight conversion efficiency of 0.679% (J{sub sc}=3 mA cm{sup −2}, V{sub oc}=0.48 V and FF=0.47), under light intensity of 100 mW cm{sup −2}.
Methyl methacrylate oligomerically-modified clay and its poly(methyl methacrylate) nanocomposites
International Nuclear Information System (INIS)
Zheng Xiaoxia; Jiang, David D.; Wilkie, Charles A.
2005-01-01
A methyl methacrylate oligomerically-modified clay was used to prepare poly(methyl methacrylate) clay nanocomposites by melt blending and the effect of the clay loading level on the modified clay and corresponding nanocomposite was studied. These nanocomposites were characterized by X-ray diffraction, transmission electron microscopy, thermogravimetric analysis and cone calorimetry. The results show a mixed intercalated/delaminated morphology with good nanodispersion. The compatibility between the methylacrylate-subsituted clay and poly(methyl methacrylate) (PMMA) are greatly improved compared to other oligomerically-modified clays
International Nuclear Information System (INIS)
Hayakawa, Kiyoshi; Taoda, Hiroshi; Kawase, Kaoru; Tazawa, Masato; Yamakita, Hiromi
1986-01-01
Thermal behavior of several kinds of poly (alkyl methacrylate) and polypropylene-g-poly (alkyl methacrylate) fibers prepared by γ-irradiation was investigated by thermogravimetric measurements with the intermittent analysis of the gaseous products. The degradation of poly (methyl methacrylate) proceeded according to the deploymerization mechanism reproducing the pristine monomer exclusively. The thermogram in inert atmosphere showed the features of a two-step depolymerization, while in air it showed no such a stepwise decrease with the elevating temperature. The dissolution-precipitation treatment of polymer seemed to affect the decomposition behavior. On other alkyl methacrylate polymers, the thermal decomposition generally proceeded also according to the depolymerization mechanism. But, for instance, at least two kinds of products besides its own monomer were formed from poly (isobutyl methacrylate), and their relative fractions differed with the temperature. Polypropylene-g-poly (alkyl methacrylate) fibers showed lowering of initiation temperature of decomposition with the increase in extent of the grafting, and their initiation temperatures of decomposition in air were lower than those in inert atmosphere. (author)
NaF-loaded core-shell PAN-PMMA nanofibers as reinforcements for Bis-GMA/TEGDMA restorative resins.
Cheng, Liyuan; Zhou, Xuegang; Zhong, Hong; Deng, Xuliang; Cai, Qing; Yang, Xiaoping
2014-01-01
A kind of core-shell nanofibers containing sodium fluoride (NaF) was produced and used as reinforcing materials for dimethacrylate-based dental restorative resins in this study. The core-shell nanofibers were prepared by coaxial-electrospinning with polyacrylonitrile (PAN) and poly(methyl methacrylate) (PMMA) solutions as core and shell fluids, respectively. The produced PAN-PMMA nanofibers varied in fiber diameter and the thickness of PMMA shell depending on electrospinning parameters. NaF-loaded nanofibers were obtained by incorporating NaF nanocrystals into the core fluid at two loadings (0.8 or 1.0wt.%). Embedment of NaF nanocrystals into the PAN core did not damage the core-shell structure. The addition of PAN-PMMA nanofibers into Bis-GMA/TEGDMA clearly showed the reinforcement due to the good interfacial adhesion between fibers and resin. The flexural strength (Fs) and flexural modulus (Ey) of the composites decreased slightly as the thickness of PMMA shell increasing. Sustained fluoride releases with minor initial burst release were achieved from NaF-loaded core-shell nanofibers and the corresponding composites, which was quite different from the case of embedding NaF nanocrystals into the dental resin directly. The study demonstrated that NaF-loaded PAN-PMMA core-shell nanofibers were not only able to improve the mechanical properties of restorative resin, but also able to provide sustained fluoride release to help in preventing secondary caries. © 2013.
International Nuclear Information System (INIS)
Pronyaev, V.G.
2003-01-01
Data fitting with GMA and GLUCS gives consistent results. Difference in the evaluated central values obtained with different formalisms can be related to the general accuracy with which fits could be done in different formalisms. It has stochastic nature and should be accounted in the final results of the data evaluation as small SERC uncertainty. Some shift in central values of data evaluated with GLUCS and GMA relative the central values evaluated with the R-matrix model code RAC is observed for cases of fitting strongly varying data and is related to the PPP. The procedure of evaluation, free from PPP, should be elaborated. (author)
Nakatani, Kiyoharu; Yamashita, Jun; Sekine, Tomomi; Toriumi, Minoru; Itani, Toshiro
2003-05-01
The dissociation of t-butyl methacrylate-methacrylic acid copolymers in dimethyl sulfoxide was analyzed by a nonaqueous potentiometric titration technique. The negative logarithm of the dissociation constant of the monomer unit of a methacrylic acid (MAA) monotonously increased with the increasing degree of dissociation corresponding to the titrant/MAA amount ratio, and was highly influenced by the copolymerization ratio. The results are discussed in terms of the suppression of the dissociation of MAA by a neighboring charged methacrylate anion unit.
Directory of Open Access Journals (Sweden)
Weih, Markus
2013-05-01
Full Text Available [english] The German graduate medical education system is going through an important phase of changes. Besides the ongoing reform of the national guidelines for graduate medical education (Musterweiterbildungsordnung, other factors like societal and demographic changes, health and research policy reforms also play a central role for the future and competitiveness of graduate medical education.With this position paper, the committee on graduate medical education of the Society for Medical Education (GMA would like to point out some central questions for this process and support the current discourse.As an interprofessional and interdisciplinary scientific society, the GMA has the resources to contribute in a meaningful way to an evidence-based and future-oriented graduate medical education strategy.In this position paper, we use four key questions with regards to educational goals, quality assurance, teaching competence and policy requirements to address the core issues for the future of graduate medical education in Germany. The GMA sees its task in contributing to the necessary reform processes as the only German speaking scientific society in the field of medical education.[german] Die ärztliche Weiterbildung in Deutschland befindet sich im Umbruch. Neben der aktuellen Reform der Musterweiterbildungsordnung spielen gesellschaftliche, demographische, gesundheits- und forschungspolitische Faktoren eine wichtige Rolle für die Zukunft und Konkurrenzfähigkeit der ärztlichen Weiterbildung.Der Ausschuss für Weiterbildung der Gesellschaft für Medizinische Ausbildung (GMA möchte mit diesem Positionspapier auf zentrale Fragen in diesem Prozess aufmerksam machen und Impulse für den aktuellen Diskurs geben.Dabei kann die GMA als interdisziplinäre und interprofessionelle Fachgesellschaft wichtige Beiträge zu einer evidenzbasierten und zukunftsorientierten Weiterbildungsstrategie liefern.Im vorliegenden Papier werden anhand von vier Leitfragen zu
Directory of Open Access Journals (Sweden)
Ayub Irmadani Anwar
2016-06-01
Full Text Available Pit and fissure sealant applications is one way to prevent caries. One of the effective ingredient as a pit and fissure sealant is a Bis-GMA resin. One of the active components of Bis-GMA resin is sodium fluoride, which is capable of releasing fluoride ions to the tooth surface and able to improve the repair and remineralization process through the replacement of calcium and phosphate ions found in saliva to increase the pH of saliva. This study was to determine the effect of pit and fissure sealant applications made from Bis-GMA resin to pH of saliva in children aged 6-12 years. The study design is pre and post test with control group design. Saliva samples were derived from 15 pediatric patients has met the criteria. The pH of saliva were taken before and after the application of pit and fissure sealant made from Bis-GMA and measured with pH meter. This study used a non-parametric test, the Wilcoxon Signed Rank test. The results of this study are also supported by the results of statistical tests showed p-: 0.005 (p<0.05 value, which means that there are significant differences in pH of saliva before and after the application of pit and fissure sealant made from Bis-GMA resin.
Energy Technology Data Exchange (ETDEWEB)
Drozdova, Maria G., E-mail: drozdovamg@gmail.com [Polymers for Biology Laboratory, Shemyakin & Ovchinnikov Institute of Bioorganic Chemistry of Russian Academy of Sciences, Miklukho-Maklaya str., 16/10, Moscow 117997 (Russian Federation); Zaytseva-Zotova, Daria S. [Polymers for Biology Laboratory, Shemyakin & Ovchinnikov Institute of Bioorganic Chemistry of Russian Academy of Sciences, Miklukho-Maklaya str., 16/10, Moscow 117997 (Russian Federation); Akasov, Roman A. [Polymers for Biology Laboratory, Shemyakin & Ovchinnikov Institute of Bioorganic Chemistry of Russian Academy of Sciences, Miklukho-Maklaya str., 16/10, Moscow 117997 (Russian Federation); Sechenov First Moscow State Medical University, Institute for Regenerative Medicine, Trubetskaya str., 8/2, Moscow 119048 (Russian Federation); Golunova, Anna S.; Artyukhov, Alexander A. [D. Mendeleyev University of Chemical Technology of Russia, Miusskaya Square 9, Moscow 125047 (Russian Federation); Udartseva, Olga O.; Andreeva, Elena R. [Institute of Biomedical Problems of Russian Academy of Sciences, Khoroshevskoe Shosse 76a, Moscow 123007 (Russian Federation); Lisovyy, Denis E.; Shtilman, Michael I. [D. Mendeleyev University of Chemical Technology of Russia, Miusskaya Square 9, Moscow 125047 (Russian Federation); Markvicheva, Elena A. [Polymers for Biology Laboratory, Shemyakin & Ovchinnikov Institute of Bioorganic Chemistry of Russian Academy of Sciences, Miklukho-Maklaya str., 16/10, Moscow 117997 (Russian Federation)
2017-06-01
Poly(vinyl alcohol) (PVA) hydrogels are widely employed for various biomedical applications, including tissue engineering, due to their biocompatibility, high water solubility, low protein adsorption, and chemical stability. However, non-charged surface of PVA-based hydrogels is not optimal for cell adhesion and spreading. Here, cross-linked macroporous hydrogels based on low molecular weight acrylated PVA (Acr-PVA) was synthesized by modification of the pendant alcohol groups on the PVA with glycidyl methacrylate (GMA). To enhance cell affinity, charged groups were introduced to the hydrogel composition. For this purpose, Acr-PVA was copolymerized with either negatively charged acrylic acid (AA) or positively charged 2-(diethylamino) ethyl methacrylate (DEAEMA) monomers. A surface charge of the obtained hydrogels was found to be in function of the co-monomer type and content. Confocal microscopy observations confirmed that adhesion and spreading of both mouse fibroblasts (L929) and human mesenchymal stem cells (hMSC) on the modified Acr-PVA-AA and Acr-PVA-DEAEMA hydrogels were better than those on the non-modified Acr-PVA hydrogel. The increase of DEAEMA monomer content from 5 to 15 mol% resulted in the enhancement of cell viability which was 1.5-fold higher for Acr-PVA-DEAEMA-15 hydrogel than that of the non-modified Acr-PVA hydrogel sample. - Highlights: • To enhance cell affinity, acrylated PVA hydrogel was modified with AA or DEAEMA monomers. • Cell adhesion and spreading were found to depend on the co-monomer type and content. • Proliferation of L929 fibroblasts and stem cells increased on the modified hydrogels.
International Nuclear Information System (INIS)
Drozdova, Maria G.; Zaytseva-Zotova, Daria S.; Akasov, Roman A.; Golunova, Anna S.; Artyukhov, Alexander A.; Udartseva, Olga O.; Andreeva, Elena R.; Lisovyy, Denis E.; Shtilman, Michael I.; Markvicheva, Elena A.
2017-01-01
Poly(vinyl alcohol) (PVA) hydrogels are widely employed for various biomedical applications, including tissue engineering, due to their biocompatibility, high water solubility, low protein adsorption, and chemical stability. However, non-charged surface of PVA-based hydrogels is not optimal for cell adhesion and spreading. Here, cross-linked macroporous hydrogels based on low molecular weight acrylated PVA (Acr-PVA) was synthesized by modification of the pendant alcohol groups on the PVA with glycidyl methacrylate (GMA). To enhance cell affinity, charged groups were introduced to the hydrogel composition. For this purpose, Acr-PVA was copolymerized with either negatively charged acrylic acid (AA) or positively charged 2-(diethylamino) ethyl methacrylate (DEAEMA) monomers. A surface charge of the obtained hydrogels was found to be in function of the co-monomer type and content. Confocal microscopy observations confirmed that adhesion and spreading of both mouse fibroblasts (L929) and human mesenchymal stem cells (hMSC) on the modified Acr-PVA-AA and Acr-PVA-DEAEMA hydrogels were better than those on the non-modified Acr-PVA hydrogel. The increase of DEAEMA monomer content from 5 to 15 mol% resulted in the enhancement of cell viability which was 1.5-fold higher for Acr-PVA-DEAEMA-15 hydrogel than that of the non-modified Acr-PVA hydrogel sample. - Highlights: • To enhance cell affinity, acrylated PVA hydrogel was modified with AA or DEAEMA monomers. • Cell adhesion and spreading were found to depend on the co-monomer type and content. • Proliferation of L929 fibroblasts and stem cells increased on the modified hydrogels.
40 CFR 721.9492 - Polymers of styrene, cyclohexyl methacrylate and substituted methacrylate.
2010-07-01
... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Polymers of styrene, cyclohexyl... Significant New Uses for Specific Chemical Substances § 721.9492 Polymers of styrene, cyclohexyl methacrylate...) The chemical substances identified generically as polymers of styrene, cyclohexyl methacrylate and...
Kiesewetter, Jan; Drossard, Sabine; Gaupp, Rainer; Baschnegger, Heiko; Kiesewetter, Isabel; Hoffmann, Susanne
2018-01-01
The topic of patient safety is of fundamental interest for the health care sector. In view of the realisation of the National Competence-Based Learning Objectives Catalogue for Undergraduate Medical Education (NKLM) this topic now has to be prepared for medical education. For a disciplinary and content-related orientation the GMA Committee developed the Learning Objectives Catalogue Patient Safety for Undergraduate Medical Education (GMA-LZK). To ensure an optimal implementation of the GMA-LZK we recommend a longitudinal embedding into the existing curriculum. This position paper supports the implementation of the GMA-LZK and is aimed at everyone who wants to establish teaching courses on the topic patient safety and embed them in the curriculum. In light of this, we will initially describe the key features for a structured analysis of the current situation. Based on three best-practice-examples, as seen in the faculties of Freiburg, Bonn and Munich, different approaches to the implementation of the GMA-LZK will be illustrated. Lastly, we will outline the methodical requirements regarding the curriculum development as well as the disciplinary and methodical competences that the lecturers will have to hold or develop to fulfil the requirements.
Directory of Open Access Journals (Sweden)
Kyo-Il Kim
2009-08-01
Full Text Available A multi-walled nanotube (MWNT ionic liquid was prepared by the immobilization of 1-butylimidazole bromide onto an epoxy group on a poly(glycidyl methacrylate-grafted MWNT, which was synthesized by radiation-induced graft polymerization of glycidyl methacrylate onto MWNT in an aqueous solution. Subsequently, a MWNT ionic liquid electrode was fabricated by hand-casting MWNT ionic liquid, tyrosinase, and chitosan solution as a binder on indium tin oxide (ITO glass. The sensing ranges of the MWNT ionic liquid electrode with immobilized tyrosinase was in the range of 0.01-0.08 mM in a phosphate buffer solution. The optimal conditions such as pH, temperature, and effects of different phenolic compounds were determined. The total phenolic compounds of three commercial red wines were also determined on the tyrosinase-immobilized biosensor.
International Nuclear Information System (INIS)
Lu Zhaoxin; Fujimura, Takashi
1993-01-01
Polymer carriers, poly(hydroxyethyl acrylate(HEA)-methoxy polyethylene glycol methylacrylate (M-23G)) and poly(hydroxyethyl acrylate(HEA)-glycidyl methylacrylate (GMA)) used for the immobilization of yeast cells were prepared by radiation polymerization at low temperature. Yeast cells were immobilized through adhesion and multiplication of yeast cells. The ethanol productivity of immobilized yeast cells with these carriers was related to the monomer composition of polymers and the optimum monomer composition was 20%:10% in poly(HEA-M-23G) and 17%:6% in poly(HEA-GMA). In this case, the ethanol productivity of immobilized yeast cells was about 4 times that of cells in free system. The relationship between the activity of immobilized yeast cells and the water content of the polymer carrier were also discussed. (author)
International Nuclear Information System (INIS)
Xin, Zhirong; Du, Shanshan; Zhao, Chunyu; Chen, Hao; Sun, Miao; Yan, Shunjie; Luan, Shifang; Yin, Jinghua
2016-01-01
Graphical abstract: - Highlights: • PNVP and PHMG components were covalently immobilized on PP_N_W_F surface. • PP_N_W_F-g-PNVP-PHMG possessed bacterial adhesion-resistant and bactericidal capabilities. • PP_N_W_F-g-PNVP-PHMG obviously suppressed platelet and red blood cell adhesion. - Abstract: A growing number of wound dressing-related nosocomial infections necessitate the development of novel antibacterial strategies. Herein, polypropylene non-woven fabric (PP_N_W_F) was facilely modified with passive and active antibacterial components, namely photografting polymerization both N-Vinyl-2-pyrrolidone (NVP) and glycidyl methacrylate (GMA) monomers, and the introduction of guanidine polymer through the reaction between active amino groups and epoxy groups. The modified samples were confirmed by attenuated total reflectance Fourier transform infrared spectroscopy (ATR-FTIR), X-ray photoelectron spectroscopy (XPS), respectively. Water contact angle measurement, antibacterial test, platelet and red blood cell adhesion were used to evaluate the hydrophilicity, antibacterial properties and hemocompatibility of the samples. It was found that the antibacterial properties were obviously enhanced, meanwhile significantly suppressing platelet and red blood cell adhesion after the above modification. This PP_N_W_F samples that possess antifouling and antimicrobial properties, have great potential in wound dressing applications.
Flexural behaviour of post-cured composites at oral-simulating temperatures.
Ho, C T; Vijayaraghavan, T V; Lee, S Y; Tsai, A; Huang, H M; Pan, L C
2001-07-01
Post-curing treatments have been known to improve the mechanical stability of visible light-cured composites. After individual post-curing treatment, the flexural strength (FS) of four commercial direct/indirect placement composite materials which differ greatly in composition [oligocarbonate dimethacrylate (OCDMA)-based Conquest C & B (CQT), Bisphenol-A glycidyl dimethacrylate (BisGMA)-based Charisma, urethane dimethacrylate (UDMA)-based Concept (CCT), and BisGMA/UDMA-based Dentacolor] was evaluated under water in the temperature range of 12-50 degrees C. A control series was tested in air at room temperature (25 +/- 1 degrees C). Data were analysed using ANOVA and Duncan's test. Flexural strengths overall decreased (20-40%, P OCDMA-based materials. Post-cured composites can be significantly affected by exposure to oral environments. Different composition determines the degree of influence.
Sohn, Eun-Ho; Ha, Jong-Wook; Lee, Soo-Bok; Park, In Jun
2016-09-27
To control the surface properties of a commonly used polymer, poly(methyl methacrylate) (PMMA), poly(perfluoromethyl methacrylate)s (PFMMAs) with short perfluorinated side groups (i.e., -CF3, -CF2CF3, -(CF3)2, -CF2CF2CF3) were used as blend components because of their good solubility in organic solvents, low surface energies, and high optical transmittance. The surface energies of the blend films of PFMMA with the -CF3 group and PMMA increased continuously with increasing PMMA contents from 17.6 to 26.0 mN/m, whereas those of the other polymer blend films remained at very low levels (10.2-12.6 mN/m), similar to those of pure PFMMAs, even when the blends contained 90 wt %PMMA. Surface morphology and composition measurements revealed that this result originated from the different blend structures, such as lateral and vertical phase separations. We expect that these PFMMAs will be useful in widening the applicable window of PMMA.
Tsarevsky, Nicolay V.; Woodruf, Shannon R.; Wisian-Neilson, Patty J.
2016-01-01
A two-session experiment is designed to introduce undergraduate students to concepts in catalysis, transition metal complexes, polymer synthesis, and postpolymerization modifications. In the first session, students synthesize poly(glycidyl methacrylate) via low-catalyst-concentration atom transfer radical polymerization (ATRP). The…
Process for production of an alkyl methacrylate
Eastham, Graham Ronald; Johnson, David William; Fraaije, Marco; Winter, Remko
2015-01-01
A process for the production of an alkyl methacrylate, particularly methyl methacrylate, is provided, in which a Baeyer-Villiger Monooxygenase enzyme is used to convert an alkylisopropenylketone substrate to the relevant alkyl methacrylate by abnormal asymmetric oxygen insertion. The invention
Steinhaus, Johannes; Hausnerova, Berenika; Haenel, Thomas; Selig, Daniela; Duvenbeck, Fabian; Moeginger, Bernhard
2016-07-01
Shear viscosity and ion viscosity of uncured visible light-curing (VLC) resins and resin based composites (RBC) are correlated with respect to the resin composition, temperature and filler content to check where Dielectric Analysis (DEA) investigations of VLC RBC generate similar results as viscosity measurements. Mixtures of bisphenol A glycidyl methacrylate (Bis-GMA) and triethylene glycol dimethacrylate (TEGDMA) as well as the pure resins were investigated and compared with two commercial VLC dental resins and RBCs (VOCO, Arabesk Top and Grandio). Shear viscosity data was obtained using a Haake Mars III, Thermo Scientific. Ion viscosity measurements performed by a dielectric cure analyzer (DEA 231/1 Epsilon with Mini IDEX-Sensor, Netzsch-Gerätebau). Shear viscosity depends reciprocally on the mobility of molecules, whereas the ion viscosity also depends on the ion concentration as it is affected by both ion concentration and mixture viscosity. Except of pure TEGDMA, shear and ion viscosities depend on the resin composition qualitatively in a similar manner. Furthermore, shear and ion viscosities of the commercial VLC dental resins and composites exhibited the same temperature dependency regardless of filler content. Application of typical rheological models (Kitano and Quemada) revealed that ion viscosity measurements can be described with respect to filler contents of up to 30vol.%. Rheological behavior of a VLC RBC can be characterized by DEA under the condition that the ion concentration is kept constant. Both methods address the same physical phenomenon - motion of molecules. The proposed relations allows for calculating the viscosity of any Bis-GMA-TEGDMA mixture on the base of the viscosities of the pure components. This study demonstrated the applicability of DEA investigations of VLC RBCs with respect to quality assurance purposes. Copyright © 2016 The Academy of Dental Materials. Published by Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Gamze Barim
2014-01-01
Full Text Available Methacrylates have high glass transition temperature (Tg values and high thermal stability. A new methacrylate copolymer, poly(4-acetylphenyl methacrylate-co-ethyl methacrylate (APMA-co-EMA, was synthesized. The thermal behaviors of copolymers were investigated by differential scanning calorimetry and thermogravimetric analysis. They behaved as new single polymers with single Tg’s and the thermal stability of the copolymers increased with increasing 4-acetylphenyl methacrylate (APMA fraction, leading to the manufacture of copolymers with desired Tg values. Structure and composition of copolymers for a wide range of monomer feed ratios were determined by Fourier transform infrared (FT-IR and 1H-nuclear magnetic resonance (1H-NMR spectroscopic techniques. Copolymerization reactions were continued up to 40% conversions. The monomer reactivity ratios for copolymer system were determined by the Kelen-Tüdös (ra(APMA=0.81; rb(EMA=0.61 and extended Kelen-Tüdös (ra=0.77; rb=0.54 methods and a nonlinear least squares (ra=0.74; rb=0.49 method.
Multifunctional poly(alkyl methacrylate) films for dental care
International Nuclear Information System (INIS)
Nielsen, Birthe V; Nevell, Thomas G; Barbu, Eugen; Smith, James R; Tsibouklis, John; Rees, Gareth D
2011-01-01
Towards the evaluation of non-permanent dental coatings for their capacity to impart dental-care benefits, thin films of a homologous series of comb-like poly(alkyl methacrylate)s (ethyl to octadecyl) have been deposited, from aqueous latex formulations, onto dentally relevant substrates. AFM studies have shown that the thickness (40-300 nm) and surface roughness (8-12 nm) of coherent polymer films are influenced by the degree of polymerization and by the length of the pendant chain. Of the polymers under consideration, poly(butyl methacrylate) formed a close-packed film that conferred to dental substrates a high degree of inhibition to acid-mediated erosion (about 27%), as evaluated by released-phosphate determinations. The potential utility of the coatings to act as anti-sensitivity barriers has been evaluated by determining the hydraulic conductance of coated bovine-dentine substrates; single treatments of dentine discs with poly(butyl methacrylate) or with poly(ethyl methacrylate) effected mean respective reductions in fluid flow of about 23% with respect to water-treated controls; repeated applications of the poly(butyl methacrylate) latex led to mean reductions in fluid flow of about 80%. Chromometric measurements have shown that pellicle-coated hydroxyapatite discs treated with poly(butyl methacrylate), poly(hexyl methacrylate) or poly(lauryl methacrylate) exhibit significant resistance to staining by food chromogens.
Multifunctional poly(alkyl methacrylate) films for dental care
Energy Technology Data Exchange (ETDEWEB)
Nielsen, Birthe V; Nevell, Thomas G; Barbu, Eugen; Smith, James R; Tsibouklis, John [School of Pharmacy and Biomedical Sciences, University of Portsmouth, Portsmouth, Hampshire, PO1 2DT (United Kingdom); Rees, Gareth D [GlaxoSmithKline R and D, St George' s Avenue, Weybridge, Surrey, KT13 0DE (United Kingdom)
2011-02-15
Towards the evaluation of non-permanent dental coatings for their capacity to impart dental-care benefits, thin films of a homologous series of comb-like poly(alkyl methacrylate)s (ethyl to octadecyl) have been deposited, from aqueous latex formulations, onto dentally relevant substrates. AFM studies have shown that the thickness (40-300 nm) and surface roughness (8-12 nm) of coherent polymer films are influenced by the degree of polymerization and by the length of the pendant chain. Of the polymers under consideration, poly(butyl methacrylate) formed a close-packed film that conferred to dental substrates a high degree of inhibition to acid-mediated erosion (about 27%), as evaluated by released-phosphate determinations. The potential utility of the coatings to act as anti-sensitivity barriers has been evaluated by determining the hydraulic conductance of coated bovine-dentine substrates; single treatments of dentine discs with poly(butyl methacrylate) or with poly(ethyl methacrylate) effected mean respective reductions in fluid flow of about 23% with respect to water-treated controls; repeated applications of the poly(butyl methacrylate) latex led to mean reductions in fluid flow of about 80%. Chromometric measurements have shown that pellicle-coated hydroxyapatite discs treated with poly(butyl methacrylate), poly(hexyl methacrylate) or poly(lauryl methacrylate) exhibit significant resistance to staining by food chromogens.
Stereosequence distributions of poly(t-butyl methacrylate)s prepared with butyllithium
International Nuclear Information System (INIS)
Suzuki, Toshimitsu; Yamada, Osamu; Watanabe, Yoshihisa; Takegami, Yoshinobu
1982-01-01
13 C NMR spectra of poly(t-butyl methacrylate)s (PBMA) prepared with butyl-lithium (n-BuLi) were studied. Methylene carbon resonances appeared as five overlapped peaks, which were interpreted as a combination of hexad stereosequence distributions. The stereosequence distribution of PBMA prepared with n-BuLi at -78 0 C obeyed the first order Markov chain model even polymerized in tetrahydrofuran (THF). Syndiotactic PBMA was obtained with azobisisobutyronitrile (AIBN) as the initiator, and the stereosequence distribution of this polymer agreed well with Bernoullian statistics. (author)
Preparation of Affinity Column Based on Zr{sup 4+} Ion for Phosphoproteins Isolation
Energy Technology Data Exchange (ETDEWEB)
Lee, Seon Mi; Bae, In Ae; Park, Jung Hyen; Kim, Tae Dong; Choi, Seong Ho [Hannam University, Daejeon (Korea, Republic of)
2009-06-15
This paper has described about preparation of Zr{sup 4+} affinity column based on the poly(styreneco- glycidyl methacrylate) prepared by emulsion polymerization of styrene and glycidyl methacrylate in order to isolate phosphopeptide. The Zr{sup 4+} ions were introduced after the phophonation of an epoxy group on polymeric microspheres. The successful preparation of Zr{sup 4+}-immobilized polymeric microsphere stationary phase was confirmed through Fourier transform infrared spectra, optical microscopy, scanning electron microscopy, X-ray photoelectron spectra and inductively coupled plasma-atomic emission spectrometer. The separation efficiency for Zr{sup 4+} affinity column prepared by slurry packing was tested to phosphonated casein and dephosphonated casein. The resolution time (min) of the phosphonated casein was higher than that of dephosphated casein for Zr{sup 4+} affinity polymeric microsphere by liquid chromatography. This Zr{sup 4+} affinity column can be used for isolation of phosphonated casein from casein using liquid chromatography.
Preparation of Affinity Column Based on Zr4+ Ion for Phosphoproteins Isolation
International Nuclear Information System (INIS)
Lee, Seon Mi; Bae, In Ae; Park, Jung Hyen; Kim, Tae Dong; Choi, Seong Ho
2009-01-01
This paper has described about preparation of Zr 4+ affinity column based on the poly(styreneco- glycidyl methacrylate) prepared by emulsion polymerization of styrene and glycidyl methacrylate in order to isolate phosphopeptide. The Zr 4+ ions were introduced after the phophonation of an epoxy group on polymeric microspheres. The successful preparation of Zr 4+ -immobilized polymeric microsphere stationary phase was confirmed through Fourier transform infrared spectra, optical microscopy, scanning electron microscopy, X-ray photoelectron spectra and inductively coupled plasma-atomic emission spectrometer. The separation efficiency for Zr 4+ affinity column prepared by slurry packing was tested to phosphonated casein and dephosphonated casein. The resolution time (min) of the phosphonated casein was higher than that of dephosphated casein for Zr 4+ affinity polymeric microsphere by liquid chromatography. This Zr 4+ affinity column can be used for isolation of phosphonated casein from casein using liquid chromatography
Pratt, J. R.
1981-01-01
Eight glycidyl amines were prepared by alkylating the parent amine with epichlorohydrin to form chlorohydrin, followed by cyclization with aqueous NaOH. Three of these compounds contained propargyl groups with postcuring studies. A procedure for quantitatively estimating the epoxy content of these glycidyl amines was employed for purity determination. Two diamond carbonates and several model propargly compounds were prepared. The synthesis of three new diamines, two which contain propargyloxy groups, and another with a sec-butyl group is in progress. These materials are at the dinitro stage ready for the final hydrogenation step. Four aromatic diamines were synthesized for mutagenic testing purposes. One of these compounds rapidly decomposes on exposure to air.
Formation of interfacial network structure via photo-crosslinking in carbon fiber/epoxy composites
Directory of Open Access Journals (Sweden)
S. H. Deng
2014-07-01
Full Text Available A series of diblock copolymers (poly(n-butylacrylate-co-poly(2-hydroxyethyl acrylate-b-poly(glycidyl methacrylate ((PnBA-co-PHEA-b-PGMA, containing a random copolymer block PnBA-co-PHEA, were successfully synthesized by atom transfer radical polymerization (ATRP. After being chemically grafted onto carbon fibers, the photosensitive methacrylic groups were introduced into the random copolymer, giving a series of copolymers (poly(n-butylacrylate-co-poly(2-methacryloyloxyethyl acrylate-b-poly(glycidyl methacrylate((PnBA-co-PMEA-b-PGMA. Dynamic mechanical analysis indicated that the random copolymer block after ultraviolet (UV irradiation was a lightly crosslinked polymer and acted as an elastomer, forming a photo-crosslinked network structure at the interface of carbon fiber/epoxy composites. Microbond test showed that such an interfacial network structure greatly improved the cohesive strength and effectively controlled the deformation ability of the flexible interlayer. Furthermore, three kinds of interfacial network structures, i physical crosslinking by H-bonds, ii chemical crosslinking by photopolymerization, and iii interpenetrating crosslinked network by photopolymerization and epoxy curing reaction were received in carbon fiber/epoxy composite, depending on the various preparation processes.
2010-07-01
... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Fatty acid, reaction product with... Specific Chemical Substances § 721.6181 Fatty acid, reaction product with substituted oxirane, formaldehyde... as fatty acid, reaction product with substituted oxirane, formaldehyde-phenol polymer glycidyl ether...
Scalability tests of R-GMA based Grid job monitoring system for CMS Monte Carlo data production
Bonacorsi, D; Field, L; Fisher, S; Grandi, C; Hobson, P R; Kyberd, P; MacEvoy, B; Nebrensky, J J; Tallini, H; Traylen, S
2004-01-01
High Energy Physics experiments such as CMS (Compact Muon Solenoid) at the Large Hadron Collider have unprecedented, large-scale data processing computing requirements, with data accumulating at around 1 Gbyte/s. The Grid distributed computing paradigm has been chosen as the solution to provide the requisite computing power. The demanding nature of CMS software and computing requirements, such as the production of large quantities of Monte Carlo simulated data, makes them an ideal test case for the Grid and a major driver for the development of Grid technologies. One important challenge when using the Grid for large-scale data analysis is the ability to monitor the large numbers of jobs that are being executed simultaneously at multiple remote sites. R-GMA is a monitoring and information management service for distributed resources based on the Grid Monitoring Architecture of the Global Grid Forum. In this paper we report on the first measurements of R-GMA as part of a monitoring architecture to be used for b...
International Nuclear Information System (INIS)
Pastor, S.D.
1979-01-01
A novel class of photosensitive polymers are disclosed which are prepared by the reaction, preferably in the presence of a catalyst, of a reactive polymer, a halogenated cyclic anhydride and glycidyl ester of an alpha, beta-unsaturated carboxylic acid. These polymers are capable of undergoing vinyl-type polymerization when exposed to actinic radiation
Miksa, B; Wilczynska, M; Cierniewski, C; Basinska, T; Slomkowski, S
1995-01-01
Poly(methyl methacrylate-methacrylic acid-2-hydroxyethyl methacrylate) latex (ACRYLAT) was synthesized by radical precipitation polymerization. The mass median diameter (MMD) and the geometrical standard deviation (GSD) of the ACRYLAT particles were 138 nm and 1.2, respectively. The concentration of the titrable carboxylic groups in the surface layer of latex particles was equal to 8.41 x 10(-6) mol m-2. Latex was able to bind up to 2.82 x 10(-7) mol of 1-aminopyrene per 1 m2 of the surface of the latex particles due to the ionic interactions between carboxylate anions and ammonium cations of protonated 1-aminopyrene. ACRYLAT was able to immobilize covalently human serum albumin in amounts up to 0.23 mg m-2. Aggregation of ACRYLAT with immobilized HSA, induced with specific antibodies (anti-HSA), was investigated turbidimetrically. The results indicated that in the model turbidimetric immunoassay, ACRYLAT coated with HSA can be used for the detection of anti-HSA in the goat anti-HSA serum diluted from 50 to 7000-fold. Immobilization of rabbit antibodies to plasminogen (anti-Plg) to ACRYLAT via the epsilon-aminocaproic acid linkers provided particles which were used for the development of the turbidimetric immunoassay for plasminogen. In this assay plasminogen could be detected in concentration ranging from 0.75 to 75 micrograms ml-1 in the blood plasma.
International Nuclear Information System (INIS)
Tavares, Maria Ines B.; Mansur, Claudia R.E.; Monteiro, Elisabeth E.C.
1997-01-01
Several methyl-methacrylate/methacrylic acid copolymers were prepared in the presence of concentrated nitric acid. The obtained copolymers were characterized by molecular weigh determination and hydrolization degree. The molecular mobility of these copolymers was studied by solid state nuclear magnetic resonance. Results are presented
Process for producing a coating composition. [electron beam irradiation
Energy Technology Data Exchange (ETDEWEB)
Kimura, T; Harada, H; Kobayashi, S; Nakamoto, H; Sunano, K
1968-07-19
An easily hardenable acrylic coating composition is produced by irradiation with low energy electron beams to economize the industrial application of the composition. A polymer with molecular weights in the 5,000 to 500,000 range is composed of 1 to 40% by weight of a vinyl monomer containing a glycidyl radical, 30 to 99% of a methacrylic monomer and 0 to 69% of other copolymerizable vinyl monomers. This polymer dissolves in a monomer containing at least 30% of an acrylic monomer and 70% of other vinyl monomers. The reaction takes place between 0.1 to 1.0 mole of vinyl monomer containing a carboxyl radical and one mole of glycidyl radical in the solution. In an embodiment, 17.5% by weight of glycidyl methacrylate and 82.5% of alkyl acrylate are polymerized in suspension in the presence of a catalyst to form a bead like polymer with molecular weights in the 5,000 to 500,000 range. After 120 parts of the bead like polymer are dissolved in 180 parts of the acrylic monomer in the presence of a polymerization inhibitor by heating, 22 parts of ..cap alpha.., ..beta..- unsaturated monocarboxylic acid are added to the solution to react with the glycidyl radical, whereby a non-solvent type coating material containing the polymer having a vinyl radical side chain is produced. In the place of the catalyst, electron beams can be used at an energy level of 0.1 to 20 MeV. The dose rate may be in the range of 0.1 to 2.0 Mrad/sec.
Wydra, James W; Cramer, Neil B; Stansbury, Jeffrey W; Bowman, Christopher N
2014-06-01
A model BisGMA/TEGDMA unfilled resin was utilized to investigate the effect of varied irradiation intensity on the photopolymerization kinetics and shrinkage stress evolution, as a means for evaluation of the reciprocity relationship. Functional group conversion was determined by FTIR spectroscopy and polymerization shrinkage stress was obtained by a tensometer. Samples were polymerized with UV light from an EXFO Acticure with 0.1wt% photoinitiator. A one-dimensional kinetic model was utilized to predict the conversion-dose relationship. As irradiation intensity increased, conversion decreased at a constant irradiation dose and the overall dose required to achieve full conversion increased. Methacrylate conversion ranged from 64±2% at 3mW/cm(2) to 78±1% at 24mW/cm(2) while the final shrinkage stress varied from 2.4±0.1MPa to 3.0±0.1MPa. The ultimate conversion and shrinkage stress levels achieved were dependent not only upon dose but also the irradiation intensity, in contrast to an idealized reciprocity relationship. A kinetic model was utilized to analyze this behavior and provide theoretical conversion profiles versus irradiation time and dose. Analysis of the experimental and modeling results demonstrated that the polymerization kinetics do not and should not be expected to follow the reciprocity law behavior. As irradiation intensity is increased, the overall dose required to achieve full conversion also increased. Further, the ultimate conversion and shrinkage stress that are achieved are not dependent only upon dose but rather upon the irradiation intensity and corresponding polymerization rate. Copyright © 2014 Academy of Dental Materials. Published by Elsevier Ltd. All rights reserved.
Vaidyanathan, Tritala K; Vaidyanathan, Jayalakshmi
2015-12-01
Objective : The goal of this study was to characterize the light curing characteristics of a new oligomer PEM-665 designed to be used as an alternative monomer to BisGMA. Materials and methods : PEM-665 (P) and BisGMA (B) solutions were prepared with triethylene glycol dimethacrylate (T) diluent in different weight proportions (70/30 and 50/50). Solutions containing 70% P and 30% T were designated as 70PT, 70%B and 30%T as 70BT, 50%P and 50%T as 50PT and 50%B and 50%T as 50BT. The initiators were CQ (EDMAB was used as amine accelerator for CQ) and DPO in 1% concentration. Eight solutions were prepared in a factorial design: 70PT/DPO; 70PT/CQ; 50PT/DPO; 50PT/CQ; 70BT/DPO; 70BT/CQ; 50BT/DPO; 50BT/CQ. BISCO VIP visible light was used to cure the monomer solutions using 30 s exposure time and 400 W power setting. TA Instruments Differential Scanning Calorimeter (DSC 2910) was used to determine the heat of cure (J/g) during polymerization at 37 °C, from which molar heat of cure (kJ/mole) and %Conversion values were estimated. Results : Range of mean values as a function monomer selections were: heat of cure (J/g): 161.7 for 70PT/DPO system to 198.6 for 50BT/CQ system; molar heat of cure (kJ/mole): 67.3 for 70BT/DPO to 78.86 for 50PT/CQ; % conversion: 59.9 for 70BT/DPO to 70.3 for 50PT/CQ. Analysis of variance and Tukey HSD pairwise contrast showed statistically significant differences between % conversion means of PEM and BisGMA mixtures, with PEM mixtures showing significantly higher mean values. Conclusions : The results suggest that PEM-665 is a promising candidate material for dental polymer applications.
Directory of Open Access Journals (Sweden)
Izabela Barszczewska-Rybarek
2015-03-01
Full Text Available The effect of various dimethacrylates on the structure and properties of homo- and copolymer networks was studied. The 2,2-bis-[4-(2-hydroxy-3- methacryloyloxypropoxyphenyl]-propane (Bis-GMA, triethylene glycol dimethacrylate (TEGDMA and 1,6-bis-(methacryloyloxy-2-ethoxycarbonylamino-2,4,4-trimethylhexane (HEMA/TMDI, all popular in dentistry, as well as five urethane-dimethacrylate (UDMA alternatives of HEMA/TMDI were used as monomers. UDMAs were obtained from mono-, di- and tri(ethylene glycol monomethacrylates and various commercial diisocyanates. The chemical structure, degree of conversion (DC and scanning electron microscopy (SEM fracture morphology were related to the mechanical properties of the polymers: flexural strength and modulus, hardness, as well as impact strength. Impact resistance was widely discussed, being lower than expected in the case of poly(UDMAs. It was caused by the heterogeneous morphology of these polymers and only moderate strength of hydrogen bonds between urethane groups, which was not high enough to withstand high impact energy. Bis-GMA, despite having the highest polymer morphological heterogeneity, ensured fair impact resistance, due to having the strongest hydrogen bonds between hydroxyl groups. The TEGDMA homopolymer, despite being heterogeneous, produced the smoothest morphology, which resulted in the lowest brittleness. The UDMA monomer, having diethylene glycol monomethacrylate wings and the isophorone core, could be the most suitable HEMA/TMDI alternative. Its copolymer with Bis-GMA and TEGDMA had improved DC as well as all the mechanical properties.
Leigh, Jessica K; MacMahon, Shaun
2016-12-14
A method was developed for the extraction of fatty acid esters of 3-chloro-1,2-propanediol (3-MCPD) and glycidol from infant formula, followed by quantitative analysis of the extracts using liquid chromatography-tandem mass spectrometry (LC-MS/MS). These process-induced chemical contaminants are found in refined vegetable oils, and studies have shown that they are potentially carcinogenic and/or genotoxic, making their presence in edible oils (and processed foods containing these oils) a potential health risk. The extraction procedure involves a liquid-liquid extraction, where powdered infant formula is dissolved in water and extracted with ethyl acetate. Following shaking, centrifugation, and drying of the organic phase, the resulting fat extract is cleaned-up using solid-phase extraction and analyzed by LC-MS/MS. Method performance was confirmed by verifying the percent recovery of each 3-MCPD and glycidyl ester in a homemade powdered infant formula reference material. Average ester recoveries in the reference material ranged from 84.9 to 109.0% (0.6-9.5% RSD). The method was also validated by fortifying three varieties of commercial infant formulas with a 3-MCPD and glycidyl ester solution. Average recoveries of the esters across all concentrations and varieties of infant formula ranged from 88.7 to 107.5% (1.0-9.5% RSD). Based on the validation results, this method is suitable for producing 3-MCPD and glycidyl ester occurrence data in all commercially available varieties of infant formula.
International Nuclear Information System (INIS)
Wisniak, Jaime; Peralta, Rene D.; Infante, Ramiro; Cortez, Gladis
2005-01-01
Densities of the binary systems of 1,1-dimethylethyl methyl ether (MTBE) with allyl methacrylate, butyl methacrylate, methacrylic acid, and vinyl acetate have been measured as a function of the composition, at 298.15 and 308.15 K and atmospheric pressure, using an Anton Paar DMA 5000 oscillating U-tube densimeter. The calculated excess molar volumes were correlated with the Redlich-Kister equation and with a series of Legendre polynomials. The excess molar volumes are negative for the binaries of MTBE + methacrylates; the system MTBE with vinyl acetate presents near ideal behavior. The excess coefficient of thermal expansion is positive for all the systems studied here; the value of the coefficient for the system MTBE + allyl methacrylate is at least three times larger than that for the other systems
Wen, Xiufang; Ye, Chao; Cai, Zhiqi; Xu, Shouping; Pi, Pihui; Cheng, Jiang; Zhang, Lijuan; Qian, Yu
2015-06-01
This study focuses on the preparation of superhydrophobic films by crosslinkable polymer material-Poly(methyl methacrylate-butyl acrylate-hydroxyethyl methacrylate)-b-Poly(perfluorohexylethyl methacrylate) (P (MMA-BA-HEMA)-b-PFMA) with a simple one-step casting process. Nanoscale micelle particles with core-shell structure was obtained by dissolving the polymer and curing agent in the mixture of acetone and 1H, 1H, 5H octafluoropentyl-1,1,2,2 tetrafluoroethyl ether (FHT). Superhydrophobic films were fabricated by casting the micelle solution on the glass slides. By controlling the polymer concentration and acetone/FHT volume ratio, superhydrophobic polymer film with water contact angle of 153.2 ± 2.1° and sliding angle of 4° was obtained. By introducing a curing agent into the micelle solution, mechanical properties of the films can be improved. The adhension grade and hardness of the crosslinked superhydrophobic films reached 2 grade and 3H, respectively. The hydrophobicity is attributed to the synergistic effect of micro-submicro-nano-meter scale roughness by nanoscale micelle particles and low surface energy of fluoropolymer. This procedure makes it possible for widespread applications of superhydrophobic film due to its simplicity and practicability.
Radiation cured acrylonitrile--butadiene elastomers
International Nuclear Information System (INIS)
Eldred, R.J.
1976-01-01
In accordance with a preferred embodiment of this invention, the ultimate elongation of an electron beam radiation cured acrylonitrile-butadiene elastomer is significantly increased by the incorporation of a preferred noncrosslinking monomer, glycidyl methacrylate, in combination with the conventional crosslinking monomer, trimethylolpropanetrimethacrylate, prior to the radiation curing process
Biocompatible multi-walled carbon nanotube–CdTe quantum dot–polymer hybrids for medical applications
Energy Technology Data Exchange (ETDEWEB)
Baslak, Canan, E-mail: cananbaslak@gmail.com [Advanced Technology Research and Application Center, Selcuk University, 42075 Konya (Turkey); Department of Chemistry, Faculty of Science, Selcuk University, 42075 Konya (Turkey); Demirel Kars, Meltem, E-mail: dmeltem@yahoo.com [Advanced Technology Research and Application Center, Selcuk University, 42075 Konya (Turkey); Sarayonu Vocational High School, Selcuk University, 42430 Konya (Turkey); Karaman, Mustafa; Kus, Mahmut [Advanced Technology Research and Application Center, Selcuk University, 42075 Konya (Turkey); Department of Chemical Engineering, Faculty of Engineering, Selcuk University, 42075 Konya (Turkey); Cengeloglu, Yunus; Ersoz, Mustafa [Advanced Technology Research and Application Center, Selcuk University, 42075 Konya (Turkey); Department of Chemistry, Faculty of Science, Selcuk University, 42075 Konya (Turkey)
2015-04-15
Herein we report the synthesis of polymer coated quantum dots (QDs)–carbon nanotube composite material with high biocompatibility and low cellular toxicity. The synthesized multi-walled carbon nanotube (MWCNT)–QD-(-poly(glycidyl methacrylate)) (pGMA) hybrids were characterized using X-ray photoelectron spectroscopy, laser scanning confocal microscopy, transmission electron microscopy and scanning electron microscopy. The results showed that quantum dots were well-distributed on nanotube surfaces in high density. The toxicological assessments of QDs and MWCNT–QD–polymer hybrids in human mammary carcinoma cells and their fluorescence imaging in living cell system were carried out. MWCNT–QD–polymer hybrids possess intense red fluorescence signal under confocal microscopy and good fluorescence stability over 6-h exposure in living cell system. The toxicity comparison of QDs and MWCNT–QD–polymer hybrids has shown that the existence of PGMA thin coating on MWCNT–QD hybrid surface decreased the cellular toxicity and increased biocompatibility. - Highlights: • We report that polymer coating of QDs on CNTs increased their biocompatibility by decreasing cellular toxicity. • QD–CNT polymer hybrid material may be proposed as a good diagnostic agent to visualize cancer cells which may be improved as a therapeutic carrier in future. • Coating QDs with polymer seems to be a right choice to be used in medicinal applications both for diagnosis and for therapy.
International Nuclear Information System (INIS)
Hagras, S.A.A.
2009-01-01
The present study aimed at establishing new techniques for eliminating or preventing microbial colonization of central venous catheters (CVCs) material. Therefore, the microbial contaminants of CVCs used by 100 ICUs patients were isolated . Then the ability of these isolates to produce bio films was in vitro studied.In addition , their susceptibilities to a large number of antibiotics, representing all groups of antibiotics, were examined by determination of their MICs. Gram-negative rods were the major contaminants of tested CVCs, representing about 92% of all isolates. Nevertheless,the percentage of Gram-positive cocci and yeasts did not exceed 4% each.More than 70% of the isolates were positive for slime production and levofloxacin was the most effective antibiotic against bacterial isolates. The effectiveness of different lock solutions of levofloxacin or fluconazole, against bio films of four microbial strains, selected on the basis of their high resistance to tested antibiotics and their ability for slime production, was in vitro studied. Where 1 mg/ml of levofloxacin and 0.5 mg/ml of fluconazole proved to be efficient against bacterial or yeast bio films, respectively, within three days lock period. Upon immobilizing gentamicin molecules on the gamma radiation treated polyurethane catheter material to graft it with spacer or linker chains of poly glycidyl methacrylate (pGMA) molecules, the catheter material acquired antimicrobial and anti adhesive properties.
Biocompatible multi-walled carbon nanotube–CdTe quantum dot–polymer hybrids for medical applications
International Nuclear Information System (INIS)
Baslak, Canan; Demirel Kars, Meltem; Karaman, Mustafa; Kus, Mahmut; Cengeloglu, Yunus; Ersoz, Mustafa
2015-01-01
Herein we report the synthesis of polymer coated quantum dots (QDs)–carbon nanotube composite material with high biocompatibility and low cellular toxicity. The synthesized multi-walled carbon nanotube (MWCNT)–QD-(-poly(glycidyl methacrylate)) (pGMA) hybrids were characterized using X-ray photoelectron spectroscopy, laser scanning confocal microscopy, transmission electron microscopy and scanning electron microscopy. The results showed that quantum dots were well-distributed on nanotube surfaces in high density. The toxicological assessments of QDs and MWCNT–QD–polymer hybrids in human mammary carcinoma cells and their fluorescence imaging in living cell system were carried out. MWCNT–QD–polymer hybrids possess intense red fluorescence signal under confocal microscopy and good fluorescence stability over 6-h exposure in living cell system. The toxicity comparison of QDs and MWCNT–QD–polymer hybrids has shown that the existence of PGMA thin coating on MWCNT–QD hybrid surface decreased the cellular toxicity and increased biocompatibility. - Highlights: • We report that polymer coating of QDs on CNTs increased their biocompatibility by decreasing cellular toxicity. • QD–CNT polymer hybrid material may be proposed as a good diagnostic agent to visualize cancer cells which may be improved as a therapeutic carrier in future. • Coating QDs with polymer seems to be a right choice to be used in medicinal applications both for diagnosis and for therapy
Liu, Guoqin; Yan, Guojin; Zou, Wenjun; Li, Zhengxin
2011-01-01
The contraction of poly(methacrylic acid-co-methyl methacrylate) (P(MAA-co-MMA)) gel induced by complexation with linear poly(N-vinyl-2-pyrrolidone) (PVP) is quite different from that of poly(acrylic acid) (PAA) or poly(methacrylic acid) (PMAA) gel. It was found that the concentration of PVP has a strong effect on the complexation with P(MAA-co-MMA) gel. When PVP was introduced into the P(MAA-co-MMA) network, its dynamic mechanic properties vary greatly between complexed and uncomplexed netwo...
International Nuclear Information System (INIS)
Kaetsu, I.; Yoshii, F.; Watanabe, Y.
1978-01-01
Radiation-induced polymerization of glass-forming monomers such as 2-hydroxyethyl methacrylate and glycidyl methacrylate under high pressure was studied. The glass transition temperature of these monomers was heightened by increased pressure. The temperature dependence of polymerizability showed a characteristic relation, similar to those in supercooled-phase polymerization under normal pressure, that had a maximum at T/sub ν/ which shifted to higher levels of temperature as well as to T/sub g/ under high pressure. Polymerizability in the supercooled state also increased under increased pressure
Sim, Biow Ing; Muhamad, Halimah; Lai, Oi Ming; Abas, Faridah; Yeoh, Chee Beng; Nehdi, Imededdine Arbi; Khor, Yih Phing; Tan, Chin Ping
2018-04-01
This paper examines the interactions of degumming and bleaching processes as well as their influences on the formation of 3-monochloropropane-1,2-diol esters (3-MCPDE) and glycidyl esters in refined, bleached and deodorized palm oil by using D-optimal design. Water degumming effectively reduced the 3-MCPDE content up to 50%. Acid activated bleaching earth had a greater effect on 3-MCPDE reduction compared to natural bleaching earth and acid activated bleaching earth with neutral pH, indicating that performance and adsorption capacities of bleaching earth are the predominant factors in the removal of esters, rather than its acidity profile. The combination of high dosage phosphoric acid during degumming with the use of acid activated bleaching earth eliminated almost all glycidyl esters during refining. Besides, the effects of crude palm oil quality was assessed and it was found that the quality of crude palm oil determines the level of formation of 3-MCPDE and glycidyl esters in palm oil during the high temperature deodorization step of physical refining process. Poor quality crude palm oil has strong impact towards 3-MCPDE and glycidyl esters formation due to the intrinsic components present within. The findings are useful to palm oil refining industry in choosing raw materials as an input during the refining process.
DEFF Research Database (Denmark)
Madsen, Jeppe; Madden, George; Themistou, Efrosyni
2018-01-01
methacrylate [PyMA] is statistically copolymerized with glycerolmonomethacrylate (GMA) to introduce a suitable fluorescent label. The chain-ends of the PDPA block are labelled with cresylviolet perchlorate [CV] by exploiting the spin trap properties of this dye molecule. Below pH 6, fluorescence from both...
International Nuclear Information System (INIS)
Abdel Ghaffar, A.M.; Youssef, Tamer E.; Mohamed, Hanan H.
2016-01-01
The synthesis and characterization of new 2-hydroxyethyl methacrylate-co-methyl methacrylate/zinc phthalocyanine composite Poly(HEMA/MMA/ZnPc) is described for the first time in this study. The aim of this research is to present possibility of radiation synthesis of the newly zinc phthalocyanine composites as potential candidates for wide range of applications. Gel (%) and swelling for Poly(hydroxyethyl methacrylate) Poly(HEMA) and the based Poly(hydroxyethyl methacrylate/methyl methacrylate) copolymer Poly(HEMA/MMA) with different composition 100/0, 95/5, 90/10 and 80/20 wt % were evaluated. It was found that Poly(HEMA/MMA) copolymer with composition 95/5 wt % characterized by its high swelling property at pH 7.4. The prepared composites I and II Poly(HEMA/MMA/ZnPc) with composition (95/5/1 wt%) and (95/5/1.5 wt%) respectively have been characterized by FTIR and TGA. The effect of gamma irradiation on the chemical properties of composite I was described. It is observed that the Zinc phthalocyanine with low concentration 1 wt % enhance chemical, thermal properties and stabilization against gamma radiation of the prepared composite I. - Highlights: • The preparation of Poly(HEMA/MMA/ZnPc) by radiation forming modified composites. • The low concentration of ZcPc (1 or 1.5 wt %) lead to form outstanding properties. • These composites are a potential candidate for wide range of applications.
Energy Technology Data Exchange (ETDEWEB)
Abdel Ghaffar, A.M., E-mail: am_abdelghaffar@yahoo.com [Radiation Research of Polymer Chemistry Department, Industrial Irradiation Division, National Center for Radiation Research and Technology, Atomic Energy Authority P.O. Box 29, Nasr City, Cairo (Egypt); Youssef, Tamer E. [Applied Organic Chemistry Department, Chemical Industries Research Division, National Research Center, Dokki, Cairo, 12622 (Egypt); Chemical and Materials Engineering Department, Faculty of Engineering, King Abdulaziz University, P.O. Box 80204, Jeddah, 21589 (Saudi Arabia); Mohamed, Hanan H. [Chemistry Department, Faculty of Science, Helwan University, Ain Helwan, Cairo (Egypt)
2016-08-01
The synthesis and characterization of new 2-hydroxyethyl methacrylate-co-methyl methacrylate/zinc phthalocyanine composite Poly(HEMA/MMA/ZnPc) is described for the first time in this study. The aim of this research is to present possibility of radiation synthesis of the newly zinc phthalocyanine composites as potential candidates for wide range of applications. Gel (%) and swelling for Poly(hydroxyethyl methacrylate) Poly(HEMA) and the based Poly(hydroxyethyl methacrylate/methyl methacrylate) copolymer Poly(HEMA/MMA) with different composition 100/0, 95/5, 90/10 and 80/20 wt % were evaluated. It was found that Poly(HEMA/MMA) copolymer with composition 95/5 wt % characterized by its high swelling property at pH 7.4. The prepared composites I and II Poly(HEMA/MMA/ZnPc) with composition (95/5/1 wt%) and (95/5/1.5 wt%) respectively have been characterized by FTIR and TGA. The effect of gamma irradiation on the chemical properties of composite I was described. It is observed that the Zinc phthalocyanine with low concentration 1 wt % enhance chemical, thermal properties and stabilization against gamma radiation of the prepared composite I. - Highlights: • The preparation of Poly(HEMA/MMA/ZnPc) by radiation forming modified composites. • The low concentration of ZcPc (1 or 1.5 wt %) lead to form outstanding properties. • These composites are a potential candidate for wide range of applications.
International Nuclear Information System (INIS)
Mascioni, Matteo; Sands, James M.; Palmese, Giuseppe R.
2003-01-01
Radiation curable polymeric materials suffer from relatively poor mechanical properties. Moreover, the curing behavior of such systems (i.e. the exact relationship between chemical kinetics and key processing variables) is not fully understood. In order to design improved epoxy based electron beam (EB) curable systems, and in order to develop appropriate process models, a detailed knowledge of the kinetics of epoxy cationic polymerization induced by ultraviolet (UV) or EB irradiation is required. In this work, we present our development of a technique based on real time near infrared (RTIR) spectroscopy for performing in situ kinetic analysis of radiation induced cationic polymerization of epoxy systems. To our knowledge this is the first time such data have been collected and presented for high-energy EB (10 MeV) induced polymerization. A demonstration of the technique for deterministic evaluation of degree of cure is shown using model glycidyl ether (phenyl glycidyl ether and diglycidyl ether of bisphenol A) resins and isothermal curing conditions. The impact of initiation rate on polymerizations with UV and EB for the cationic initiator is directly evident by comparative analysis. The sensitivity of the RTIR method and ability to produce quantitative data evidence of reaction mechanisms is demonstrated. The type of data presented in this work forms the basis for cure models being developed
Directory of Open Access Journals (Sweden)
Guoqin Liu
2011-01-01
Full Text Available The contraction of poly(methacrylic acid-co-methyl methacrylate (P(MAA-co-MMA gel induced by complexation with linear poly(N-vinyl-2-pyrrolidone (PVP is quite different from that of poly(acrylic acid (PAA or poly(methacrylic acid (PMAA gel. It was found that the concentration of PVP has a strong effect on the complexation with P(MAA-co-MMA gel. When PVP was introduced into the P(MAA-co-MMA network, its dynamic mechanic properties vary greatly between complexed and uncomplexed networks. It had the following results: (1 the higher modulus ratio; (2 a slight contraction of gel.
Glycidyl fatty acid esters (GEs), one of the main contaminants in processed oil, are mainly formed during the deodorization step in the oil refining process of edible oils and therefore occur in almost all refined edible oils. GEs are potential carcinogens, due to the fact that they hydrolyze into t...
Yan, Jing; Oey, Sergio B.; Leeuwen, van Stefan P.J.; Ruth, van Saskia M.
2018-01-01
In this study, the processing derived contaminants 2- and 3-monochloropropanediol (2- and 3-MCPD) esters and glycidyl esters (GEs) were analysed in 84 oil samples by GC–MS/MS for the discrimination of processing grades of olive oils as a potential authentication tool. Concentrations of 2- and 3-MCPD
David, Dagmar M; Euteneier, Alexander; Fischer, Martin R; Hahn, Eckhart G; Johannink, Jonas; Kulike, Katharina; Lauch, Robert; Lindhorst, Elmar; Noll-Hussong, Michael; Pinilla, Severin; Weih, Markus; Wennekes, Vanessa
2013-01-01
The German graduate medical education system is going through an important phase of changes. Besides the ongoing reform of the national guidelines for graduate medical education (Musterweiterbildungsordnung), other factors like societal and demographic changes, health and research policy reforms also play a central role for the future and competitiveness of graduate medical education. With this position paper, the committee on graduate medical education of the Society for Medical Education (GMA) would like to point out some central questions for this process and support the current discourse. As an interprofessional and interdisciplinary scientific society, the GMA has the resources to contribute in a meaningful way to an evidence-based and future-oriented graduate medical education strategy. In this position paper, we use four key questions with regards to educational goals, quality assurance, teaching competence and policy requirements to address the core issues for the future of graduate medical education in Germany. The GMA sees its task in contributing to the necessary reform processes as the only German speaking scientific society in the field of medical education.
Process for the production of methyl methacrylate
Eastham, G.R.; Johnson, D.W.; Straathof, A.J.J.; Fraaije, Marco; Winter, Remko
2015-01-01
A process of producing methyl methacrylate or derivatives thereof is described. The process includes the steps of; (i) converting 2-butanone to methyl propionate using a Baeyer-Villiger monooxygenase, and (ii) treating the methyl propionate produced to obtain methyl methacrylate or derivatives
Polymerization by radiation. Application
International Nuclear Information System (INIS)
Romero, M.; Fernandez Miranda, J.
1997-01-01
Achieved results of the research work done in the field of radiation polymerization are summarized. Developing new chromatographic matrices, the radiation grafting of Glycidyl methacrylate on the surface of Low Density Polyethylene beads was studied. The dependence of both, the grafted degree and width of the grafted layer, with the radiation dose applied, is presented
Collins, Michael; Heagney, Aaron; Cordaro, Frank; Odgers, David; Tarrant, Gregory; Stewart, Samantha
2007-07-01
Five 44 gallon drums labeled as glycidyl methacrylate were seized by the Australian Customs Service and the Australian Federal Police at Port Botany, Sydney, Australia, in December 2004. Each drum contained a white, semisolid substance that was initially suspected to be 3,4-methylenedioxymethylamphetamine (MDMA). Gas chromatography-mass spectroscopy (GC/MS) analysis demonstrated that the material was neither glycidyl methacrylate nor MDMA. Because intelligence sources employed by federal agents indicated that this material was in some way connected to MDMA production, suspicion fell on the various MDMA precursor chemicals. Using a number of techniques including proton nuclear magnetic resonance spectroscopy ((1)H NMR), carbon nuclear magnetic resonance spectroscopy ((13)C NMR), GC/MS, infrared spectroscopy, and total synthesis, the unknown substance was eventually identified as methyl 3-[3',4'(methylenedioxy)phenyl]-2-methyl glycidate. The substance was also subjected to a published hydrolysis and decarboxylation procedure and gave a high yield of the MDMA precursor chemical, 3,4-methylenedioxyphenyl-2-propanone, thereby establishing this material as a "precursor to a precursor."
Polymerization of novel methacrylated anthraquinone dyes
Directory of Open Access Journals (Sweden)
Christian Dollendorf
2013-02-01
Full Text Available A new series of polymerizable methacrylated anthraquinone dyes has been synthesized by nucleophilic aromatic substitution reactions and subsequent methacrylation. Thereby, green 5,8-bis(4-(2-methacryloxyethylphenylamino-1,4-dihydroxyanthraquinone (2, blue 1,4-bis(4-((2-methacryloxyethyloxyphenylaminoanthraquinone (6 and red 1-((2-methacryloxy-1,1-dimethylethylaminoanthraquinone (12, as well as 1-((1,3-dimethacryloxy-2-methylpropan-2-ylaminoanthraquinone (15 were obtained. By mixing of these brilliant dyes in different ratios and concentrations, a broad color spectrum can be generated. After methacrylation, the monomeric dyes can be covalently emplaced into several copolymers. Due to two polymerizable functionalities, they can act as cross-linking agents. Thus, diffusion out of the polymer can be avoided, which increases the physiological compatibility and makes the dyes promising compounds for medical applications, such as iris implants.
Xia, Hongjun; Wan, Guangping; Zhao, Junlong; Liu, Jiawei; Bai, Quan
2016-11-04
High performance liquid chromatography (HPLC) is a kind of efficient separation technology and has been used widely in many fields. Micro-sized porous silica microspheres as the most popular matrix have been used for fast separation and analysis in HPLC. In this paper, the monodisperse large-porous silica microspheres with controllable size and structure were successfully synthesized with polymer microspheres as the templates and characterized. First, the poly(glycidyl methacrylate-co-ethyleneglycol dimethacrylate) microspheres (P GMA-EDMA ) were functionalized with tetraethylenepentamine (TEPA) to generate amino groups which act as a catalyst in hydrolysis of tetraethyl orthosilicate (TEOS) to form Si-containing low molecular weight species. Then the low molecular weight species diffused into the functionalized P GMA-EDMA microspheres by induction force of the amino groups to form polymer/silica hybrid microspheres. Finally, the organic polymer templates were removed by calcination, and the large-porous silica microspheres were obtained. The compositions, morphology, size distribution, specific surface area and pore size distribution of the porous silica microspheres were characterized by infrared analyzer, scanning-electron microscopy, dynamic laser scattering, the mercury intrusion method and thermal gravimetric analysis, respectively. The results show that the agglomeration of the hybrid microspheres can be overcome when the templates were functionalized with TEPA as amination reagent, and the yield of 95.7% of the monodisperse large-porous silica microspheres can be achieved with high concentration of polymer templates. The resulting large-porous silica microspheres were modified with octadecyltrichlorosilane (ODS) and the chromatographic evaluation was performed by separating the proteins and the digest of BSA. The baseline separation of seven kinds of protein standards was achieved, and the column delivered a better performance when separating BSA digests
Retention of krypton on polymethyl methacrylate
International Nuclear Information System (INIS)
Ciric, M.M.; Cvjeticanin, N.M.; Radak, B.B.
1975-01-01
Retention of krypton on polymethyl methacrylate was studied as a function of kryptonation pressure (P), temperature (T) and time (t). It was found that the dependence of the retained quantity on P, T, and t is in accordance with the diffusion theory. The optimum results (i.e., the maximum retained quantity and the best stability of the kryptonate) were obtained at elevated kryptonation temperatures (200 0 C). The diffusion coefficients of krypton in polymethyl methacrylate, determined from the dekryptonation process, vary from 1 x 10 -10 cm 2 /s to 0.2 x 10 -10 cm 2 /s for samples kryptonated at 20 0 C and 200 0 C respectively. The results have been discussed from the viewpoint of radiation and thermal stability of kryptonated polymethyl methacrylate. Inadequate radiation stability could be the main obstacle for practical purposes. (U.S.)
Methacrylate-Based Copolymers for Polymer Optical Fibers
Directory of Open Access Journals (Sweden)
Daniel Zaremba
2017-01-01
Full Text Available Waveguides made of poly-methyl-methacrylate (PMMA play a major role in the homogeneous distribution of display backlights as a matrix for solid-state dye lasers and polymer optical fibers (POFs. PMMA is favored because of its transparency in the visible spectrum, low price, and well-controlled processability. Nevertheless, technical drawbacks, such as its limited temperature stability, call for new materials. In this work, the copolymerization technique is used to modify the properties of the corresponding homopolymers. The analytical investigation of fourteen copolymers made of methyl-methacrylate (MMA or ethyl-methacrylate (EMA as the basis monomer is summarized. Their polymerization behaviors are examined by NMR spectroscopy with subsequent copolymerization parameter evaluation according to Fineman-Ross and Kelen-Tüdös. Therefore, some r-parameter sets are shown to be capable of copolymerizations with very high conversions. The first applications as high-temperature resistant (HT materials for HT-POFs are presented. Copolymers containing isobornyl-methacrylate (IBMA as the comonomer are well-suited for this demanding application.
Improved Mechanical Performance Fracture Properties and Reliability of Radical-Cured Thermosets
Energy Technology Data Exchange (ETDEWEB)
Redline, Erica Marie [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Bolintineanu, Dan S. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Lane, J. Matthew [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Stevens, Mark J. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Alam, Todd M. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Celina, Mathias C. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)
2016-10-01
The aim of this study was to alter polymerization chemistry to improve network homogeneity in free-radical crosslinked systems. It was hypothesized that a reduction in heterogeneity of the network would lead to improved mechanical performance. Experiments and simulations were carried out to investigate the connection between polymerization chemistry, network structure and mechanical properties. Experiments were conducted on two different monomer systems - the first is a single monomer system, urethane dimethacrylate (UDMA), and the second is a two-monomer system consisting of bisphenol A glycidyl dimethacrylate (BisGMA) and triethylene glycol dimethacrylate (TEGDMA) in a ratio of 70/30 BisGMA/TEGDMA by weight. The methacrylate systems were crosslinked using traditional radical polymeriza- tion (TRP) with azobisisobutyronitrile (AIBN) or benzoyl peroxide (BPO) as an initiator; TRP systems were used as the control. The monomers were also cross-linked using activator regenerated by electron transfer atom transfer radical polymerization (ARGET ATRP) as a type of controlled radical polymerization (CRP). FTIR and DSC were used to monitor reac- tion kinetics of the systems. The networks were analyzed using NMR, DSC, X-ray diffraction (XRD), atomic force microscopy (AFM), and small angle X-ray scattering (SAXS). These techniques were employed in an attempt to quantify differences between the traditional and controlled radical polymerizations. While a quantitative methodology for characterizing net- work morphology was not established, SAXS and AFM have shown some promising initial results. Additionally, differences in mechanical behavior were observed between traditional and controlled radical polymerized thermosets in the BisGMA/TEGDMA system but not in the UDMA materials; this finding may be the result of network ductility variations between the two materials. Coarse-grained molecular dynamics simulations employing a novel model of the CRP reaction were carried out for
Directory of Open Access Journals (Sweden)
Adriana Cristina Wenceslau
2012-03-01
Full Text Available IPN hydrogels based on chemically modified poly(vinyl alcohol (or PVA-Ma, with different degrees of substitution (DS, and poly(N-isopropylacrylamide (or PNIPAAm were obtained and characterized through measures of LCST, swelling ratio and mechanical properties. Linear PVA-Ma with several DS were obtained through the chemical reaction of PVA with glycidyl methacrylate (GMA. The DS of various PVA-Ma were determined through 1H NMR spectroscopy. Two steps were used for preparation the PVA-Ma/PNIPAAm membrane hydrogels. In the first step the PVA-Ma hydrogels (using PVA-Ma with different DS were prepared by reaction of double bonds on PVA-Ma, using the persulfate/TEMED system. Using a photoreaction pathway in the second step, PNIPAAm network was prepared within the parent PVA-Ma network at different PVA-Ma/NIPAAm ratios. The studies show that degree of swelling ratio (SR of PVA-Ma/PNIPAAm IPN hydrogels is dependent of temperature. The LCST for each IPN-hydrogel was determined by measuring the intensity of light transmitted through the hydrogel. The LCST of the IPN hydrogels ranged from 34.6 to 38.1oC. The elastic modules of swollen IPN hydrogels increased from 25 to 35oC but decreased by further warming to 45oC. The LCST, swelling ratio and mechanical properties of PVA-Ma/PNIPAAm IPN hydrogels can be tailored by tuning the PVA-Ma/NIPAAm ratio.
Kang, Y.; Zhang, L.; Zhang, H.; Wu, T.; Du, Y.
2017-05-01
A sensitive and selective surface-enhanced Raman scattering (SERS) sensor for mercury(II) was fabricated based on the target-mediated displacement of a T-rich oligonucleotide strand. A DNA/aptamer duplex was prepared by the hybridization between a tetramethylrhodamine(TMR)-labeled thymine(T)-rich Hg2+-specific aptamer (denoted as TMR-aptamer) and a thiolated adenine-rich capturing DNA. The duplex can be immobilized onto the SERS substrate of the Ag-moiety modified glycidyl methacrylate-ethylene dimethacrylate (denoted as Ag-GMA-EDMA) via self-assembly by the thiol anchor, in which the TMR-aptamer exists in a double-stranded chain. In this case, the label of the TMR moiety approaches the substrate surface and produces a strong SERS signal. Upon the addition of the target, a pair of TMR-aptamers could cooperatively coordinate with Hg2+ to form a stable duplex-like structure mediated by the T-Hg2+-T complex between two adjacent strands, which triggers the release of the TMR-aptamer from the SERS substrate surface, thus drawing the TMR tags away from the substrate with a significant decrease in the SERS signal. This optical sensor shows a sensitive response to Hg2+ in a concentration from 5 nM to 2.0 μM with a detection limit of 2.5 nM. The prepared sensor is negligibly responsive to other metal ions, can be easily regenerated, and shows good performance in real sample analysis.
International Nuclear Information System (INIS)
Saito, Kyoichi
2014-01-01
Various functional groups such as chelate-forming and ion-exchange groups were introduced into the poly-glycidyl methacrylate chain grafted onto a commercially available porous hollow-fiber membrane with a thickness of approximately 1 mm, an average pore size of 0.4 µm, and a porosity of 70%. Permeation of a target metal-ion or protein solution driven by a transmembrane pressure enables us to minimize the diffusional mass-transfer resistance of metal ions or proteins to the functional groups. Considerable degree of GMA grafting and molar conversion of the epoxy group into the functional group provide a higher functional group density of the porous hollow-fiber membrane than for conventional adsorbents. First, metal ions and proteins were transported to the chelating and ion-exchange groups, respectively, of the graft chain. The higher the permeation rate of the target solution is, the higher the overall adsorption rate of the target ions or proteins onto the modified porous hollow-fiber membrane becomes. In addition, proteins were bound to the ion-exchange polymer brush in multilayers because the polymer brush extends from the pore surface towards the pore interior due to its mutual electrostatic repulsion. Second, replacement adsorption was observed in a binary system of metal ions or proteins during the permeation of the solution through the membrane with a membrane thickness of approximately 1 mm. Third, chiral resolution of DL-tryptophan was demonstrated using albumin-multilayered porous hollow-fiber membranes. (author)
Energy Technology Data Exchange (ETDEWEB)
Wisniak, Jaime [Department of Chemical Engineering, Ben-Gurion University of the Negev, Beer-Sheva 84105 (Israel)]. E-mail: wisniak@bgumail.bgu.ac.il; Peralta, Rene D. [Centro de Investigacion en Quimica Aplicada, Saltillo 25100, Coahuila (Mexico); Infante, Ramiro [Centro de Investigacion en Quimica Aplicada, Saltillo 25100, Coahuila (Mexico); Cortez, Gladis [Centro de Investigacion en Quimica Aplicada, Saltillo 25100, Coahuila (Mexico); Lopez, R.G. [Centro de Investigacion en Quimica Aplicada, Saltillo 25100, Coahuila (Mexico)
2005-10-15
Densities of the binary systems of cyclohexane with allyl methacrylate, butyl methacrylate, methacrylic acid, and vinyl acetate have been measured as a function of the composition, at 298.15 and 308.15 K and atmospheric pressure, using an Anton Paar DMA 5000 oscillating U-tube densimeter. The calculated excess molar volumes were correlated with the Redlich-Kister equation and with a series of Legendre polynomials. The excess molar volumes are positive for the four binaries studied. Within the short temperature range considered here the coefficient of thermal expansion is positive for all the systems studied; it varies only slightly with the nature of the acrylate except for the system cyclohexane + vinyl acetate.
Park, Jong-Gu; Ye, Qiang; Topp, Elizabeth M.; Spencer, Paulette
2009-01-01
A new trimethacrylate monomer with urethane-linked groups, 1,1,1-tri-[4-(methacryloxyethylamino-carbonyloxy)-phenyl]ethane (MPE), was synthesized, characterized, and used as a co-monomer in dentin adhesives. Dentin adhesives containing 2-hydroxyethyl methacrylate (HEMA, 45% w/w) and 2,2-bis[4(2-hydroxy-3-methacryloyloxy-propyloxy)-phenyl] propane (BisGMA, 30% w/w) in addition to MPE (25% w/w) were formulated with H2O at 0 (MPE0), 8 (MPE8) and 16 wt % water (MPE16) to simulate the wet demineralized dentin matrix and compared with controls [HEMA/BisGMA, 45/55 w/w, at 0 (C0), 8 (C8) and 16 wt% water (C16)]. The new adhesive showed a degree of double bond conversion and mechanical properties comparable with control, with good penetration into the dentin surface and a uniform adhesive/dentin interface. On exposure to porcine liver esterase, the net cumulative methacrylic acid (MAA) release from the new adhesives was dramatically (P < 0.05) decreased relative to the control, suggesting that the new monomer improves esterase resistance. PMID:19582843
2005-01-01
Methacrylate ester monomers are used in as artificial nail builders in nail enhancement products. They undergo rapid polymerization to form a hard material on the nail that is then shaped. While Ethyl Methacrylate is the primary monomer used in nail enhancement products, other methacrylate esters are also used. This safety assessment addresses 22 other methacrylate esters reported by industry to be present in small percentages as artificial nail builders in cosmetic products. They function to speed up polymerization and/or form cross-links. Only Tetrahydrofurfuryl Methacrylate was reported to the FDA to be in current use. The polymerization rates of these methacrylate esters are within the same range as Ethyl Methacrylate. While data are not available on all of these methacrylate esters, the available data demonstrated little acute oral, dermal, or i.p. toxicity. In a 28-day inhalation study on rats, Butyl Methacrylate caused upper airway irritation; the NOAEL was 1801 mg/m3. In a 28-day oral toxicity study on rats, t-Butyl Methacrylate had a NOAEL of 20 mg/kg/day. Beagle dogs dosed with 0.2 to 2.0 g/kg/day of C12 to C18 methacrylate monomers for 13 weeks exhibited effects only in the highest dose group: weight loss, emesis, diarrhea, mucoid feces, or salivation were observed. Butyl Methacrylate (0.1 M) and Isobutyl Methacrylate (0.1 M) are mildly irritating to the rabbit eye. HEMA is corrosive when instilled in the rabbit eye, while PEG-4 Dimethacrylate and Trimethylolpropane Trimethacrylate are minimally irritating to the eye. Dermal irritation caused by methacrylates is documented in guinea pigs and rabbits. In guinea pigs, HEMA, Isopropylidenediphenyl Bisglycidyl Methacrylate, Lauryl Methacrylate, and Trimethylolpropane Trimethacrylate are strong sensitizers; Butyl Methacrylate, Cyclohexyl Methacrylate, Hexyl Methacrylate, and Urethane Methacrylate are moderate sensitizers; Hydroxypropyl Methacrylate is a weak sensitizer; and PEG-4 Dimethacrylate and
78 FR 55644 - Styrene, Copolymers with Acrylic Acid and/or Methacrylic Acid; Tolerance Exemption
2013-09-11
..., 3-sulfopropyl acrylate, 3-sulfopropyl methacrylate, hydroxypropyl methacrylate, hydroxypropyl acrylate, hydroxyethyl methacrylate, and/or hydroxyethyl acrylate; and its sodium, potassium, ammonium..., hydroxypropyl acrylate, hydroxyethyl methacrylate, and/or hydroxyethyl acrylate; and its sodium, potassium...
Radiation-chemical preparation of poly(vinyl alcohol) hydrogels
International Nuclear Information System (INIS)
Duflot, Anastasia V.; Kitaeva, Natalia K.; Duflot, Vladimir R.
2015-01-01
This work reports the usage of method of radiation-chemical synthesis to prepare cross-linked hydrogels from poly(vinyl alcohol) modified with glycidyl methacrylate. Synthesis kinetics of modified poly(vinyl alcohol) and properties of hydrogels were studied. The gel fraction, swelling, mechanical properties, and water content of the hydrogels were measured. It was found that gel fraction increases with increasing radiation dose, concentration of modified poly(vinyl alcohol), and reaches 60%. It was established by differential scanning calorimetry that a fraction of the “bound” water in hydrogels is 50–70% and independent of gel fraction content. In addition to “bound” and “free” states, water in hydrogels is also present in the intermediate state. - Highlights: • The synthesis and the properties of poly(vinyl alcohol) hydrogels were studied. • PVA was modified by glycidyl methacrylate before gamma cross-linking. • The modification results in decreasing of PVA cross-linking dose by 3 orders lower. • The gel fraction and water content of the hydrogels were measured. • A fraction of the “bound” water in hydrogels is independent of gel fraction content
Leigh, Jessica; MacMahon, Shaun
2017-03-01
This work presents occurrence data for fatty acid esters of 3-chloro-1,2-propanediol (3-MCPD) and glycidol in 98 infant formula samples purchased in the United States. These contaminants are considered potentially carcinogenic and/or genotoxic, making their presence in refined oils and foods a potential health risk. Recently, attention has focused on methodology to quantify MCPD and glycidyl esters in infant formula for risk-assessment purposes. Occurrence data for 3-MCPD and glycidyl esters were produced using a procedure for extracting fat from infant formula and an LC-MS/MS method for analysing fat extracts for intact esters. Infant formulas were produced by seven manufacturers, five of which use palm oil and/or palm olein in their formulations. In formulas containing palm/palm olein, concentrations for bound 3-MCPD and glycidol ranged from 0.021 to 0.92 mg kg - 1 (ppm) and from 3-MCPD and glycidol concentrations ranged from 0.072 to 0.16 mg kg - 1 (ppm) and from 0.005 to 0.15 mg kg - 1 (ppm), respectively. Although formulas from manufacturers A and G did not contain palm/palm olein, formulas from manufacturer E (containing palm olein) had the lowest concentrations of bound 3-MCPD and glycidol, demonstrating the effectiveness of industrial mitigation strategies.
Energy Technology Data Exchange (ETDEWEB)
Lin, Shu-Ling; Wu, Yu-Ru; Lin, Tzuen-Yeuan; Fuh, Ming-Ren, E-mail: msfuh@scu.edu.tw
2015-04-29
Highlights: • Methacrylic acid (MAA) was used to increase hydrophilicity of polymeric monoliths. • Fast separation of phenol derivatives was achieved in 5 min using MAA-incorporated column. • Separations of aflatoxins and phenicol antibiotics were achieved using MAA-incorporated column. - Abstract: In this study, methacrylic acid (MAA) was incorporated with alkyl methacrylates to increase the hydrophilicity of the synthesized ethylene dimethacrylate-based (EDMA-based) monoliths for separating polar small molecules by capillary LC analysis. Different alkyl methacrylate–MAA ratios were investigated to prepare a series of 30% alkyl methacrylate–MAA–EDMA monoliths in fused-silica capillaries (250-μm i.d.). The porosity, permeability, and column efficiency of the synthesized MAA-incorporated monolithic columns were characterized. A mixture of phenol derivatives is employed to evaluate the applicability of using the prepared monolithic columns for separating small molecules. Fast separation of six phenol derivatives was achieved in 5 min with gradient elution using the selected poly(lauryl methacrylate-co-MAA-co-EDMA) monolithic column. In addition, the effect of acetonitrile content in mobile phase on retention factor and plate height as well as the plate height-flow velocity curves were also investigated to further examine the performance of the selected poly(lauryl methacrylate-co-MAA-co-EDMA) monolithic column. Moreover, the applicability of prepared polymer-based monolithic column for potential food safety applications was also demonstrated by analyzing five aflatoxins and three phenicol antibiotics using the selected poly(lauryl methacrylate-co-MAA-co-EDMA) monolithic column.
Directory of Open Access Journals (Sweden)
A. Praharaj
2015-01-01
Full Text Available In this work, initially a non-destroyable surface grafting of acid functionalized multiwalled carbon nanotubes (f-MWCNTs with biopolymer chitosan (CS was carried out using glutaraldehyde as a cross-linking agent via the controlled covalent deposition method which was characterized by Fourier transform infrared spectroscopy (FTIR and scanning electron microscopy (SEM. Then, BisGMA (bisphenol-A glycidyldimethacrylate-polyvinylpyrrolidone (PVP blend was prepared (50:50 wt% by a simple sonication method. The CS grafted f-MWCNTs (CS/f-MWCNTs were finally dispersed in BisGMA-PVP blend (BGP50 system in different compositions i.e. 0, 2, 5 and 7 wt% and pressed into molds for the fabrication of reinforced nanocomposites which were characterized by SEM. Nanocomposites reinforced with 2 wt% raw MWCNTs and acid f-MWCNTs were also fabricated and their properties were studied in detail. The results of comparative study report lower values of the investigated properties in nanocomposites with 2 wt% raw and f-MWCNTs than the one with 2 wt% CS/f-MWCNTs proving it to be a better reinforcing nanofiller. Further, the mechanical behavior of the nanocomposites with various CS/f-MWCNTs content showed a dramatic increase in Young’s Modulus, tensile strength, impact strength and hardness along with improved dynamic mechanical, thermal and electrical properties at 5 wt% content of CS/f-MWCNTs. The addition of CS/f-MWCNTs also resulted in reduced corrosion and swelling properties. Thus, the fabricated nanocomposites with optimum nanofiller content could serve as low cost and light weight structural, thermal and electrical materials compatible in various corrosive and solvent based environments.
International Nuclear Information System (INIS)
Liu Renlong; Zhang Huiyan; Li Yintao; Zhou Yuanlin; Zhang Quanping; Zheng Jian; Wang Shanqiang
2016-01-01
The poly(methyl methacrylate)-block-poly(methacrylic acid) diblock copolymer with different monomer compositions was synthesized via reversible addition-fragmentation chain transfer polymerization. Meanwhile, a novel self-embrittling strippable coating was prepared using the diblock copolymers, which is proposed to be used as radioactive decontamination agents without manual operation. Furthermore, the decontamination efficiencies of self-embrittling strippable coatings for radioactive contamination on glass, marble, and stainless steel surfaces were studied. (author)
Directory of Open Access Journals (Sweden)
MA Qiang
2016-09-01
Full Text Available An amphiphilic random copolymer of polyglycidyl methacrylate-co-N-vinyl carbazole P(GMA-co-NVC was synthesized by free radical polymerization and was used to noncovalently modify multi-walled carbon nanotubes (MWCNTs. The obtained P(GMA-co-NVC/MWCNTs was mixed with epoxy resin and used to reinforce epoxy resin. Polymer modified carbon nanotubes/epoxy resin composites were prepared by a casting molding method. Tensile test, electrical resistivity test and differential scanning calorimeter(DSC analysis were used to study the effect of polymer modified carbon nanotubes on the mechanical, electrical, and thermal properties of epoxy resin. The results show that the epoxy composite reinforced with P(GMA-co-NVC/MWCNTs shows a remarkable enhancement in both tensile strength and elongation at break compared to either the pure epoxy or the pristine MWCNTs/epoxy composites. In addition, the electrical conductivity of epoxy is significantly improved and the volume resistivity decreases from 1014Ω·m to 106Ω·m with 0.25% mass fraction loading of P(GMA-co-NVC/MWCNTs. Moreover, glass transition temperature of the epoxy composite also increases from 144℃ to 149℃.
Preparation of Rhodamine B Fluorescent Poly(methacrylic acid) Coated Gelatin Nanoparticles
Gan, Zhenhai; Ju, Jianhui; Zhang, Ting; Wu, Daocheng
2011-01-01
Poly(methacrylic acid) (PMAA)-coated gelatin nanoparticles encapsulated with fluorescent dye rhodamine B were prepared by the coacervation method with the aim to retard the release of rhodamine B from the gelatin matrix. With sodium sulfate as coacervation reagent for gelatin, a kind of biopolymer with excellent biocompatibility, the formed gelatin nanoparticles were cross-linked by formaldehyde followed by the polymerization of methacrylic acid coating. The fluorescent poly(methacrylic acid)...
DEFF Research Database (Denmark)
Mose, Kristian Fredløv; Andersen, Klaus Ejner; Christensen, Lars Porskjaer
2013-01-01
The homogeneity of methacrylates in commercial patch test preparations has not yet been investigated. Inhomogeneous patch test preparations may give rise to false-negative or false-positive patch test results in patients suspected of having methacrylate allergy.......The homogeneity of methacrylates in commercial patch test preparations has not yet been investigated. Inhomogeneous patch test preparations may give rise to false-negative or false-positive patch test results in patients suspected of having methacrylate allergy....
Energy Technology Data Exchange (ETDEWEB)
Zhang, Rongyue; Li, Qiang; Li, Juan; Zhou, Weiqing; Ye, Peili; Gao, Yang; Ma, Guanghui, E-mail: ghma@home.ipe.ac.cn; Su, Zhiguo
2012-12-01
Protein denaturation and nonspecific adsorption on polymer media as a chromatographic support have been a problem which needs to be overcome. Macroporous poly(glycidyl methacrylate-divinylbezene) (PGMA-DVB) microspheres prepared in this study were firstly covalently coated with dextran through a three-step method. The dextran was firstly adsorbed onto the microspheres and then covalently bound to the PGMA-DVB microsphere through ether bonds which were formed by hydroxyl group reacting with epoxy group at the presence of 4-(Dimethylamino) pyridine. Finally, the coating dextran layer was crosslinked by ethylene glycol diglycidyl ether to form the continuous network coating. The coated microspheres were characterized by Fourier transform infrared spectra, scanning electron microscope, mercury porosimetry measurements, laser scanning confocal microscope, and protein adsorption experiments. Results showed that PGMA-DVB microspheres coated with dextran successfully maintained the macroporous structure and high permeability. The backpressure was only 1.69 MPa at a high flow rate of 2891 cm/h. Consequently, the hydrophilicity and biocompatibility of modified microspheres were greatly improved, and the contact angle decreased from 184 Degree-Sign to 13 Degree-Sign , and nonspecific adsorption of proteins was decreased to little or none. The clad dextran coating with large amounts of hydroxyl group was easily derived to be various functional groups. The derived media have great potential applications in rapid protein chromatography. - Highlights: Black-Right-Pointing-Pointer Macroporous PGMA-DVB microspheres were covalently coated with dextran. Black-Right-Pointing-Pointer The hydrophilicity of the coated microspheres was significantly improved. Black-Right-Pointing-Pointer The irreversible adsorption of proteins was reduced to zero. Black-Right-Pointing-Pointer The coated microspheres can maintain the macropore structure. Black-Right-Pointing-Pointer The coated microspheres
Investigation of Methacrylic Acid at High Pressure Using Neutron Diffraction
DEFF Research Database (Denmark)
Marshall, William G.; Urquhart, Andrew; Oswald, Iain D. H.
2015-01-01
This article shows that pressure can be a low-intensity route to the synthesis of polymethacrylic acid. The exploration of perdeuterated methacrylic acid at high pressure using neutron diffraction reveals that methacrylic acid exhibits two polymorphic phase transformations at relatively low...
Synthesis of acrylates and methacrylates from coal-derived syngas
Energy Technology Data Exchange (ETDEWEB)
Spivey, J.J.; Gogate, M.R.; Jang, B.W.L. [Bechtel, San Francisco, CA (United States)] [and others
1995-12-31
Acrylates and methacrylates are among the most widely used chemical intermediates in the world. One of the key chemicals of this type is methyl methacrylate. Of the 4 billion pounds produced each year, roughly 85% is made using the acetone-cyanohydrin process, which requires handling of large quantities of hydrogen cyanide and produces ammonium sulfate wastes that pose an environmental disposal challenge. The U.S. Department of Energy and Eastman Chemical Company are sharing the cost of research to develop an alternative process for the synthesis of methyl methacrylate from syngas. Research Triangle Institute is focusing on the synthesis and testing of active catalysts for the condensation reactions, and Bechtel is analyzing the costs to determine the competitiveness of several process alternatives. Results thus far show that the catalysts for the condensation of formaldehyde and the propionate are key to selectively producing the desired product, methacrylic acid, with a high yield. These condensation catalysts have both acid and base functions and the strength and distribution of these acid-base sites controls the product selectivity and yield.
International Nuclear Information System (INIS)
Pyun, H.C.; Park, W.B.; Kim, K.Y.; Sung, K.Y.
1980-01-01
Electron beam curable prepolymers were prepared by the addition reaction of methyl methacrylate-glycidyl methacrylate copolymer with methacrylic acid, and electron beam curing was studied for the prepolymer and their mixtures of several kind of vinyl monomers. When the reaction was carried out in the presence of triethylbenzyl ammonium chloride in N,N-dimethyl formamide solution, the rate of addition reaction obeyed first-order kinetics. In the electron beam curing, the rate of gel formation of the prepolymer was slower than that of the mixtures of prepolymer and monomers. In the curing of mixtures of prepolymer with polyethyleneglycol dimethacrylates, the rate of gel formation increased with the increase in the degree of polymerization of polyethylene oxide fraction of polyethyleneglycol dimethacrylate, and decreased with the increase the polyethyleneglycol dimethacrylate content. The properties of cured coatings were also examined. (author)
Synthesis and characterization of sugar-based methacrylates and their random copolymers by ATRP
Directory of Open Access Journals (Sweden)
G. Acik
2017-10-01
Full Text Available Various sugar-based methacrylate monomers have been prepared and randomly copolymerized with methyl methacrylate (MMA using classical atom transfer radical polymerization (ATRP. Firstly, four different sugar-based methacrylates are synthesized by two-step method: (i etherification of protected monosaccharides with epichlorohydrin and (ii following ring-opening reaction of obtained epoxides with methacrylic acid (MAA in the presence of triethylamine. Next, these monomers are copolymerized with MMA via ATRP at 90 °C to obtain corresponding random copolymers. The molecular weights of the copolymers are determined by both GPC (gel permeation chromatography and 1H-NMR (nuclear magnetic resonance spectroscopy analyses and found as 10600~16800 and 12200~18500 g/mol, respectively. Moreover, the copolymer compositions are also determined by 1H-NMR analysis using characteristic signals of the monomers and found as about 94.1~97.8%, which are good agreement with feeding ratio. In addition, the glass transition temperatures of copolymers are found as 101.2~102.9 °C by changing type and composition of sugar-based methacrylate monomers. Overall, a series of well-defined random copolymers comprising different sugar-based methacrylates and methyl methacrylates were successfully synthesized by classical ATRP method.
Low HAP/VOC Compliant Resins for Military Applications
2011-09-01
commumty that was dooradng the perchlorote. Soy Oil 1Walls’ Win Against Perchlorate Texas Military Facility Gets EPA, State OK for Reuse T he...accomplishment is rhe soy - bean, or to be more precise its derivative, soy oil , which cleaned up the chemicals and saved millions of dollars. 5 Army’s Soy ...Fourier Transform Infrared Spectroscopy GM: Glycidyl methacrylate GPC: Gel Permeation Chromatography HAP: Hazardous Air Pollutants HMMWV: High
Marc, Corinne; Drouard-Pascarel, Valérie; Rétho, Cécile; Janvion, Patrice; Saltron, Frédéric
2016-06-01
This paper describes a method for the determination of 3-monochloropropane-1,2-diol and 2-monochloropropane-1,3-diol (MCPD) esters and glycidyl esters in various foodstuffs, which are isolated using microwave extraction. The next step is based on alkaline-catalyzed ester cleavage. The released glycidol is transformed into monobromopropanediol (MBPD). All compounds are derivatized in free diols (MCPD and MBPD) with phenylboronic acid and analyzed by gas chromatography-mass spectrometry (GC-MS). The method was validated for oils with a limit of quantitation (LOQ) of 0.1 mg/kg, for chips and crisps with a LOQ of 0.02 mg/kg, and for infant formula with a LOQ of 0.0025 mg/L. Recoveries of each sample were controlled by standard addition on extracts before derivatization. Quantitation was performed by the addition of isotopically labeled glycidyl and 3-monochloropropane-1,2-diol (3-MCPD) esters.
Czech Academy of Sciences Publication Activity Database
Trachtová, Š.; Obermajer, T.; Španová, A.; Matijašić, B. B.; Rogelj, I.; Horák, Daniel; Rittich, B.
2012-01-01
Roč. 555, č. 1 (2012), s. 263-270 ISSN 1542-1406. [International Conference on Frontiers of Polymers and Advanced Materials /11./. Pretoria, 22.05.2011-27.05.2011] R&D Projects: GA MŠk 2B06053 Institutional research plan: CEZ:AV0Z40500505 Keywords : DNA isolation * magnetic microspheres * mouse faeces Subject RIV: EE - Microbiology, Virology Impact factor: 0.530, year: 2012
Yan, Xia; Shi, Xiaofeng; Yang, Jie; Zhang, Xu; Jia, Wenjie; Ma, Jun
2017-10-01
A self-assembled surface enhanced Raman scattering (SERS) sensor is reported in this paper. To achieve high sensitivity, a high sensitive SERS substrate and a high efficient self-constructed light path were made. The SERS substrate was composed by gold nanoparticles (AuNPs, pH=13), glycidyl methacrylate-ethylene dimethacrylate (GMA-EDMA) porous material and syringe filter. The substrate had a good repeatability, and the relative standard deviation (RSD) of the same substrate was less than 5%. The efficiency of the self-constructed light path is about two times better than RPB Y type reflection fiber when the energy density was roughly equal on samples. The size of the SERS sensor is 350×300×180 mm and the weight is 15 kg. Its miniaturization and portable can comply with the requirements of field detection. Besides, it has good sensitivity, stability and selectivity. For lab experiments, strong enhancements of Raman scattering from organic pollutant polycyclic aromatic hydrocarbons (PAHs) molecules were exhibited. The dependences of SERS intensities on concentrations of PAHs were investigated, and the results indicated that they revealed a satisfactory linear relationship in low concentrations. The limits of detection (LODs) of PAHs phenanthrene and fluorene are 8.3×10-10 mol/L and 7.1×10-10 mol/L respectively [signal to noise ratio (S/N) =3]. Based on this SERS sensor, signals of benzo (a) pyrene and pyrene were found in environmental water and the sensor would be an ideal candidate for field detection of PAHs.
PEGylation of magnetic poly(glycidyl methacrylate) microparticles for microfluidic bioassays
Czech Academy of Sciences Publication Activity Database
Kučerová, J.; Svobodová, Z.; Knotek, P.; Palarčik, J.; Vlček, Milan; Kincl, Miloslav; Horák, Daniel; Autebert, J.; Viovy, J.-L.; Bílková, Z.
2014-01-01
Roč. 40, 1 July (2014), s. 308-315 ISSN 0928-4931 R&D Projects: GA MŠk 7E12053; GA MŠk 7E09109 EU Projects: European Commission(XE) 246513 - NADINE; European Commission(XE) 228980 - CAMINEMS Institutional support: RVO:61389013 Keywords : PEGylation * magnetic microscopy * microfluidics Subject RIV: CE - Biochemistry
Mechanical Properties of Surface-Charged Poly(Methyl Methacrylate as Denture Resins
Directory of Open Access Journals (Sweden)
Sang E. Park
2009-01-01
Full Text Available The aim of this study was to examine the mechanical properties of a new surface-modified denture resin for its suitability as denture base material. This experimental resin is made by copolymerization of methacrylic acid (MA to poly(methyl methacrylate (PMMA to produce a negative charge. Four experimental groups consisted of Orthodontic Dental Resin (DENTSPLY Caulk as a control and three groups of modified PMMA (mPMMA produced at differing ratios of methacrylic acid (5 : 95, 10 : 90, and 20 : 80 MA : MMA. A 3-point flexural test using the Instron Universal Testing Machine (Instron Corp. measured force-deflection curves and a complete stress versus strain history to calculate the transverse strength, transverse deflection, flexural strength, and modulus of elasticity. Analysis of Variance and Scheffe Post-test were performed on the data. Resins with increased methacrylic acid content exhibited lower strength values for the measured physical properties. The most significant decrease occurred as the methacrylic acid content was increased to 20% mPMMA. No significant differences at P<.05 were found in all parameters tested between the Control and 5% mPMMA.
International Nuclear Information System (INIS)
Dharmalingam, K.; Ramachandran, K.; Sivagurunathan, P.
2007-01-01
The molecular interaction between alkyl methacrylates (methyl methacrylate, ethyl methacrylate and butyl methacrylate) and primary alcohols (1-propanol, 1-butanol, 1-pentanol, 1-heptanol, 1-octanol and 1-decanol) has been studied in carbon tetrachloride by FTIR spectroscopic and dielectric methods. The results show that the most likely association between alcohol and ester is 1:1 complex through the free hydroxyl group of the alcohol and the carbonyl group of ester, and the alkyl chain length of both the alcohols and esters plays an important role in the determination of the strength of hydrogen bond (O-H:O=C) formed
Organic inorganic hybrid coating (poly(methyl methacrylate)/monodisperse silica)
Rubio, E.; Almaral, J.; Ramírez-Bon, R.; Castaño, V.; Rodríguez, V.
2005-04-01
Polymethylmethacrylate-silica hybrid coatings were prepared from methyl methacrylate and monodisperse colloidal silica prepared by the Stöber method. The surfaces of the spheres were successfully modified by chemical reaction with 3-(trimethoxysilyl) propyl methacrylate (TMSPM) to compatibilise the organic and inorganic components of the precursor solution mixture. The coatings were deposited by dip-coating on glass substrates. They result with good properties of homogeneity, optical transparence, hardness and adhesion.
Radiation-curable coating composition
International Nuclear Information System (INIS)
Mibae, Jiro; Kawamura, Hiroshi; Takahashi, Masao.
1970-01-01
A radiation-curable coating composition, suitable for metal precoating, is provided. The composition is prepared by mixing 50 to 90 parts of a long chain fatty acid ester (A) with 10 to 50 parts of monomer (B) which is copolymerizable with (A). (A) is prepared by reacting a dimer acid (particularly the dimer of linolenic acid) with hydroxyalkyl methacrylate or glycidyl methacrylate. Upon irradiation with electron beams (0.1 to 3 MeV) the composition cures to yield a coating of high adhesion, impact resistance and bending resistance. In one example, 100 g of dimer acid (Versadime 216, manufactured by General Mills) was esterified with 50 g of 2-hydroxyethyl methacrylate. A zinc plated iron plate was coated with the product and irradiated with electron beams (2 Mrad). Pencil hardness was F; adhesion 0: impact resistance (Du Pont) 1 kg x 30 cm; bending resistance 2T. (Kaichi, S.)
Electrochemical sensing platforms based on the different carbon derivative incorporated interface.
Dervisevic, Muamer; Çevik, Emre; Durmuş, Zehra; Şenel, Mehmet
2016-01-01
their effects on the properties of these biosensors. Biosensors were prepared by Horseradish peroxidase (HRP) immobilization on the composite electrodes composed of carbon black, carbon nanofiber (CNF), extended graphite, multiwalled carbon nanotube (MWCNT), reduced graphene oxide (REGO) and poly(glycidyl methacrylateco-vinylferrocene) (P(GMA-co-VFc)) as mediator, covalent linker, and host matrix for carbon derivatives. The modified pencil graphite electrode (PGE) was used for the detection of hydrogen peroxide and to follow electrochemical behavior of different carbon derivatives which were recorded. The electrochemical characterization was investigated by cyclic voltammetry and electrochemical impedance spectroscopy methods. Amperometric measurements showed that the REGO and MWCNT modified electrodes have excellent performance in comparison with other carbon derivatives studied.
International Nuclear Information System (INIS)
LMP, Campos; Boaro, LC; LKG, Santos; Parra, DF; Lugão, AB
2015-01-01
Dental restorative composites are activated by visible light and the polymerization process, known as direct technique, is initiated by absorbing light in a specific wavelength range (450–500 nm). However this technique presented some disadvantages. If light is not inserted correctly, layers uncured can cause countless damage to restoration, especially with regard to mechanical properties. A clinical alternative used to reduce the shortcomings of direct application is the use of composite resins for indirect application. These composites are adaptations of resins prepared for direct use, with differences mainly in the healing process. Besides the traditional photoactivation, indirect application composites may be submitted to particular curing conditions, such as a slow curing rate, heating, vacuum, and inert-gas pressure leading to an oxygen-free environment. However few studies have been conducted on the process of post-curing by ionizing radiation at low doses. On this sense the purpose of this study was to evaluate possible interactions of ionizing radiation in the post-curing process of the experimental composites based on BisGMA/TEGDMA filled with silica Aerosil OX-50 silanized. Characterization of the experimental composites was performed by thermogravimetry analysis, infrared spectroscopy, elastic modulus and flexural strength. Statistical analysis of results was calculated by one-way ANOVA/Tukey's test. Cross-linking of the polymeric matrix caused by ionizing radiation, influenced the thermal stability of irradiated specimens. FTIR analysis showed that the ionizing radiation induced a post-cure reaction in the specimens. The irradiation dose influenced directly the mechanical properties that showed a strong positive correlation between flexural strength and irradiation and between modulus strength and irradiation. - Highlights: • Interactions of ionizing radiation in BisGMA/TEGDMA experimental dental composites filled with sylanized silica.
Institute of Scientific and Technical Information of China (English)
WANG, Yao-Rong(王耀荣); SHEN, Qi(沈琪); MA, Jia-Le(马家乐); ZHAO, Qun(赵群)
2000-01-01
Methyl methacrylate (MMA) was effectively polymerized by diphenylamido bis(methyicyclopentadienyl) ytterbium complex (MeCp)2YbNPh2(THF). Tne reaction can be carried out over a range of polymerization temperature from - 40℃ to 40℃ and gives the polyMMA with high molecular weights.The initiation mechanism was demonstrated by diphenylamidoterminated methyl methacrylate oligomer.
Repair Strength in Simulated Restorations of Methacrylate- or Silorane-Based Composite Resins.
Consani, Rafael Leonardo Xediek; Marinho, Tatiane; Bacchi, Atais; Caldas, Ricardo Armini; Feitosa, Victor Pinheiro; Pfeifer, Carmem Silvia
2016-01-01
The study verified the bond strength in simulated dental restorations of silorane- or methacrylate-based composites repaired with methacrylate-based composite. Methacrylate- (P60) or silorane-based (P90) composites were used associated with adhesive (Adper Single Bond 2). Twenty-four hemi-hourglass-shaped samples were repaired with each composite (n=12). Samples were divided according to groups: G1= P60 + Adper Single Bond 2+ P60; G2= P60 + Adper Single Bond 2 + P60 + thermocycling; G3= P90 + Adper Single Bond 2 + P60; and G4= P90 + Adper Single Bond 2 + P60 + thermocycling. G1 and G3 were submitted to tensile test 24 h after repair procedure, and G2 and G4 after submitted to 5,000 thermocycles at 5 and 55 ?#61616;C for 30 s in each bath. Tensile bond strength test was accomplished in an universal testing machine at crosshead speed of 0.5 mm/min. Data (MPa) were analyzed by two-way ANOVA and Tukey's test (5%). Sample failure pattern (adhesive, cohesive in resin or mixed) was evaluated by stereomicroscope at 30?#61655; and images were obtained in SEM. Bond strength values of methacrylate-based composite samples repaired with methacrylate-based composite (G1 and G2) were greater than for silorane-based samples (G3 and G4). Thermocycling decreased the bond strength values for both composites. All groups showed predominance of adhesive failures and no cohesive failure in composite resin was observed. In conclusion, higher bond strength values were observed in methacrylate-based resin samples and greater percentage of adhesive failures in silorane-based resin samples, both composites repaired with methacrylate-based resin.
Energy Technology Data Exchange (ETDEWEB)
Buga, Mihaela-Ramona [National Research and Development Institute for Cryogenics and Isotopic Technologies, ICIT Rm. Valcea, 240050 Rm. Valcea, Uzinei 4, CP7, Raureni, Valcea (Romania); Zaharia, Cătălin, E-mail: zaharia.catalin@gmail.com [Advanced Polymer Materials Group, University Politehnica of Bucharest, 1-7, Gh. Polizu Street, Sector 1, 011061 Bucharest (Romania); Bălan, Mihai [National Research and Development Institute for Cryogenics and Isotopic Technologies, ICIT Rm. Valcea, 240050 Rm. Valcea, Uzinei 4, CP7, Raureni, Valcea (Romania); Bressy, Christine [Université de Toulon, MAPIEM, EA 4323, 83957 La Garde (France); Ziarelli, Fabio [Fédération des Sciences Chimiques de Marseille, CNRS-FR1739, Spectropole, 13397 Marseille (France); Margaillan, André [Université de Toulon, MAPIEM, EA 4323, 83957 La Garde (France)
2015-06-01
In this study, silk fibroin surface containing hydroxyl and aminogroups was firstly modified using a polymerizable coupling agent 3-(trimethoxysilyl) propyl methacrylate (MPS), in order to induce vinyl groups onto the fiber surface. The reversible addition–fragmentation chain transfer (RAFT)-mediated polymerization of methyl methacrylate (MMA) and tributylsilyl methacrylate (TBSiMA) through the immobilized vinyl bond on the silk fibroin surface in the presence of 2-cyanoprop-2-yl dithiobenzoate (CPDB) as chain-transfer agent and 2,2′-azobis(isobutyronitrile) (AIBN) as initiator was conducted in toluene solution at 70 °C for 24 h. The structure and properties of the modified fiber were characterized by Fourier Transform Infrared Spectroscopy, {sup 13}C, {sup 29}Si Nuclear Magnetic Resonance (NMR) spectroscopy, thermogravimetric analysis (TGA), scanning electron microscopy (SEM) and energy dispersive spectroscopy (EDS), confirming the presence of the coupling molecule and the methacrylate groups onto the silk fibroin fiber surface. Molecular weight distributions were assessed by triple detection size exclusion chromatography (TD-SEC) in order to verify the livingness of the polymerization. - Highlights: • SF surface containing hydroxyl and amino groups was firstly modified with MPS. • RAFT polymerizations of MMA and TBSiMA were studied. • TD-SEC was used to verify the livingness of the RAFT polymerization. • The grafted polymer chains enhance the thermal stability of the SF fibers. • The grafted fibers could be potentially promising candidates as antifouling agents.
International Nuclear Information System (INIS)
Buga, Mihaela-Ramona; Zaharia, Cătălin; Bălan, Mihai; Bressy, Christine; Ziarelli, Fabio; Margaillan, André
2015-01-01
In this study, silk fibroin surface containing hydroxyl and aminogroups was firstly modified using a polymerizable coupling agent 3-(trimethoxysilyl) propyl methacrylate (MPS), in order to induce vinyl groups onto the fiber surface. The reversible addition–fragmentation chain transfer (RAFT)-mediated polymerization of methyl methacrylate (MMA) and tributylsilyl methacrylate (TBSiMA) through the immobilized vinyl bond on the silk fibroin surface in the presence of 2-cyanoprop-2-yl dithiobenzoate (CPDB) as chain-transfer agent and 2,2′-azobis(isobutyronitrile) (AIBN) as initiator was conducted in toluene solution at 70 °C for 24 h. The structure and properties of the modified fiber were characterized by Fourier Transform Infrared Spectroscopy, 13 C, 29 Si Nuclear Magnetic Resonance (NMR) spectroscopy, thermogravimetric analysis (TGA), scanning electron microscopy (SEM) and energy dispersive spectroscopy (EDS), confirming the presence of the coupling molecule and the methacrylate groups onto the silk fibroin fiber surface. Molecular weight distributions were assessed by triple detection size exclusion chromatography (TD-SEC) in order to verify the livingness of the polymerization. - Highlights: • SF surface containing hydroxyl and amino groups was firstly modified with MPS. • RAFT polymerizations of MMA and TBSiMA were studied. • TD-SEC was used to verify the livingness of the RAFT polymerization. • The grafted polymer chains enhance the thermal stability of the SF fibers. • The grafted fibers could be potentially promising candidates as antifouling agents
21 CFR 177.2000 - Vinylidene chloride/methyl acrylate/methyl methacrylate polymers.
2010-04-01
... methacrylate polymers. 177.2000 Section 177.2000 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF...: POLYMERS Substances for Use as Basic Components of Single and Repeated Use Food Contact Surfaces § 177.2000 Vinylidene chloride/methyl acrylate/methyl methacrylate polymers. The vinylidene chloride/methyl acrylate...
A Non-Intrusive GMA Welding Process Quality Monitoring System Using Acoustic Sensing.
Cayo, Eber Huanca; Alfaro, Sadek Crisostomo Absi
2009-01-01
Most of the inspection methods used for detection and localization of welding disturbances are based on the evaluation of some direct measurements of welding parameters. This direct measurement requires an insertion of sensors during the welding process which could somehow alter the behavior of the metallic transference. An inspection method that evaluates the GMA welding process evolution using a non-intrusive process sensing would allow not only the identification of disturbances during welding runs and thus reduce inspection time, but would also reduce the interference on the process caused by the direct sensing. In this paper a nonintrusive method for weld disturbance detection and localization for weld quality evaluation is demonstrated. The system is based on the acoustic sensing of the welding electrical arc. During repetitive tests in welds without disturbances, the stability acoustic parameters were calculated and used as comparison references for the detection and location of disturbances during the weld runs.
Occurrence of 3-MCPD and glycidyl esters in edible oils in the United States.
MacMahon, Shaun; Begley, Timothy H; Diachenko, Gregory W
2013-01-01
Fatty acid esters of 3-monochloropropanediol (3-MCPD) and glycidol are processing contaminants found in a wide range of edible oils. While both 3 MCPD and glycidol have toxicological properties that at present has concerns for food safety, the published occurrence data are limited. Occurrence information is presented for the concentrations of 3-MCPD and glycidyl esters in 116 retail and/or industrial edible oils and fats using LC-MS/MS analysis of intact esters. The concentrations for bound 3-MCPD ranged from below the limit of quantitation (3-MCPD and glycidol were seen in refined palm oil and palm olein samples. Palm olein samples also contained a higher percentage of 3-MCPD in mono-ester form than any other type of oil.
Institute of Scientific and Technical Information of China (English)
杨梅林; 马於光; 郑莹光; 沈家骢
1990-01-01
It is found that the volatile products of methyl methacrylate plasma can very actively initiate the polymerization of the monomer to produce ultrahigh molecular weight polymers. This polymerization of MMA occurs by a livlng free radical mechanism with instantaneous initiation and monomer transfer.
Randolph, Luc D; Steinhaus, Johannes; Möginger, Bernhard; Gallez, Bernard; Stansbury, Jeffrey; Palin, William M; Leloup, Gaëtane; Leprince, Julian G
2016-02-01
The use of a Type I photoinitiator (monoacylphosphine oxide, MAPO) was described as advantageous in a model formulation, as compared to the conventional Type II photoinitiator (Camphorquinone, CQ). The aim of the present work was to study the kinetics of polymerization of various composite mixtures (20-40-60-80 mol%) of bisphenol A glycidyl dimethacrylate/triethylene glycol dimethacrylate (BisGMA/TegDMA) containing either CQ or MAPO, based on real-time measurements and on the characterization of various post-cure characteristics. Polymerization kinetics were monitored by Fourier-transform near-infrared spectroscopy (FT-NIRS) and dielectric analysis (DEA). A range of postcure properties was also investigated. FT-NIRS and DEA proved complementary to follow the fast kinetics observed with both systems. Autodecceleration occurred after ≈1 s irradiation for MAPO-composites and ≈5-10 s for CQ-composites. Conversion decreased with increasing initial viscosity for both photoinitiating systems. However despite shorter light exposure (3s for MAPO vs 20s for CQ-composites), MAPO-composites yielded higher conversions for all co-monomer mixtures, except at 20 mol% BisGMA, the less viscous material. MAPO systems were associated with increased amounts of trapped free radicals, improved flexural strength and modulus, and reduced free monomer release for all co-monomer ratios, except at 20 mol% BisGMA. This work confirms the major influence of the initiation system both on the conversion and network cross-linking of highly-filled composites, and further highlights the advantages of using MAPO photoinitiating systems in highly-filled dimethacrylate-based composites provided that sufficient BisGMA content (>40 mol%) and adapted light spectrum are used. Copyright © 2015 Academy of Dental Materials. Published by Elsevier Ltd. All rights reserved.
Phase behavior for the poly(alkyl methacrylate)+supercritical CO2+DME mixture at high pressures
International Nuclear Information System (INIS)
Choi, Yong-Seok; Chio, Sang-Won; Byun, Hun-Soo
2016-01-01
The phase behavior curves of binary and ternary system were measured for poly(alkyl methacrylate) in supercritical CO 2 , as well as for the poly(alkyl methacrylate)+dimethyl ether (DME) (or 1-butene) in CO 2 . The solubility curves are reported for the poly(alkyl methacrylate)+DME in supercritical CO 2 at temperature from (300 to 465) K and a pressure from (3.66 to 248) MPa. Also, The high-pressure static-type apparatus of cloud-point curve was tested by comparing the measured phase behavior data of the poly(methyl methacrylate) [PMMA]+CO 2 +20.0 and 30.4 wt% methyl methacrylate (MMA) system with literature data of 10.4, 28.8 and 48.4 wt% MMA concentration. The phase behavior data for the poly(alkyl methacrylate)+CO 2 +DME mixture were measured in changes of the pressure-temperature (p, T) slope and with DME concentrations. Also, the cloud-point pressure for the poly(alkyl methacrylate)+1- butene solution containing supercritical CO 2 shows from upper critical solution temperature (UCST) region to lower critical solution temperature (LCST) region at concentration range from (0.0 to 95) wt% 1-butene at below 455 K and at below 245MPa.
Multifunctional methacrylate-based coatings for glass and metal surfaces
Energy Technology Data Exchange (ETDEWEB)
Pospiech, Doris, E-mail: pospiech@ipfdd.de [Leibniz-Institut für Polymerforschung Dresden e. V., Dresden (Germany); Jehnichen, Dieter [Leibniz-Institut für Polymerforschung Dresden e. V., Dresden (Germany); Starke, Sandra; Müller, Felix [Leibniz-Institut für Polymerforschung Dresden e. V., Dresden (Germany); Technische Universität Dresden, Organic Chemistry of Polymers, Dresden (Germany); Bünker, Tobias [Leibniz-Institut für Polymerforschung Dresden e. V., Dresden (Germany); Wollenberg, Anne [Leibniz-Institut für Polymerforschung Dresden e. V., Dresden (Germany); Technische Universität Dresden, Organic Chemistry of Polymers, Dresden (Germany); Häußler, Liane; Simon, Frank; Grundke, Karina; Oertel, Ulrich [Leibniz-Institut für Polymerforschung Dresden e. V., Dresden (Germany); Opitz, Michael; Kruspe, Rainer [IDUS Biologisch Analytisches Umweltlabor GmbH, Ottendorf-Okrilla (Germany)
2017-03-31
Highlights: • New methacrylate-based copolymers synthesized by free radical polymerization. • Comonomer AAMA was able to complex Cu (II) ions in solvent annealing procedure. • Coatings had efficient anti-biofouling efficacy. - Abstract: In order to prevent freshwater biofouling glass and metal surfaces were coated with novel transparent methacrylate-based copolymers. The multifunctionality of the copolymers, such as adhesion to the substrate, surface polarity, mechanical long-term stability in water, and ability to form metal complexes was inserted by the choice of suitable comonomers. The monomer 2-acetoacetoxy ethyl methacrylate (AAMA) was used as complexing unit to produce copper(II) complexes in the coating’s upper surface layer. The semifluorinated monomer 1H,1H,2H,2H-perfluorodecyl methacrylate was employed to adjust the surface polarity and wettability. Comprehensive surface characterization techniques, such as X-ray photoelectron spectroscopy (XPS) and contact angle measurements showed that surface compositions and properties can be easily adjusted by varying the concentrations of the comonomers. The formation of copper(II) complexes along the copolymer chains and their stability against washing out with plenty of water was proven by XPS. Copolymers containing semifluorinated comonomers significantly inhibited the growth of Achnanthidium species. Copolymers with copper-loaded AAMA-sequences were able to reduce both the growth of Achnanthidium spec. and Staphylococcus aureus.
Multifunctional methacrylate-based coatings for glass and metal surfaces
International Nuclear Information System (INIS)
Pospiech, Doris; Jehnichen, Dieter; Starke, Sandra; Müller, Felix; Bünker, Tobias; Wollenberg, Anne; Häußler, Liane; Simon, Frank; Grundke, Karina; Oertel, Ulrich; Opitz, Michael; Kruspe, Rainer
2017-01-01
Highlights: • New methacrylate-based copolymers synthesized by free radical polymerization. • Comonomer AAMA was able to complex Cu (II) ions in solvent annealing procedure. • Coatings had efficient anti-biofouling efficacy. - Abstract: In order to prevent freshwater biofouling glass and metal surfaces were coated with novel transparent methacrylate-based copolymers. The multifunctionality of the copolymers, such as adhesion to the substrate, surface polarity, mechanical long-term stability in water, and ability to form metal complexes was inserted by the choice of suitable comonomers. The monomer 2-acetoacetoxy ethyl methacrylate (AAMA) was used as complexing unit to produce copper(II) complexes in the coating’s upper surface layer. The semifluorinated monomer 1H,1H,2H,2H-perfluorodecyl methacrylate was employed to adjust the surface polarity and wettability. Comprehensive surface characterization techniques, such as X-ray photoelectron spectroscopy (XPS) and contact angle measurements showed that surface compositions and properties can be easily adjusted by varying the concentrations of the comonomers. The formation of copper(II) complexes along the copolymer chains and their stability against washing out with plenty of water was proven by XPS. Copolymers containing semifluorinated comonomers significantly inhibited the growth of Achnanthidium species. Copolymers with copper-loaded AAMA-sequences were able to reduce both the growth of Achnanthidium spec. and Staphylococcus aureus.
Polyaniline Coated Core-Shell Typed Stimuli-Responsive Microspheres and Their Electrorheology
Directory of Open Access Journals (Sweden)
Yu Zhen Dong
2018-03-01
Full Text Available Functional core-shell-structured particles have attracted considerable attention recently. This paper reviews the synthetic methods and morphologies of various electro-stimuli responsive polyaniline (PANI-coated core-shell-type microspheres, including PANI-coated Fe3O4, SiO2, Fe2O3, TiO2, poly(methyl methacrylate, poly(glycidyl methacrylate, and polystyrene along with their electrorheological (ER characteristics when prepared by dispersing these particles in an insulating medium. In addition to the various rheological characteristics and their analysis, such as shear stress and yield stress of their ER fluids, this paper summarizes some of the mechanisms proposed for ER fluids to further understand the responses of ER fluids to an externally applied electric field.
International Nuclear Information System (INIS)
Jansen, B.; Ellinghorst, G.
1985-01-01
Radiation grafting of monomers onto suitable trunk polymers is a useful tool for tailoring new polymers for special purposes. This technique has been used in the past for the development of biocompatible materials, e.g., by grafting hydrogels onto mechanically stable polymers. In this first part of our work, the radiation grafting of hydrophilic or reactive monomers onto a polyetherurethane film using the pre-swelling technique is described. Following this technique the trunk polymer was swollen in the monomer before irradiation. As monomers 2-hydroxyethyl methacrylate (HEMA), 2,3-epoxypropyl methacrylate (GMA), 2,3-dihydroxypropyl methacrylate (GOMA), and acrylamide (AAm) were used. The kinetics of the grafting reactions were examined, and the distribution of the graft component inside the trunk polymer was investigated by means of infrared (IR) spectroscopy. Surface-grafted as well as bulk- and surface-grafted products could be obtained. The mechanical behavior of the grafted films--especially in the water-swollen state--was examined and compared with that of the pure trunk polymer. In nearly all cases it was found that the tensile strength sigma B and the elongation at break epsilon R decreases as the grafting yield increases. Modification of GMA- and AAm-grafted films via chemical reactions was performed to create new functional groups of biomedical interest. In this manner a diol structure, a carboxylic acid structure, and a sulfonic acid group could be introduced in the grafted polymer. The water uptake of such modified films is increased markedly when compared with that of the unmodified samples
Process for a preparing a coating composition. [electrom irradiation
Energy Technology Data Exchange (ETDEWEB)
Kimura, T; Harada, H; Kobayashi, J; Nakamoto, H; Sunano, K
1968-07-16
An easily hardenable acrylic coating composition is prepared with low energy electron beams to develop a surface coating process without requiring solvents, and which may be widely applied by industry. The process comprises dissolving a polymer with a molecular weight in the 5,000 to 500,000 range in a monomer consisting of at least 30% by weight of acrylic monomer and 70% by weight of other vinyl monomers. The polymer is obtained by the polymerization of 1 to 40% by weight of vinyl monomer containing carboxyl radicals, 30 to 99% by weight of methacrylic monomer and 0 to 69% by weight of other copolymerizable vinyl monomers. Then, one mole of carboxyl radical of the solution reacts with 0.1 to 1.0 mole of vinyl monomer containing a glycidyl radical. In an embodiment, 17.5% by weight of methacrylate are dissolved in 82.5% of alkyl acrylate and undergo suspension polymerization in water in the presence of a catalyst to produce a beads-like polymer of molecular weight in the 5,000 to 500,000 range. Thereafter, 120 parts of the beads-like polymer are dissolved in 180 parts of acrylic monomer in the presence of a polymerization inhibitor. To this solution are added 22 parts of glycidyl methacrylate to react with carboxyl radicals, thereby obtaining non-solvent coating materials which contain the side chain vinyl radicals in the polymer. The acceleration voltage of the electron beams employed in the polymerization is generally 0.1 to 2.0 MeV. The dose rate to harden the coatings is in the range of 0.1 to 2.0 Mrad/sec.
International Nuclear Information System (INIS)
Baek, Seung-Hyun; Byun, Hun-Soo
2016-01-01
Highlights: • Phase behaviours for the (CO_2 + propargyl (meth)acrylate) systems by static method were measured. • (P, x) isotherms is obtained at pressures up to 19.14 MPa and at temperature of (313.2 to 393.2) K. • The (CO_2 + propargyl acrylate) and (CO_2 + propargyl methacrylate) systems exhibit type-I behaviour. - Abstract: Acrylate and methacrylate (acrylic acid type) are compounds with weak polarity which show a non-ideal behaviour. Phase behaviour of these systems play a significant role as organic solvents in industrial processes. High pressure phase behaviour data were reported for binary mixture of propargyl acrylate and propargyl methacrylate in supercritical carbon dioxide. The bubble-point curves for the (carbon dioxide + propargyl acrylate) and (carbon dioxide + propargyl methacrylate) mixtures were measured by static view cell apparatus at temperature range from 313.2 K to 393.2 K and at pressures below 19.14 MPa. The (carbon dioxide + propargyl acrylate) and (carbon dioxide + propargyl methacrylate) systems exhibit type-I phase behaviour. The (carbon dioxide + (meth)acrylate) systems had continuous critical mixture curves with maximums in pressure located between the critical temperatures of carbon dioxide and propargyl acrylate or carbon dioxide and propargyl methacrylate. The solubility behaviour of propargyl (meth)acrylate in the (carbon dioxide + propargyl acrylate) and (carbon dioxide + propargyl acrylate) systems increases as the temperature increases at a fixed pressure. The experimental results for the (carbon dioxide + propargyl acrylate) and (carbon dioxide + propargyl methacrylate) systems correlate with the Peng–Robinson equation of state using a van der Waals one-fluid mixing rule. The critical properties of propargyl acrylate and propargyl methacrylate were predicted with the Joback–Lyderson group contribution and Lee–Kesler method.
Directory of Open Access Journals (Sweden)
Aline B. Denis
2016-01-01
Full Text Available This study aimed to analyze the kinetic parameters of two monomers using attenuated total reflectance Fourier transform infrared (ATR-FTIR: 2,2-bis-[4-(2-hydroxy-3-methacryloxypropyl-1-oxy-phenyl] propane (Bis-GMA and triethylene glycol dimethacrylate (TEGDMA. The following were calculated to evaluate the kinetic parameters: maximum conversion rate (Rpmax, time at the maximum polymerization rate (tmax, conversion at Rpmax, and total conversion recorded at the maximum conversion point after 300 s. Camphorquinone (CQ and phenyl propanedione (PPD were used in this study as photoinitiators, whereas N,N-dimethyl-p-toluidine (DMPT amine was used as a coinitiator. LED apparatus and halogen lamp were used in turn to evaluate the effect that light source had on the monomer kinetics. The mass concentration ratio for the three resin preparations was 0.7 : 0.3 for Bis-GMA and TEGDMA: R1 (CQ + DMPT, R2 (PPD + DMPT, and R3 (PPD + CQ + DMPT. The PPD association with the CQ photoinitiator altered the polymerization kinetics compared to a resin containing only the CQ photoinitiator. The light sources exhibited no significant differences for tmax of R1 and R3. Resins containing only the PPD initiator exhibited a higher tmax than those containing only CQ. However, the Rpmax decreased for resins containing the PPD photoinitiator.
Directory of Open Access Journals (Sweden)
Liu Guoqin
2014-01-01
Full Text Available Poly(methacrylic acid-co-methyl methacrylate (P(MAA-co-MMA was prepared in the presence of poly(N-vinyl-2-pyrrolidone (PVP and multiwalled carbon nanotubes (MWNTs via ultrasonic assisted solution free radical polymerization, i.e., P(MAA-co-MMA/PVP/MWNTs nanocomposites. The morphology, glassy-state storage modulus, thermal behavior and swelling characteristics of P(MAA-co-MMA/PVP/MWNTs nanocomposites were investigated. Scanning electron micrographs (SEM revealed that MWNTs at low concentration could be uniformly dispersed into P(MAA-co-MMA/PVP blends. With increasing MWNTs weight fraction, the average glassy-state modulus, glass transition temperatures and decomposition temperature of the nanocomposites increased, but their swelling characteristics decreased.
Energy Technology Data Exchange (ETDEWEB)
Guoqin, Liu; Wei, Miao [College of Material Science and Engineering, Henan University of Technology (China); Lin-Jian, Shangguan, E-mail: mikepolymer@126.com [School of Mechanical Engineering, North China University of Water Conservancy and Electric Power (China)
2014-06-01
Poly(methacrylic acid-co-methyl methacrylate) (P(MAA-co-MMA)) was prepared in the presence of poly(N-vinyl-2-pyrrolidone) (PVP) and multi-walled carbon nanotubes (MWNTs) via ultrasonic assisted solution free radical polymerization, i.e., P(MAA-co-MMA)/PVP/MWNTs nanocomposites. The morphology, glassy-state storage modulus, thermal behavior and swelling characteristics of P(MAA-co-MMA)/PVP/MWNTs nanocomposites were investigated. Scanning electron micrographs (SEM) revealed that MWNTs at low concentration could be uniformly dispersed into P(MAA-co-MMA)/PVP blends. With increasing MWNTs weight fraction, the average glassy-state modulus, glass transition temperatures and decomposition temperature of the nanocomposites increased, but their swelling characteristics decreased. (author)
KAYA, İsmet
2014-01-01
Some thermodynamic quantities were obtained for the interactions of poly [2-(3-phenyl -3- methylcyclobutyl)-2-hydroxyethyl methacrylate-co-methacrylic acid] Poly (PCHEMA-co-MA) with alcohols, ketones, acetates, aromatics and n-alkanes by inverse gas chromatography in the temperature range of 150-180oC. The specific retention volumes, Vgo, weight fraction activity coefficients of solute probes at infinite dilution, W1\\infty and Flory-Huggins thermodynamic interaction parameters, c12...
Methacrylate hydrogels reinforced with bacterial cellulose
Czech Academy of Sciences Publication Activity Database
Hobzová, Radka; Dušková-Smrčková, Miroslava; Michálek, Jiří; Karpushkin, Evgeny; Gatenholm, P.
2012-01-01
Roč. 61, č. 7 (2012), s. 1193-1201 ISSN 0959-8103 R&D Projects: GA AV ČR KJB400500902 Institutional research plan: CEZ:AV0Z40500505 Keywords : bacterial cellulose * methacrylate hydrogel * composite Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.125, year: 2012
Performance of R-GMA based grid job monitoring system for CMS data production
Byrom, Robert; Fisher, Steve M; Grandi, Claudio; Hobson, Peter R; Kyberd, Paul; MacEvoy, Barry; Nebrensky, Jindrich Josef; Tallini, Hugh; Traylen, Stephen
2004-01-01
High Energy Physics experiments, such as the Compact Muon Solenoid (CMS) at the CERN laboratory in Geneva, have large-scale data processing requirements, with stored data accumulating at a rate of 1 Gbyte/s. This load comfortably exceeds any previous processing requirements and we believe it may be most efficiently satisfied through Grid computing. Management of large Monte Carlo productions (~3000 jobs) or data analyses and the quality assurance of the results requires careful monitoring and bookkeeping, and an important requirement when using the Grid is the ability to monitor transparently the large number of jobs that are being executed simultaneously at multiple remote sites. R-GMA is a monitoring and information management service for distributed resources based on the Grid Monitoring Architecture of the Global Grid Forum. We have previously developed a system allowing us to test its performance under a heavy load while using few real Grid resources. We present the latest results on this system and comp...
Multifunctional methacrylate-based coatings for glass and metal surfaces
Pospiech, Doris; Jehnichen, Dieter; Starke, Sandra; Müller, Felix; Bünker, Tobias; Wollenberg, Anne; Häußler, Liane; Simon, Frank; Grundke, Karina; Oertel, Ulrich; Opitz, Michael; Kruspe, Rainer
2017-03-01
In order to prevent freshwater biofouling glass and metal surfaces were coated with novel transparent methacrylate-based copolymers. The multifunctionality of the copolymers, such as adhesion to the substrate, surface polarity, mechanical long-term stability in water, and ability to form metal complexes was inserted by the choice of suitable comonomers. The monomer 2-acetoacetoxy ethyl methacrylate (AAMA) was used as complexing unit to produce copper(II) complexes in the coating's upper surface layer. The semifluorinated monomer 1H,1H,2H,2H-perfluorodecyl methacrylate was employed to adjust the surface polarity and wettability. Comprehensive surface characterization techniques, such as X-ray photoelectron spectroscopy (XPS) and contact angle measurements showed that surface compositions and properties can be easily adjusted by varying the concentrations of the comonomers. The formation of copper(II) complexes along the copolymer chains and their stability against washing out with plenty of water was proven by XPS. Copolymers containing semifluorinated comonomers significantly inhibited the growth of Achnanthidium species. Copolymers with copper-loaded AAMA-sequences were able to reduce both the growth of Achnanthidium spec. and Staphylococcus aureus.
Capturing of staphylococcus aureus onto an interface containing graft chains
International Nuclear Information System (INIS)
Lee, W.; Furusaki, Shintaro; Saito, Kyoichi; Sugo, Takanobu; Makuuchi, Keizo.
1995-01-01
A microbial-cell-capturing material was prepared by radiation-induced grafting of glycidyl methacrylate onto a polyethylene-based fiber before the introduction of diethylamine. The prepared fiber was tested against a Staphylococcus aureus and Escherichia coli solution. The results showed that the grafted-type fiber had a capturing rate constant 1000-fold higher than the commercial crosslinked-type bead for S. aureus and that an activation energy of 39 kJ/mol was obtained for the microbial-cell-capturing action. (author)
Energy Technology Data Exchange (ETDEWEB)
Choi, Yong-Seok; Chio, Sang-Won; Byun, Hun-Soo [Chonnam National University, Yeosu (Korea, Republic of)
2016-01-15
The phase behavior curves of binary and ternary system were measured for poly(alkyl methacrylate) in supercritical CO{sub 2}, as well as for the poly(alkyl methacrylate)+dimethyl ether (DME) (or 1-butene) in CO{sub 2}. The solubility curves are reported for the poly(alkyl methacrylate)+DME in supercritical CO{sub 2} at temperature from (300 to 465) K and a pressure from (3.66 to 248) MPa. Also, The high-pressure static-type apparatus of cloud-point curve was tested by comparing the measured phase behavior data of the poly(methyl methacrylate) [PMMA]+CO{sub 2}+20.0 and 30.4 wt% methyl methacrylate (MMA) system with literature data of 10.4, 28.8 and 48.4 wt% MMA concentration. The phase behavior data for the poly(alkyl methacrylate)+CO{sub 2}+DME mixture were measured in changes of the pressure-temperature (p, T) slope and with DME concentrations. Also, the cloud-point pressure for the poly(alkyl methacrylate)+1- butene solution containing supercritical CO{sub 2} shows from upper critical solution temperature (UCST) region to lower critical solution temperature (LCST) region at concentration range from (0.0 to 95) wt% 1-butene at below 455 K and at below 245MPa.
Adsorption of lead from aqueous solutions by poly (methyl methacrylate)
International Nuclear Information System (INIS)
Din, M.; Hussain, R.
1992-01-01
The adsorption capability of commercially manufactured poly (methyl methacrylate) for lead in aqueous medium has been investigated. Percent adsorption and distribution coefficient values have been determined in relation to the shaking time, amount of adsorbent, pH effects and concentration of lead in the solution. The experimental results are compatible with Freundlich type of adsorption behavior. It is discernible from the experimental results that poly (methyl methacrylate) can be used for the removal of lead from slightly acidic aqueous solutions. (author)
Assessment of the skin sensitising potency of the lower alkyl methacrylate esters.
Kimber, Ian; Pemberton, Mark A
2014-10-01
There is continued interest in, and imperatives for, the classification of contact allergens according to their relative skin sensitising potency. However, achieving that end can prove problematic, not least when there is an apparent lack of concordance between experimental assessments of potency and the prevalence allergic contact dermatitis as judged by clinical experience. For the purpose of exploring this issue, and illustrating the important considerations that are required to reach sound judgements about potency categorisation, the lower alkyl methacrylate esters (LAM) have been employed here as a case study. Although the sensitising potential of methyl methacrylate (MMA) has been reviewed previously, there is available new information that is relevant for assessment of skin sensitising potency. Moreover, for the purposes of this article, analyses have been extended to include also other LAM for which relevant data are available: ethyl methacrylate (EMA), n-butyl methacrylate (nBMA), isobutyl methacrylate (iBMA), and 2-ethylhexyl methacrylate (EHMA). In addressing the skin sensitising activity of these chemicals and in drawing conclusions regarding relative potency, a number of sources of information has been considered, including estimates of potency derived from local lymph node assay (LLNA) data, the results of guinea pig assays, and data derived from in silico methods and from recently developed in vitro approaches. Moreover, clinical experience of skin sensitisation of humans by LAM has also been evaluated. The conclusion drawn is that MMA and other LAM are contact allergens, but that none of these chemicals has any more than weak skin sensitising potency. We have also explored here the possible bases for this modest sensitising activity. Finally, the nature of exposure to LAM has been reviewed briefly and on the basis of that information, together with an understanding of skin sensitising potency, a risk assessment has been prepared. Copyright © 2014
Polymerization of sodium methacrylate induced by irradiation
International Nuclear Information System (INIS)
Galvan S, A.
1998-01-01
This work has two objectives, first: it is pretended to localize the lines of carbon links in its IR spectra, and second: following the polymerization of sodium methacrylate according to that it is irradiated with gamma rays. (Author)
Structure and properties of hybrid poly(2-hydroxyethyl methacrylate)/SiO2 monoliths
DEFF Research Database (Denmark)
Ji, Xiangling; Jiang, Shichun; Qiu, Xuepeng
2003-01-01
Abstract: Hybrid poly(2-hydroxyethyl methacrylate) (PHEMA)/SiO2 monoliths were synthesized via a sol-gel process of the precursor tetraethyl orthosilicate (TEOS) and the in situ free-radical polymerization of 2-hydroxyethyl methacrylate (HEMA). The weight ratio of the starting chemicals, TEOS...
SYNTHESIS OF METHACRYLATES FROM COAL-DERIVED SYNGAS
Energy Technology Data Exchange (ETDEWEB)
Jang, B.W.L.; Spivey, J.J.; Gogate, M.R.; Zoeller, J.R.; Colberg, R.D.; Choi, G.N.
1999-12-01
Research Triangle Institute (RTI), Eastman Chemical Company, and Bechtel have developed a novel process for synthesis of methyl methacrylate (MMA) from coal-derived syngas, under a contract from the US Department of Energy/Fossil Energy Technology Center (DOE/FETC). This project has resulted in five US patents (four already published and one pending publication). It has served as the basis for the technical and economic assessment of the production of this high-volume intermediate from coal-derived synthesis gas. The three-step process consists of the synthesis of a propionate from ethylene carbonylation using coal-derived CO, condensation of the propionate with formaldehyde to form methacrylic acid (MAA); and esterification of MAA with methanol to yield MMA. The first two steps, propionate synthesis and condensation catalysis, are the key technical challenges and the focus of the research presented here.
Troelstra, E.J; van Dierendonck, L.L.; Janssen, L.P.B.M.; Renken, A.
2002-01-01
The Buss-Kneader has proven to be a suitable reactor for the polymerization of acrylates. In this second part, the polymerization of methyl methacrylate and the ter-polymerization of methyl methacrylate (MMA), hydroxyethyl methacrylate and n-butylmethacrylate is carried out in a pilot Buss-Kneader.
(Meth)Acrylate Occupational Contact Dermatitis in Nail Salon Workers: A Case Series.
DeKoven, Samuel; DeKoven, Joel; Holness, D Linn
Recently, many cases of acrylate-associated allergic contact dermatitis have appeared among nail salon workers. Common acrylate-containing products in nail salons include traditional nail polish, ultraviolet-cured shellac nail polish, ultraviolet-cured gel nails, and press-on acrylic nails. Nail salon technicians seen in the occupational medicine clinic in 2015 and 2016 were identified, and their patch test results and clinical features were summarized. Patch testing was done with the Chemotechnique (Meth)Acrylate nail series, and either the North American Standard series or the North American Contact Dermatitis Group screening series. Six patients were identified, all women, ages 38 to 58. Common presentations included erythematous dermatitis of the dorsa of the hands, palms, and forearms and fissures on the fingertips. Less common sites of eruptions included the periorbital region, cheeks, posterior ears, neck, sacral area, lateral thighs, and dorsa of the feet. All patients reacted to hydroxyethyl methacrylate, and 5 patients reacted to ethyl acrylate. Each patient also reacted to (meth)acrylates that are not found on either standard series, including ethyleneglycol dimethacrylate, 2-hydroxypropyl methacrylate, and 2-hydroxyethyl acrylate. The authors report 6 cases of allergic contact dermatitis to acrylates in nail technicians seen over the past year, representing a new trend in their clinic. These cases are reflective of a growing trend of nail technicians with allergic contact dermatitis associated with occupational (meth)acrylate exposure. Efforts to improve prevention are needed.
Functionalization and Chemical Modification of 2-Hydroxyethyl Methacrylate with Carboxylic Acid
Directory of Open Access Journals (Sweden)
Mohammad Hossein Nasirtabrizi
2012-01-01
Full Text Available Free radical polymerization of the resulting monomers methyl methacrylate (MMA, ethyl methacrylate (EMA, methylacrylate (MA and ethylacrylate (EA with 2-hydroxyethyl methacrylate (HEMA (in 1:1 mole ratio were carried out using azobis(isoboutyronitrile (AIBN as initiator at the temperature ranges 60-70°C. The modification of polymers were carried out by 9-anthracenecarboxylic acid (9-ACA via the esterification reaction between —OH of poly(HEMA and —COOH of 9-ACA, in presence of N,N′-dicyclohexyl-carbodiimide (DCC, 4-(dimethylamino pyridine (DMAP and N,N-dimethyl formamid (DMF. It was found that the molar ratio acid/alcohol/catalysts= 0.02: 0.02: 0.02 and 0.002, optimal for preparation of the ester. As demonstrated by FT-IR, 1H-NMR and dynamic mechanical thermal analysis (DMTA. The Tg value of methacrylate and acrylate copolymers containing 9-ACA groups was found to increase with incorporation of 9-ACA groups in polymer structures. The presence of 9-ACA groups in the polymer side chains created new polymers with novel modified properties that find some applications in polymer industry. These anthracenic factors could take part in cyclo addition reaction with other factors such as anhydrides and kinons.
Shemper, Bianca Sadicoff
The research presented in this dissertation involves the design of polymers for biomaterials and for coatings applications. The development of non-wettable, hard UV-curing, or reactive coatings is discussed. The biomaterials section involves the syntheses of linear and star-like polymers of the functionalized monomer poly(propylene glycol) monomethacrylate (PPGM) via atom transfer radical polymerization (ATRP) (Chapter II). Its copolymerization with a perfluoroalkyl ethyl methacrylate monomer (1H,1H,2H,2H-heptadecafluorodecyl methacrylate) and the syntheses of linear and star-like amphiphilic copolymers containing the fluorinated monomer and poly(ethyleneglycol) methyl ether methacrylate (MPEGMA) are discussed in Chapter III. The four-arm amphiphilic block copolymer obtained showed unique associative properties leading to micellization in selective solvents. Chapter IV includes research involving the design of films with low surface energy by incorporating fluorine into the polymer. The synthesis, characterization and polymerization of a perfluoroalkylether-substituted methacrylic acid (C8F7) are discussed, and the properties of coatings obtained after its photopolymerization on different substrates are evaluated to confirm formation of low-surface energy polymeric coatings. Subsequently, hard coatings based on methyl (alpha-hydroxymethyl)acrylate (MHMA) were prepared via photopolymerization using UV-light. Firstly, mechanistic investigations into the photopolymerization behavior of (alpha-hydroxymethyl)acrylates (RHMA's) are reported (Chapter V). RHMA derivatives were photopolymerized with various multifunctional acrylates and methacrylates and the effect of crosslinker type and degree of functionality on photopolymerization rates and conversions was investigated. Then, in Chapter VI the synthesis of a series of new crosslinkers is described and their photopolymerization kinetics was investigated in bulk. The effect of these novel crosslinkers on the
Immobilization of biomolecules to plasma polymerized pentafluorophenyl methacrylate.
Duque, Luis; Menges, Bernhard; Borros, Salvador; Förch, Renate
2010-10-11
Thin films of plasma polymerized pentafluorophenyl methacrylate (pp-PFM) offer highly reactive ester groups throughout the structure of the film that allow for subsequent reactions with different aminated reagents and biological molecules. The present paper follows on from previous work on the plasma deposition of pentafluorophenyl methacrylate (PFM) for optimum functional group retention (Francesch, L.; Borros, S.; Knoll, W.; Foerch, R. Langmuir 2007, 23, 3927) and reactivity in aqueous solution (Duque, L.; Queralto, N.; Francesch, L.; Bumbu, G. G.; Borros, S.; Berger, R.; Förch, R. Plasma Process. Polym. 2010, accepted for publication) to investigate the binding of a biologically active peptide known to induce cellular adhesion (IKVAV) and of biochemically active proteins such as BSA and fibrinogen. Analyses of the films and of the immobilization of the biomolecules were carried out using infrared reflection absorption spectroscopy (IRRAS), X-ray photoelectron spectroscopy (XPS), and atomic force microscopy (AFM). The attachment of the biomolecules on pulsed plasma polymerized pentafluorophenyl methacrylate was monitored using surface plasmon resonance spectroscopy (SPR). SPR analysis confirmed the presence of immobilized biomolecules on the plasma polymer and was used to determine the mass coverage of the peptide and proteins adsorbed onto the films. The combined analysis of the surfaces suggests the covalent binding of the peptide and proteins to the surface of the pp-PFM.
Directory of Open Access Journals (Sweden)
Rori Sasmita
2018-01-01
Full Text Available The change of the tooth colour could be restored with bleaching. The tooth bleaching will affects the surface roughness of the composite resins. Recently, the material basis for composite resins has developed, among others are methacrylate-based and silorane based composite resins. The objective of this study was to distinguish the surface roughness value of methacrylate-based composite resin and silorane based composite resins. This research was quasi-experimental. The sample used in this study were methacrylate and silorane based composite resins in discs form, with the size of 6 mm and the thickness of 3 mm, manufactured into 20 specimens and divided into 2 groups. The control group was immersed in the artificial saliva, and the treatment group was applied with 40% hydrogen peroxide. The result of the experiment analyzed using unpaired sample t-test showed significant differences in the average value of the surface roughness after the application of 40% hydrogen peroxide. The average value of methacrylate and silorane based composite resins were 2.744 μm and 3.417 μm, respectively. There was a difference in the surface roughness of methacrylate and silorane based composite resin compounds after the application of 40% hydrogen peroxide. The surface roughness value of the silorane-based composite resin was higher than the methacrylate-based.
Oláh, A.; Hempenius, Mark A.; Vancso, Gyula J.
2004-01-01
In this research, novel 3-(2-pyridyl)propyl methacrylate and 3-(3-pyridyloxy)propyl methacrylate monomers were synthesized and emulsion polymerized on colloidal polystyrene seeds, resulting in core–shell latex systems. The cores and the core–shell particles were characterized by static light
Wettability and ζ potentials of a series of methacrylate polymers and copolymers
Hogt, A.H.; Gregonis, D.E.; Andrade, J.D.; Kim, S.W.; Dankert, J.; Feijen, Jan
1985-01-01
Polymers and copolymers of different methacrylates were synthesized and coated on glass slides. The surfaces of the polymer films were characterized by their water contact angles and potentials using the Wilhelmy plate technique and streaming potential measurements, respectively. From contact-angle measurements information was also obtained about mobility of surface polymer chains. Receding contact angles of methyl methacrylate (MMA) copolymers containing hydrophilic or charged units were dec...
International Nuclear Information System (INIS)
Rashid, H.; Ahmad, M.; Minhas, M. U.; Aamir, M. F.; Sohail, M.
2015-01-01
Objective of the study was to synthesize a chemically cross-linked poly(hydroxyethylmethacrylate-co-methacrylic acid) hydrogel (p(HEMA-co-MAA hydrogel)) for pH-responsive, controlled drug delivery of Flurbiprofen. pH-sensitive hydrogel drug delivery system was synthesized with the help of poly hydroxyethyl methacrylate (HEMA) and methacrylic acid (MAA) by using ethylene glycol dimethacrylate (EGDMA) as crosslinker. The monomers (HEMA and MAA) were successfully cross linked through free radical polymerization process, initiated by benzoyl peroxide in an aqueous medium. All formulations were loaded with Flurbiprofen as a model drug and evaluated at pH 1.2 and pH 7.4 to investigate pH-responsive nature of the system. Fourier transform infrared spectroscopy (FTIR) was performed to confirm the cross-linking of copolymer while thermo gravimetric analysis (TGA) and differential scanning calorimetry (DSC) were performed to evaluate the thermal stability of the system. Swelling studies and in-vitro release studies were carried out to evaluate pH-responsive nature of the hydrogels. FTIR confirmed that monomers were successfully cross-linked to form a copolymer. Hydrogel system showed less swelling at lower pH while at higher pH, it showed higher swelling, releasing drug in the same fashion. It was concluded that a stable hydrogel network was chemically cross-linked showing pH-responsive nature and thus, synthesized p(HEMA-co-MAA) hydrogels can be successfully employed as potential candidate for controlled drug delivery. (author)
Hoogenboom, L.A.P.
2016-01-01
EFSA was asked to deliver a scientific opinion on free and esterified 3- and 2-monochloropropane-1,2-diol (MCPD) and glycidyl esters in food. Esters of 3- and 2-MCPD and glycidol are contaminants of processed vegetable oils; free MCPDs are formed in some processed foods. The Panel on Contaminants in
Preparation of Rhodamine B Fluorescent Poly(methacrylic acid Coated Gelatin Nanoparticles
Directory of Open Access Journals (Sweden)
Zhenhai Gan
2011-01-01
Full Text Available Poly(methacrylic acid (PMAA-coated gelatin nanoparticles encapsulated with fluorescent dye rhodamine B were prepared by the coacervation method with the aim to retard the release of rhodamine B from the gelatin matrix. With sodium sulfate as coacervation reagent for gelatin, a kind of biopolymer with excellent biocompatibility, the formed gelatin nanoparticles were cross-linked by formaldehyde followed by the polymerization of methacrylic acid coating. The fluorescent poly(methacrylic acid coated gelatin (FPMAAG nanoparticles had a uniform spherical shape and a size distribution of 60±5 nm. Infrared spectral analysis confirmed the formation of PMAA coating on the gelatin nanoparticles. Based on UV-Vis spectra, the loading efficiency of rhodamine B for the FPMAAG nanoparticles was 0.26 μg per mg nanoparticles. The encapsulated rhodamine B could sustain for two weeks. Favorable fluorescence property and fluorescence imaging of cells confirmed that the FPMAAG nanoparticles have promising biochemical, bioanalytical, and biomedical applications.
Energy Technology Data Exchange (ETDEWEB)
Luo, Chunhong; Xu, Guoguang; Wang, Xinghui [Department of Materials Science and Engineering, College of Science and Engineering, Jinan University, Guangzhou 510632 (China); Tu, Mei; Zeng, Rong; Rong, Jianhua [Department of Materials Science and Engineering, College of Science and Engineering, Jinan University, Guangzhou 510632 (China); Engineering Research Center of Artificial Organs and Materials, Ministry of Education, Guangzhou 510632 (China); Zhao, Jianhao, E-mail: jhzhao@jnu.edu.cn [Department of Materials Science and Engineering, College of Science and Engineering, Jinan University, Guangzhou 510632 (China); Engineering Research Center of Artificial Organs and Materials, Ministry of Education, Guangzhou 510632 (China)
2015-01-01
A series of self-reinforcing hyaluronan hydrogels were developed to improve mechanical properties and protein sustained delivery thanks to a dually cross-linked network. Hyaluronan gel particles (HGPs, 1–5 μm in diameter) with different cross-linking densities, i.e. HGPs-1.5, HGPs-3 and HGPs-15, were prepared in an inverse emulsion system and used as the reinforcing phase after glycidyl methacrylation, while glycidyl methacrylated hyaluronan with a substitution degree of 45.2% was synthesized as the matrix phase. These two phases were cross-linked under ultraviolet irradiation to form self-reinforcing hyaluronan hydrogels (srHAs) that showed typical cross-linked structure of HGPs connecting the matrix phase by cross-section observation. In comparison to hyaluronan bulk gels and their blends with HGPs, srHAs distinctly enhanced the mechanical properties and BSA long-term sustained delivery, especially srHA-1.5 showed the highest compressive modulus of 220 ± 15 kPa and the slowest BSA delivery (67% release at 14 d). The 3T3 fibroblast cell culture showed that all the srHAs had no cytotoxicity. - Highlights: • New self-reinforcing HA hydrogels with a dually cross-linked network were developed. • Self-reinforcing HA hydrogels greatly enhanced the mechanical properties. • Self-reinforcing HA hydrogels prolonged the sustained delivery of BSA. • The self-reinforcing mechanism and BSA diffusion mechanism were discussed. • Self-reinforcing HA hydrogels had no cytotoxicity to 3T3 fibroblast cells.
International Nuclear Information System (INIS)
Luo, Chunhong; Xu, Guoguang; Wang, Xinghui; Tu, Mei; Zeng, Rong; Rong, Jianhua; Zhao, Jianhao
2015-01-01
A series of self-reinforcing hyaluronan hydrogels were developed to improve mechanical properties and protein sustained delivery thanks to a dually cross-linked network. Hyaluronan gel particles (HGPs, 1–5 μm in diameter) with different cross-linking densities, i.e. HGPs-1.5, HGPs-3 and HGPs-15, were prepared in an inverse emulsion system and used as the reinforcing phase after glycidyl methacrylation, while glycidyl methacrylated hyaluronan with a substitution degree of 45.2% was synthesized as the matrix phase. These two phases were cross-linked under ultraviolet irradiation to form self-reinforcing hyaluronan hydrogels (srHAs) that showed typical cross-linked structure of HGPs connecting the matrix phase by cross-section observation. In comparison to hyaluronan bulk gels and their blends with HGPs, srHAs distinctly enhanced the mechanical properties and BSA long-term sustained delivery, especially srHA-1.5 showed the highest compressive modulus of 220 ± 15 kPa and the slowest BSA delivery (67% release at 14 d). The 3T3 fibroblast cell culture showed that all the srHAs had no cytotoxicity. - Highlights: • New self-reinforcing HA hydrogels with a dually cross-linked network were developed. • Self-reinforcing HA hydrogels greatly enhanced the mechanical properties. • Self-reinforcing HA hydrogels prolonged the sustained delivery of BSA. • The self-reinforcing mechanism and BSA diffusion mechanism were discussed. • Self-reinforcing HA hydrogels had no cytotoxicity to 3T3 fibroblast cells
Chen, Kai; Zhang, Lingyi; Zhang, Weibing
2018-03-30
In this work, an open-tubular capillary liquid-phase column was prepared by modifying chain polymer on the inner surface of capillary and chemical bonding of metal organic frameworks, NH 2 -UiO-66, to the brushes of chain polymer (poly(glycidyl methacrylate)). Besides advantages of facial preparation and good permeability, the chain polymer effectively increases the modification amount of NH 2 -UiO-66 nanoparticles to increase the phase ratio of open-tubular capillary column and enhance the interactions with analytes. The results of scanning electron microscope energy-dispersive X-ray spectra indicated that NH 2 -UiO-66 nanoparticles were successfully bonded to the chain polymer. Because of the hydrophobic interaction and hydrogen bonding interaction between the analytes and the ligand of NH 2 -UiO-66, different analytes were well separated on the NH 2 -UiO-66-modified poly(glycidyl methacrylate) capillary (1.12 m × 25 μm id × 365 μm od) with the high absolute column efficiency reaching 121 477 plates, benefiting from an open-tubular column and low mass transfer resistance provided by polymer brush and metal-organic framework crystal. The relative standard deviations of the retention time for run-to-run, day-to-day, and column-to-column (n = 3) runs are below 4.28%, exhibiting good repeatability. Finally, the column was successfully applied to separation of flavonoids in licorice. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Wei, Dan; Liu, Junwei; Guo, Ming; Zhu, Yan
2017-11-01
A simple method for the determination of betaine, l-carnitine, and choline in human urine was developed based on column-switching ion chromatography coupled with nonsuppressed conductivity detection by using a self-packed column. A pretreatment column (50 mm × 4.6 mm, id) packed with poly(glycidyl methacrylate-divinylbenzene) microspheres was used for the extraction and cleanup of analytes. Chromatographic separation was achieved within 10 min on a cationic exchange column (150 mm × 4.6 mm, id) using maleic anhydride modified poly(glycidyl methacrylate-divinylbenzene) as the particles for packing. The detection was performed by ion chromatography with nonsuppressed conductivity detection. Parameters including column-switching time, eluent type, flow rates of eluent, and interfering effects were optimized. Linearity (r 2 ≥ 0.99) was obtained for the concentration range of 0.50-100, 0.75-100, and 0.25-100 μg/mL for betaine, l-carnitine, and choline, respectively. Detection limits were 0.12, 0.20, and 0.05 μg/mL for betaine, l-carnitine, and choline, respectively. The intra- and interday accuracy and precision for all quality controls were within ±10.11%. Satisfactory recovery was observed between 92.5 and 105.0%. The validated method was successfully applied for the determination of betaine, l-carnitine, and choline in urine samples from healthy people. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Plant oil-based shape memory polymer using acrylic monolith
Directory of Open Access Journals (Sweden)
T. Tsujimoto
2015-09-01
Full Text Available This article deals with the synthesis of a plant oil-based material using acrylic monolith. An acrylic monolith bearing oxirane groups was prepared via simple technique that involved the dissolution of poly(glycidyl methacrylate-comethyl methacrylate (PGMA in ethanolic – aqueous solution by heating and subsequent cooling. The PGMA monolith had topologically porous structure, which was attributed to the phase separation of the polymer solution. The PGMA monolith was impregnated by epoxidized soybean oil (ESO containing thermally-latent catalyst, and the subsequent curing produced a crosslinked material with relatively good transparency. The Young’s modulus and the tensile strength of polyESO/PGMA increased compared with the ESO homopolymer. The strain at break of polyESO/PGMA was larger than that of the ESO homopolymer and crosslinked PGMA. Furthermore, polyESO/PGMA exhibited good shape memory-recovery behavior.
Penile enlargement with methacrylate injection: is it safe?
Directory of Open Access Journals (Sweden)
Fabio Cesar Miranda Torricelli
Full Text Available CONTEXTPenis size is a great concern for men in many cultures. Despite the great variety of methods for penile augmentation, none has gained unanimous acceptance among experts in the field. However, in this era of minimally invasive procedure, injection therapy for penile augmentation has become more popular. Here we report a case of methacrylate injection in the penis that evolved with penile deformity and sexual dysfunction. This work also reviews the investigation and management of this pathological condition.CASE REPORTA 36-year-old male sought medical care with a complaint of penile deformity and sexual dysfunction after methacrylate injection. The treatment administered was surgical removal. Satisfactory cosmetic and functional results were reached after two months.CONCLUSIONSThere is a need for better structured scientific research to evaluate the outcomes and complication rates from all penile augmentation procedures.
Penile enlargement with methacrylate injection: is it safe?
Torricelli, Fabio Cesar Miranda; Andrade, Enrico Martins de; Marchini, Giovanni Scala; Lopes, Roberto Iglesias; Claro, Joaquim Francisco Almeida; Cury, Jose; Srougi, Miguel
2013-01-01
CONTEXT Penis size is a great concern for men in many cultures. Despite the great variety of methods for penile augmentation, none has gained unanimous acceptance among experts in the field. However, in this era of minimally invasive procedure, injection therapy for penile augmentation has become more popular. Here we report a case of methacrylate injection in the penis that evolved with penile deformity and sexual dysfunction. This work also reviews the investigation and management of this pathological condition. CASE REPORT A 36-year-old male sought medical care with a complaint of penile deformity and sexual dysfunction after methacrylate injection. The treatment administered was surgical removal. Satisfactory cosmetic and functional results were reached after two months. CONCLUSIONS There is a need for better structured scientific research to evaluate the outcomes and complication rates from all penile augmentation procedures.
Daikos, Olesya; Naumov, Sergej; Knolle, Wolfgang; Heymann, Katja; Scherzer, Tom
2016-11-30
Pentabrominated and fluorinated aromatic (meth)acrylates as well as their non-halogenated counterparts have been studied with the aim to avoid conventional photoinitiators and to overcome some negative consequences related to their use. Therefore, RTIR spectroscopy, laser flash photolysis and GC/MS were utilized. Even low concentrations (1 to 5 wt%) of brominated (meth)acrylates in the model varnish lead to initiation of a photopolymerization reaction under exposure to UV light with λ > 300 nm. This is due to the fact that excitation of the aryl moiety leads to the homolysis of bromine-phenyl bonds with a high quantum yield of ∼0.15-0.3. Both, bromine radicals released from either ortho, meta or para position as well as the corresponding tetrabromoaryl radicals, may initiate the polymerization of brominated aromatic (meth)acrylates. In contrast, fluorinated aromatic (meth)acrylates undergo α-cleavage of the carboxyl group (as in the case of non-halogenated aromatic (meth)acrylates), if excitation of the acrylic double bonds is done with UV-C light (λ fluorinated) and 0.16-0.36 (non-halogenated compounds), despite the different pathway of fragmentation. Thus, in all cases the efficiency of initiation is comparable to conventional photoinitiators. Quantum chemical calculations of orbitals involved and of the Gibbs free energy of transients and products support the suggested reaction pathway.
Directory of Open Access Journals (Sweden)
Hahn, Eckhart G.
2009-08-01
Full Text Available [english] The Framework for Qualifications of the European Higher Education Area (FQ-EHEA; Bologna Process and the European Qualifications Framework for Lifelong Learning (EQF-LLL; Lisbon Process are competence-driven frameworks for vocational and higher education programmes in need for defined learning objectives. In the field of medical education, The Netherlands and Switzerland have developed national catalogues for undergraduate medical training, which are competence-based and compatible with a two-cycle curriculum comprised of a Bachelor in Medicine and a Master in Medicine. In Germany, virtually all medical organizations, last not least the Association of Medical Faculties (MFT, have voted against the application of the two-cycle (and the three-cycle curriculum to medical undergraduate education. A standstill of the European processes will not be accepted in the political arena, and a proposition was made by the Conference of German Ministers of Higher Education to develop a medical qualification framework for Germany, asking the Association for Medical Education (GMA and the MFT to join forces. This is not possible without consented national learning objectives derived from the professional context of physicians. The GMA has teamed up with the MFT to develop National Competence-Based Learning Objectives for Undergraduate Medical Education (NKLM in Germany (see Figure 1 to fulfill these needs.
Radiation polymerization of 2-hydroxyethyl methacrylate-vinyl pyrrolidone-water system
International Nuclear Information System (INIS)
Kumakura, M.; Kaetsu, I.
1988-01-01
Polymerization was studied using mixtures of 2-hydroxyethyl methacrylate(HEMA)-water, vinyl pyrrolidone(NVP)-water and 2-hydroxyethyl methacrylate-vinyl pyrrolidone-water. The mixtures were irradiated with gamma radiation from a 60 Co source. Irradiation was carried out at temperatures of 0, -24, -45, -63, -78, and -196 degC. The dependence was studied of the polymerization rate on temperature during irradiation for the individual mixtures, as were the effect of monomer composition on the polymerization of the HEMA-NVP-water system at 0 degC, the effect of water on NVP polymerization and the relationship between water absorption and the composition of the monomer. (E.S.). 4 figs., 6 refs
Seko, Noriaki; Hoshina, Hiroyuki; Kasai, Noboru; Shibata, Takuya; Saiki, Seiichi; Ueki, Yuji
2018-02-01
Six years after the Fukushima-nuclear accident, the dissolved radioactive cesium (Cs) is now hardly detected in environmental natural waters. These natural waters are directly used as source of drinking and domestic waters in disaster-stricken areas in Fukushima. However, the possibility that some radioactive Cs adsorbed on soil or leaves will contaminate these natural waters during heavy rains or typhoon is always present. In order for the returning residents to live with peace of mind, it is important to demonstrate the safety of the domestic waters that they will use for their daily life. For this purpose, we have synthesized a material for selective removal of radioactive Cs by introducing ammonium 12-molybdophosphate (AMP) onto polyethylene nonwoven fabric through radiation-induced emulsion graft polymerization technique. Water purifiers filled with the grafted Cs adsorbent were installed in selected houses in Fukushima. The capability of the grafted adsorbent to remove Cs from domestic waters was evaluated for a whole year. The results showed that the tap water filtered through the developed water purifier contained no radioactive Cs, signifying the very effective adsorption performance of the developed grafted adsorbent. From several demonstrations, we have commercialized the water purifier named "KranCsair®". Furthermore, we have also developed a method for the mass production of the grafted nonwoven fabric. Using a 30 L grafting reactor, it was possible to produce the grafted nonwoven fabric with a suitable range of degree of grafting. When an irradiated roll of nonwoven trunk fabric with a length of 10 m and a width of 30 cm was set in the reactor filled with glycidyl methacrylate (GMA), AMP, Tween 80 monomer emulsion solution at 40 °C for 1 h, the difference of Dgs in the length and the width on roll of fabrics was negligible.
International Nuclear Information System (INIS)
Catalá-Icardo, M.; Torres-Cartas, S.; Meseguer-Lloret, S.; Gómez-Benito, C.; Carrasco-Correa, E.; Simó-Alfonso, E.F.; Ramis-Ramos, G.; Herrero-Martínez, J.M.
2017-01-01
In this work, a method for the preparation and anchoring of polymeric monoliths in a polytetrafluoroethylene (PTFE) tubing as a column housing for microbore HPLC is described. In order to assure a covalent attachment of the monolith to the inner wall of the PTFE tube, a two-step procedure was developed. Two surface etching reagents, a commercial sodium naphthalene solution (Fluoroetch"®), or mixtures of H_2O_2 and H_2SO_4, were tried and compared. Then, the obtained hydroxyl groups on the PTFE surface were modified by methacryloylation. Attenuated total reflectance Fourier-transform infrared (ATR-FTIR) spectroscopy and scanning electron microscopy (SEM) confirmed the successful modification of the tubing wall and the stable anchorage of monolith to the wall, respectively. Special emphasis was also put on the reduction of the unwanted effects of shrinking of monolith during polymerization, by using an external proper mold and by selecting the adequate monomers in order to increase the flexibility of the polymer. Poly(glycidyl methacrylate-co-divinylbenzene) monoliths were in situ synthesized by thermal polymerization within the confines of surface-vinylized PTFE tubes. The modified PTFE tubing tightly held the monolith, and the monolithic column exhibited good pressure resistance up to 20 MPa. The column performance was also evaluated via the isocratic separation of a series of alkylbenzenes in the reversed-phase mode. The optimized monolithic columns gave plate heights ranged between 70 and 80 μm. The resulting monoliths were also satisfactorily applied to the separation of proteins. - Highlights: • Successful surface etching of PTFE inner wall tubing was done. • The modified PTFE support was next methacryloylated with GMA. • Organic polymeric monolith was in situ prepared in the functionalized PTFE tube. • The monolithic columns gave suitable pressure resistance and separation of proteins.
Energy Technology Data Exchange (ETDEWEB)
Catalá-Icardo, M., E-mail: mocaic@qim.upv.es [Research Institute for Integrated Management of Coastal Areas, Universitat Politècnica de València, Paranimf 1, 46730, Grao de Gandía, Valencia (Spain); Torres-Cartas, S.; Meseguer-Lloret, S.; Gómez-Benito, C. [Research Institute for Integrated Management of Coastal Areas, Universitat Politècnica de València, Paranimf 1, 46730, Grao de Gandía, Valencia (Spain); Carrasco-Correa, E.; Simó-Alfonso, E.F.; Ramis-Ramos, G. [Department of Analytical Chemistry, Universitat de València, Dr. Moliner 50, 46100, Burjassot, Valencia (Spain); Herrero-Martínez, J.M., E-mail: jmherrer@uv.es [Department of Analytical Chemistry, Universitat de València, Dr. Moliner 50, 46100, Burjassot, Valencia (Spain)
2017-04-01
In this work, a method for the preparation and anchoring of polymeric monoliths in a polytetrafluoroethylene (PTFE) tubing as a column housing for microbore HPLC is described. In order to assure a covalent attachment of the monolith to the inner wall of the PTFE tube, a two-step procedure was developed. Two surface etching reagents, a commercial sodium naphthalene solution (Fluoroetch{sup ®}), or mixtures of H{sub 2}O{sub 2} and H{sub 2}SO{sub 4}, were tried and compared. Then, the obtained hydroxyl groups on the PTFE surface were modified by methacryloylation. Attenuated total reflectance Fourier-transform infrared (ATR-FTIR) spectroscopy and scanning electron microscopy (SEM) confirmed the successful modification of the tubing wall and the stable anchorage of monolith to the wall, respectively. Special emphasis was also put on the reduction of the unwanted effects of shrinking of monolith during polymerization, by using an external proper mold and by selecting the adequate monomers in order to increase the flexibility of the polymer. Poly(glycidyl methacrylate-co-divinylbenzene) monoliths were in situ synthesized by thermal polymerization within the confines of surface-vinylized PTFE tubes. The modified PTFE tubing tightly held the monolith, and the monolithic column exhibited good pressure resistance up to 20 MPa. The column performance was also evaluated via the isocratic separation of a series of alkylbenzenes in the reversed-phase mode. The optimized monolithic columns gave plate heights ranged between 70 and 80 μm. The resulting monoliths were also satisfactorily applied to the separation of proteins. - Highlights: • Successful surface etching of PTFE inner wall tubing was done. • The modified PTFE support was next methacryloylated with GMA. • Organic polymeric monolith was in situ prepared in the functionalized PTFE tube. • The monolithic columns gave suitable pressure resistance and separation of proteins.
DEFF Research Database (Denmark)
Petersen, Annette
EFSA was asked to deliver a scientific opinion on free and esterified 3- and 2-monochloropropane-1, 2-diol (MCPD) and glycidyl esters in food. Esters of 3- and 2-MCPD and glycidol are contaminants of processed vegetable oils; free MCPDs are formed in some processed foods. The Panel on Contaminant...
Kim, Sooyeon; Kim, Eunhye; Kim, Sungsoo; Kim, Woosik
2005-12-01
In this study we modified the surface of silica nanoparticles with methyl methacrylate by UV-induced graft polymerization. It is a surface-initiated polymerization reaction induced by ultraviolet irradiation. The resulting organic-inorganic nanocomposites were near-monodisperse and fabricated without homopolymerization of the monomer. Substantial increase in mean particle size was observed by SEM image analysis after UV-induced grafting of methyl methacrylate onto pure silica particles. FT-Raman spectroscopy and X-ray photoelectron spectroscopy studies of these materials revealed the successful grafting of methyl methacrylate onto the silica surface. The formation of a covalent bond between the grafted PMMA chains and silica surface was indicated by FT-Raman spectra. Thermogravimetric analysis of the PMMA-grafted silica particles indicated the polymer contents in good agreement with SEM photographs.
Physical properties of agave cellulose graft polymethyl methacrylate
Energy Technology Data Exchange (ETDEWEB)
Rosli, Noor Afizah; Ahmad, Ishak; Abdullah, Ibrahim; Anuar, Farah Hannan [Polymer Research Centre (PORCE), School of Chemical Sciences and Food Technology, Faculty of Science and Technology, Universiti Kebangsaan Malaysia, 43600 Bangi Selangor (Malaysia)
2013-11-27
The grafting polymerization of methyl methacrylate and Agave cellulose was prepared and their structural analysis and morphology were investigated. The grafting reaction was carried out in an aqueous medium using ceric ammonium nitrate as an initiator. The structural analysis of the graft copolymers was carried out by Fourier transform infrared and X-ray diffraction. The graft copolymers were also characterized by field emission scanning electron microscopy (FESEM). An additional peak at 1732 cm{sup −1} which was attributed to the C=O of ester stretching vibration of poly(methyl methacrylate), appeared in the spectrum of grafted Agave cellulose. A slight decrease of crystallinity index upon grafting was found from 0.74 to 0.68 for cellulose and grafted Agave cellulose, respectively. Another evidence of grafting showed in the FESEM observation, where the surface of the grafted cellulose was found to be roughed than the raw one.
Amdjadi, Parisa; Nojehdehian, Hanieh; Najafi, Farhood; Ghasemi, Amir; Seifi, Massoud; Dashtimoghadam, Erfan; Fahimipour, Farahnaz; Tayebi, Lobat
2017-07-01
Since octafluoropentyl methacrylate is an antifouling polymer, surface modification of polyether ether ketone with octafluoropentyl methacrylate is a practical approach to obtaining anti-biofilm biocompatible devices. In the current study, the surface treatment of polyether ether ketone by the use of ultraviolet irradiation, so as to graft (octafluoropentyl methacrylate) polymer chains, was initially implemented and then investigated. The Fourier-transform infrared and nuclear magnetic resonance spectra corroborated the appearance of new signals associated with the fluoroacrylate group. Thermogravimetric curves indicated enhanced asymmetry in the polymer structure due to the introduction of the said new groups. Measuring the peak area in differential scanning calorimetry experiments also showed additional bond formation. Static water contact angle measurements indicated a change in wettability to the more hydrophobic surface. The polyether ether ketone-octafluoropentyl methacrylate surface greatly reduced the protein adsorption. This efficient method can modulate and tune the surface properties of polyether ether ketone according to specific applications.
Directory of Open Access Journals (Sweden)
Henned Saade
2016-01-01
Full Text Available Ultrafine nanoparticles, less than 10 nm in mean diameter, of the FDA approved copolymer methyl methacrylate- (MMA- co-methacrylic acid (MAA, 2/1 (mol/mol, were prepared. The method used for the preparation of these particles stabilized in a latex containing around 11% solids includes the dosing of the monomers mixture on a micellar solution preserving monomer starved conditions. It is thought that the operation at these conditions combined with the hydrophilicity of MMA and MAA units favors the formation of ultrafine particles; the propagation reaction carried out within so small compartments renders copolymer chains rich in syndiotactic units very likely as consequence of the restricted movements of the end propagation of the chains. Because of their biocompatibility and biodegradability as well as their extremely small size these nanoparticles could be used as vehicles for improved drug delivery in the treatment of chronic-degenerative diseases.
Kinetics and mechanism of polymerization of methyl methacrylate ...
Indian Academy of Sciences (India)
Unknown
Kinetics and mechanism of polymerization of methyl methacrylate initiated by stibonium ylide. A K SRIVASTAVA and AJEY KUMAR CHAURASIA. Department of Chemistry, H B Technological Institute, Kanpur 208 002, India e-mail: akspolym@rediffmail.com. MS received 6 September 2002; revised 25 July 2003. Abstract.
Ermacora, Alessia; Hrnčiřík, Karel
2014-01-01
Substantial progress has been recently made in the development and optimisation of analytical methods for the quantification of 2-MCPD, 3-MCPD and glycidyl esters in oils and fats, and there are a few methods currently available that allow a reliable quantification of these contaminants in bulk oils and fats. On the other hand, no standard method for the analysis of foodstuffs has yet been established. The aim of this study was the development and validation of a new method for the simultaneous quantification of 2-MCPD, 3-MCPD and glycidyl esters in oil-based food products. The developed protocol includes a first step of liquid-liquid extraction and purification of the lipophilic substances of the sample, followed by the application of a previously developed procedure based on acid transesterification, for the indirect quantification of these contaminants in oils and fats. The method validation was carried out on food products (fat-based spreads, creams, margarine, mayonnaise) manufactured in-house, in order to control the manufacturing process and account for any food matrix-analyte interactions (the sample spiking was carried out on the single components used for the formulations rather than the final products). The method showed good accuracy (the recoveries ranged from 97% to 106% for bound 3-MCPD and 2-MCPD and from 88% to 115% for bound glycidol) and sensitivity (the LOD was 0.04 and 0.05 mg kg(-1) for bound MCPD and glycidol, respectively). Repeatability and reproducibility were satisfactory (RSD below 2% and 5%, respectively) for all analytes. The levels of salts and surface-active compounds in the formulation were found to have no impact on the accuracy and the other parameters of the method.
Energy Technology Data Exchange (ETDEWEB)
Giordanengo, Remi [Universites Aix-Marseille I, II et III - CNRS, UMR 6264: Laboratoire Chimie Provence, Spectrometries Appliquees a la Chimie Structurale, F-13397 Marseille (France); Viel, Stephane [Aix-Marseille Universite - CNRS, UMR 6263: Institut des Sciences Moleculaires de Marseille, Chimiometrie et Spectrometries, F-13397 Marseille (France); Hidalgo, Manuel; Allard-Breton, Beatrice [ARKEMA, Centre de Recherche Rhone Alpes, Rue Henri Moissan, F-69493 Pierre-Benite (France); Thevand, Andre [Universites Aix-Marseille I, II et III - CNRS, UMR 6264: Laboratoire Chimie Provence, Spectrometries Appliquees a la Chimie Structurale, F-13397 Marseille (France); Charles, Laurence, E-mail: laurence.charles@univ-provence.fr [Universites Aix-Marseille I, II et III - CNRS, UMR 6264: Laboratoire Chimie Provence, Spectrometries Appliquees a la Chimie Structurale, F-13397 Marseille (France)
2009-11-03
Mass spectrometry (MS) and nuclear magnetic resonance (NMR) have been combined to achieve the complete microstructural characterization of a poly(methacrylic acid)-poly(methyl methacrylate) (PMAA-PMMA) copolymer synthesized by nitroxide-mediated polymerization. Various PMAA-PMMA species could be identified which mainly differ in terms of terminaisons. {sup 1}H and {sup 13}C NMR experiments revealed the structure of the end-groups as well as the proportion of each co-monomer in the copolymers. These end-group masses were further confirmed from m/z values of doubly charged copolymer anions detected in the single stage mass spectrum. In contrast, copolymer composition derived from MS data was not consistent with NMR results, obviously due to strong mass bias well known to occur during electrospray ionization of these polymeric species. Tandem mass spectrometry could reveal the random nature of the copolymer based on typical dissociation reactions, i.e., water elimination occurred from any two contiguous MAA units while MAA-MMA pairs gave rise to the loss of a methanol molecule. Polymer backbone cleavages were also observed to occur and gave low abundance fragment ions which allowed the structure of the initiating end-group to be confirmed.
Fabrication and Evaluation of 2-Hydroxyethyl Methacrylate-co ...
African Journals Online (AJOL)
Purpose: To fabricate and evaluate oral 2-hydroxyethyl methacrylate co-acrylic acid hydrogels as a drug delivery system for sustained release of nicorandil. Methods: HEMA-co-AA hydrogels using different monomer concentrations were prepared by free radical polymerization. N, N-methylene bis acrylamide (MBA) was ...
Graft Copolymerization Of Methyl Methacrylate Onto Agave Cellulose
International Nuclear Information System (INIS)
Noor Afizah Rosli; Ishak Ahmad; Ibrahim Abdullah; Farah Hannan Anuar
2014-01-01
The grafting polymerization of methyl methacrylate (MMA) and Agave cellulose was prepared and the grafting reaction conditions were optimized by varying the reaction time and temperature, and ratio of monomer to cellulose. The resulting graft copolymers were characterized by Fourier transform infrared, X-ray diffraction analysis, thermogravimetric analysis, and scanning electron microscopy (SEM). The experimental results showed that the optimal conditions were at a temperature of 45 degree Celsius for 90 min with ratio monomer to cellulose at 1:1 (g/ g). An additional peak at 1738 cm -1 which was attributed to the C=O of ester stretching vibration of poly(methyl methacrylate), appeared in the spectrum of grafted Agave cellulose. A slight decrease of crystallinity index upon grafting was found from 0.74 to 0.68 for cellulose and grafted cellulose, respectively. Grafting of MMA onto cellulose enhanced its thermal stability and SEM observation further furnished evidence of grafting MMA onto Agave cellulose with increasing cellulose diameter and surface roughness. (author)
Synthesis and characterization of porous microspheres bearing pyrrolidone units
Energy Technology Data Exchange (ETDEWEB)
Maciejewska, M., E-mail: mmacieje@umcs.pl; Kołodyńska, D.
2015-01-15
Porous microspheres of glycydyl methacrylate (GMA) cross-linked with trimethylolpropane trimethacrylate (TRIM) were prepared with toluene as porogen by suspension-emulsion polymerization. With increasing molar ratio of the functional monomer to cross-linker, the epoxy group content increases significantly whereas the parameters of porous structure (specific surface area and total pore volume) decreases. In order to obtain adsorbents bearing functional groups the porous methacrylate network was modified by subsequent reaction with pyrrolidone. The materials were studied using elemental analysis, infrared spectroscopy, atomic force microscopy (AFM), attenuated total reflection (ATR) spectroscopy, Raman spectroscopy, thermal gravimetry. Additionally, polymers sorption capacity towards Cu(II) was investigated. - Highlights: • Porous microspheres with reactive epoxy group were synthesized. • Highly developed porous structure was created. • Pyrrolidone units were incorporated during ring–opening reaction. • Polymers sorption capacity towards Cu (II) was investigated.
Directory of Open Access Journals (Sweden)
Seiichiro Fujisawa
2012-01-01
Full Text Available We investigated the quantitative structure-activity relationships between hemolytic activity (log 1/H50 or in vivo mouse intraperitoneal (ip LD50 using reported data for α,β-unsaturated carbonyl compounds such as (methacrylate monomers and their 13C-NMR β-carbon chemical shift (δ. The log 1/H50 value for methacrylates was linearly correlated with the δCβ value. That for (methacrylates was linearly correlated with log P, an index of lipophilicity. The ipLD50 for (methacrylates was linearly correlated with δCβ but not with log P. For (methacrylates, the δCβ value, which is dependent on the π-electron density on the β-carbon, was linearly correlated with PM3-based theoretical parameters (chemical hardness, η; electronegativity, χ; electrophilicity, ω, whereas log P was linearly correlated with heat of formation (HF. Also, the interaction between (methacrylates and DPPC liposomes in cell membrane molecular models was investigated using 1H-NMR spectroscopy and differential scanning calorimetry (DSC. The log 1/H50 value was related to the difference in chemical shift (ΔδHa (Ha: H (trans attached to the β-carbon between the free monomer and the DPPC liposome-bound monomer. Monomer-induced DSC phase transition properties were related to HF for monomers. NMR chemical shifts may represent a valuable parameter for investigating the biological mechanisms of action of (methacrylates.
Increased radiation degradation in methyl methacrylate copolymers
International Nuclear Information System (INIS)
Helbert, J.N; Wagner, G.E.; Caplan, P.J.; Poindexter, E.H.
1975-01-01
The effect of polar substituents at the quaternary carbon on degradation processes in several polymers and 10 to 20 percent copolymers of methyl methacrylate was explored. EPR was used to monitor radiation degradation products and to determine radiation G values. Irradiations were carried out at 77 0 K in a gamma irradiator at a dose rate of 0.3 Mrad/hr. (U.S.)
Akkaya, Alper; Pazarlioglu, Nurdan
2013-01-01
Poly(3-hydroxybutyrate) is nontoxic and biodegradable, with good biocompatibility and potential support for long-term implants. For this reason, it is a good support for enzyme immobilization. Enzyme immobilization could not be done directly because poly(3-hydroxybutyrate) has no functional groups. Therefore, modification should be done for enzyme immobilization. In this study, methacrylic acid was graft polymerized to poly(3-hydroxybutyrate) and thrombin was immobilized to polymethacrylic acid grafted poly(3-hydroxybutyrate). In fact, graft polymerization of methacrylic acid to poly(3-hydroxybutyrate) and thrombin immobilization was a model study. Biomolecule immobilized poly(3-hydroxybutyrate) could be used as an implant. Thrombin was selected as a biomolecule for this model study and it was immobilized to methacrylic acid grafted poly(3-hydroxybutyrate). Then the developed product was used to stop bleeding.
2008-10-27
was repeated twice, dissolving the product in chloroform and diethyl ether, respectively. The polymer was dried at 60 °C under vacuum overnight...the Tg of the i Bu remains the same. Table 1. Tg for Butyl Methacrylate-co- Propyl Methacryl POSS Polymers with Various POSS Substituents
Functionalized polymer film surfaces via surface-initiated atom transfer radical polymerization
International Nuclear Information System (INIS)
Hu, Y.; Li, J.S.; Yang, W.T.; Xu, F.J.
2013-01-01
The ability to manipulate and control the surface properties of polymer films, without altering the substrate properties, is crucial to their wide-spread applications. In this work, a simple one-step method for the direct immobilization of benzyl chloride groups (as the effective atom transfer radical polymerization (ATRP) initiators) on the polymer films was developed via benzophenone-induced coupling of 4-vinylbenzyl chloride (VBC). Polyethylene (PE) and nylon films were selected as examples of polymer films to illustrate the functionalization of film surfaces via surface-initiated ATRP. Functional polymer brushes of (2-dimethylamino)ethyl methacrylate, sodium 4-styrenesulfonate, 2-hydroxyethyl methacrylate and glycidyl methacrylate, as well as their block copolymer brushes, have been prepared via surface-initiated ATRP from the VBC-coupled PE or nylon film surfaces. With the development of a simple approach to the covalent immobilization of ATRP initiators on polymer film surfaces and the inherent versatility of surface-initiated ATRP, the surface functionality of polymer films can be precisely tailored. - Highlights: ► Atom transfer radical polymerization initiators were simply immobilized. ► Different functional polymer brushes were readily prepared. ► Their block copolymer brushes were also readily prepared
Acrylonitrile-methyl Methacrylate Copolymer Films Containing Microencapsulated n-Octadecane
Institute of Scientific and Technical Information of China (English)
LI Jun; HAN Na; ZHANG Xing-xiang
2006-01-01
Acrylonitrile-methyl methacrylate copolymer was synthesized in aqueous solution by Redox. The copolymer was mixed with 10 - 40 wt% of microencapsulated n-octadecane (MicroPCMs) in water. Copolymer films containing MicroPCMs were cast at room temperature in N, N-Dimethylformamide solution. The copolymer of acrylonitrile-methyl methacrylate and the copolymer films containing MicroPCMs were characterized by using Fourier Transform Infrared Spectroscopy (FTIR), Differential Scanning Calorimetry (DSC), Thermogravimetric Analyzer (TG), X-ray Diffrac tion (XRD) and Scanning Electron Microscopy (SEM), etc.The microcapsules in the films are evenly distributed in the copolymer matrix. The heat-absorbing temperatures and heat-evolving temperatures of the films are almost the same as that of the MicroPCMs, respectively, and fluctuate in a slight range. In addition, the enthalpy efficiency of MicroPCMs rises with the contents of MicroPCMs increasing.The crystallinity of the film increases with the contents of MicroPCMs increasing.
International Nuclear Information System (INIS)
Wang, Niejun; Zhou, Lilin; Guo, Jun; Ye, Qiquan; Lin, Jin-Ming; Yuan, Jinying
2014-01-01
Graft through strategy was utilized to coat magnetic Fe 3 O 4 nanoparticles with poly(glycidyl methacrylate) using ordinary radical polymerization and then β-cyclodextrin was linked onto the surface of nanoparticles. With these nanoparticles modified with cyclodextrin groups, adsorption of two model environmental pollutants, bisphenol A and copper ions, was studied. Host–guest interactions between cyclodextrin and aromatic molecules had a great contribution to the adsorption of bisphenol A, while multiple hydroxyls of cyclodextrin also helped the adsorption of copper ions. These magnetic nanoparticles could be applied in the elimination, enrichment and detection of some environmental pollutants.
EM Modeling of Far-Field Radiation Patterns for Antennas on the GMA-TT UAV
Mackenzie, Anne I.
2015-01-01
To optimize communication with the Generic Modular Aircraft T-Tail (GMA-TT) unmanned aerial vehicle (UAV), electromagnetic (EM) simulations have been performed to predict the performance of two antenna types on the aircraft. Simulated far-field radiation patterns tell the amount of power radiated by the antennas and the aircraft together, taking into account blockage by the aircraft as well as radiation by conducting and dielectric portions of the aircraft. With a knowledge of the polarization and distance of the two communicating antennas, e.g. one on the UAV and one on the ground, and the transmitted signal strength, a calculation may be performed to find the strength of the signal travelling from one antenna to the other and to check that the transmitted signal meets the receiver system requirements for the designated range. In order to do this, the antenna frequency and polarization must be known for each antenna, in addition to its design and location. The permittivity, permeability, and geometry of the UAV components must also be known. The full-wave method of moments solution produces the appropriate dBi radiation pattern in which the received signal strength is calculated relative to that of an isotropic radiator.
21 CFR 177.1830 - Styrene-methyl methacrylate copolymers.
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Styrene-methyl methacrylate copolymers. 177.1830 Section 177.1830 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION (CONTINUED) INDIRECT FOOD ADDITIVES: POLYMERS Substances for Use as Basic Components of Single and Repeated Us...
GÜLTEK, Ahmet; SEÇKİN, Turgay
2002-01-01
Poly(methacrylic acid) and poly(acrylic acid) nanocomposites were prepared by in-situ polymerization of g-methacryloxypropyltrimethoxysilane (A174)/clay nanocomposites in which the macromonomer was generated by grafting A-174 onto activated clay samples via hydroxyl groups or via intercalation. In- situ polymerization was carried out in the presence of an initiator. It was found that the structural affinity between the methacrylic or acrylic acid monomers and the amount of clay playe...
KINETICS OF SUSPENDED EMULSION POLYMERIZATION OF METHYL METHACRYLATE
Institute of Scientific and Technical Information of China (English)
Yong-zhong Bao; Cheng-xi Wang; Zhi-ming Huang; Zhi-xue Weng
2004-01-01
The kinetics of suspended emulsion polymerization of methyl methacrylate (MMA), in which water acted as the dispersed phase and the mixture of MMA and cyclohexane as the continuous phase, was investigated. It showed that the initial polymerization rate (Rp0) and steady-state polymerization rate (Rp) were proportional to the mass ratio between water and oil phase, and increased as the polymerization temperature, the potassium persulphate concentration ([I]) and the Tween20 emulsifier concentration ([S]) increased. The relationships between the polymerization rate and [I] and [S] were obtained as follows: Rp0 ∝ [I]0.73[S]0.32 and Rp ∝ [I]0.71[S]0.23. The above exponents were close to those obtained from normal MMA emulsion polymerization. It also showed that the average molecular weight of the resulting poly(methyl methacrylate) decreased as the polymerization temperature, [I] and [S] increased. Thus, MMA suspended emulsion polymerization could be considered as a combination of many miniature emulsion polymerizations proceeding in water drops and obeyed the classical kinetics of MMA emulsion polymerization.
Preparation and Characterization of InP/Poly(methyl methacrylate) Nanocomposite Films.
Kwon, Younghoon; Kim, Jongsung
2017-04-01
Quantum dots (QDs) are nanocrystalline semiconductors with many unusual optical properties. They exhibit very high fluorescence intensities and possess exceptional stability against photo-bleaching. In this study, we report the preparation of InP QDs-poly(methyl methacrylate) (PMMA) hybrids by fabricating QDs via a thermal decomposition reaction, followed by radical polymerization. The InP QDs were synthesized using indium(III) chloride and tris(dimethylamino)phosphine. Flexible composite films were obtained by radical polymerization using methyl methacrylate (MMA) as the monomer and 2,2′-azobis(2-methylpropionitrile) (AIBN) as a radical initiator. The PL intensity of the QDs was lowered upon composite formation with PMMA. However, the composites exhibited higher thermal stability than pure PMMA.
International Nuclear Information System (INIS)
Byun, Hun-Soo; Choi, Min-Yong
2007-01-01
Experimental data of high pressure phase behaviour for binary mixtures of {carbon dioxide + 2-hydroxyethyl methacrylate (HEMA)}, {carbon dioxide + 2-hydroxypropyl acrylate (HPA)}, and {carbon dioxide + 2-hydroxypropyl methacrylate (HPMA)} were determined using a static type with the variable-volume cell at temperatures from (313.2 to 393.2) K and pressures up to 27.10 MPa. Among these binary experimental data, the bubble-point data were correlated with the Peng-Robinson equation of state using a van der Waals one-fluid mixing rule containing two interaction parameters (k ij and η ij ). The (carbon dioxide + HEMA), (carbon dioxide + HPA), and (carbon dioxide + HPMA) systems exhibit type-I phase behaviour. At constant pressure, the solubility of HEMA, HPA, and HPMA for the (Carbon dioxide + HEMA), (carbon dioxide + HPA), and (carbon dioxide + HPMA) systems increases as the temperature increases
Kinetics and mechanism of polymerization of methyl methacrylate ...
Indian Academy of Sciences (India)
Homopolymerization of methyl methacrylate (MMA) was carried out in the presence of triphenylstibonium 1,2,3,4-tetraphenyl-cyclopentadienylide as an initiator in dioxane at 65°C ± 0·1°C. The system follows non-ideal radical kinetics ( ∝ [M]1.4 [I]0.44) due to primary radical termination as well as degradative ...
Graft copolymerization of a series of alkyl acrylates and alkyl methacrylates onto polyethylene
International Nuclear Information System (INIS)
Zurakowska-Orszagh, J.; Soerjosoeharto, K.; Busz, W.; Oldziejewski, J.
1977-01-01
Graft copolymerization of a series of alkyl acrylates and alkyl methacrylates into polyethylene of Polish production was investigated, using benzoyl peroxide as the initiator as well as preirradiation technique, namely ionizing radiation from a 60 Co γ-source. The effect of α-carbon methyl substituent of methacrylates as well as the influence of the length of alkyl chains in the ester groups of both series of monomers into the grafting process was observed. The ungrafted and some of the grafted polyethylene film obtained was studied by infrared spectrophotometry. (author)
Exposure assessment of acrylates/methacrylates in radiation-cured applications
International Nuclear Information System (INIS)
1987-01-01
Occupational exposures to radiation-cured acrylates/methacrylates during their processing and use in coatings, inks, and adhesives were evaluated in 12 walk-through surveys at formulator and applicator sites. Inhalation and dermal-exposure routes were studied. According to the authors, the basic process used to formulate coatings, inks, and adhesives consists of blending raw materials in closed mixing vessels using local exhaust ventilation in the form of elephant trunks at vessel charging and packaging locations. Application methods surveyed included reverse-roll coaters, direct roll coaters, curtain/rain coaters, laminators, pneumatic injection, spray guns, and manual application. At the sites surveyed, the number of workers potentially exposed at each site ranged from two to 142. Process operators at applicator sites had the greatest potential for dermal exposure. Generally, the potential for inhalation exposure was low due to low volatility of the multifunctional acrylates/methacrylates used in the formulations. No reliable air-monitoring data were available at any site. Respirator use was limited and sporadic
Energy Technology Data Exchange (ETDEWEB)
Gerola, Adriana P.; Silva, Danielle C., E-mail: avalente@ci.uc.pt [Department of Chemistry, University of Coimbra, Coimbra (Portugal); Rubira, Adley F.; Muniz, Edvani C. [Universidade Estadual de Maringa (GMPC/UEM), PR (Brazil). Grupo de Materiais Polimericos e Compositos; Jesus, Sandra; Borges, Olga [Faculty of Pharmacy, University of Coimbra, Coimbra (Portugal)
2015-07-01
Modified gum Arabic (GA) hydrogels show a pH-responsive behavior making them excellent matrices to be used for oral administration of drugs. Our goal is to study the behavior of those matrices in simulated gastric and intestinal fluids. In this work we will present how the methacrylation degree of GA, by using glycidyl methacrylate, can affect the properties of these hydrogels for controlled release. The drug used in this work is the curcumin (Cur). Cur is associated with numerous pharmacological activities, but their application is limited by the low water solubility. We will present some studies involving the formation of host-guest complexes between Cur and natural cyclodextrins. Both modified GA and hydrogels were characterized by different techniques. The kinetics release of Cur complex-containing modified GA hydrogels was studied to have an insight on the release mechanism and rate constants. Toxicity studies on undifferentiated and differentiated Caco-2 were also carried out. (author)
International Nuclear Information System (INIS)
Gerola, Adriana P.; Silva, Danielle C.; Rubira, Adley F.; Muniz, Edvani C.
2015-01-01
Modified gum Arabic (GA) hydrogels show a pH-responsive behavior making them excellent matrices to be used for oral administration of drugs. Our goal is to study the behavior of those matrices in simulated gastric and intestinal fluids. In this work we will present how the methacrylation degree of GA, by using glycidyl methacrylate, can affect the properties of these hydrogels for controlled release. The drug used in this work is the curcumin (Cur). Cur is associated with numerous pharmacological activities, but their application is limited by the low water solubility. We will present some studies involving the formation of host-guest complexes between Cur and natural cyclodextrins. Both modified GA and hydrogels were characterized by different techniques. The kinetics release of Cur complex-containing modified GA hydrogels was studied to have an insight on the release mechanism and rate constants. Toxicity studies on undifferentiated and differentiated Caco-2 were also carried out. (author)
Reactive electrospinning and biodegradation of cross-linked methacrylated polycarbonate nanofibers
Energy Technology Data Exchange (ETDEWEB)
Wu Ruizhi; Zhang Jianfeng; Fan Yuwei; Xu Xiaoming [Department of Comprehensive Dentistry and Biomaterials, Louisiana State University Health Sciences Center, 1100 Florida Avenue, Box 137, New Orleans, LA 70119 (United States); Stoute, Diana; Lallier, Thomas, E-mail: xxu@lsuhsc.edu [Department of Cell Biology and Anatomy, Louisiana State University Health Science Center, 1100 Florida Avenue, Box 137, New Orleans, LA 70119 (United States)
2011-06-15
The objectives of this study were to fabricate cross-linked biodegradable polycarbonate nanofibers and to investigate their biodegradability by different enzymes. Poly(2,3-dihydroxycarbonate) was synthesized from naturally occurring l-tartaric acid. The hydroxyl groups on the functional polycarbonate were converted to methacrylate groups to enable the polymer to cross-link under UV irradiation. Smooth cross-linked methacrylated polycarbonate nanofibers (300-1800 nm) were fabricated by a reactive electrospinning process with in situ UV radiation from a mixed solution of linear methacrylated polycarbonate (MPC) and poly(ethylene oxide) (PEO) (MPC:PEO = 9:1) in methanol/chloroform (50/50). These cross-linked nanofibers have shown excellent solvent resistance and their solubility decreases with increasing degree of cross-linking. The thermal properties of linear and cross-linked polycarbonate nanofibers were investigated by differential scanning calorimetry and thermogravimetric analysis. The cross-linked polycarbonate nanofibers show no melting point below 200 {sup 0}C and their decomposition temperature increases with increasing cross-linking degree. Their biodegradation products by five different enzymes were analyzed using liquid chromatography-mass spectrometry (LC-MS). The biodegradability of the polycarbonate nanofibers decreases with increasing cross-linking degree. These nanofibers were found to support human fibroblast survival and to promote cell attachment. This study demonstrates that cross-linked biodegradable polycarbonate nanofibers with different chemical properties and biodegradability can be fabricated using the novel reactive electrospinning technology to meet the needs of different biomedical applications.
Czech Academy of Sciences Publication Activity Database
Horák, Daniel; Hlídková, Helena; Trachtová, Š.; Šlouf, Miroslav; Rittich, B.; Španová, A.
2015-01-01
Roč. 68, July (2015), s. 687-696 ISSN 0014-3057 R&D Projects: GA ČR GAP206/12/0381; GA MŠk(CZ) LH14318 Institutional support: RVO:61389013 Keywords : magnetic microspheres * poly(ethylene glycol) * real-time PCR Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.485, year: 2015
Ning, Shoucheng; Bednarski, Mark; Oronsky, Bryan; Scicinski, Jan; Knox, Susan J
2014-05-09
Selective release of nitric oxide (NO) in tumors could improve the tumor blood flow and drug delivery for chemotherapeutic agents and radiotherapy, thereby increasing the therapeutic index. Glycidyl nitrate (GLYN) is a NO generating small molecule, and has ability to release NO on bioactivation in SCC VII tumor cells. GLYN-induced intracellular NO generation was significantly attenuated by NO scavenger carboxy-PTIO (cPTIO) and NAC. GLYN significantly increases tumor blood flow, but has no effect on the blood flow of normal tissues in tumor-bearing mice. When used with cisplatin, GLYN significantly increased the tumor growth inhibition effect of cisplatin. GLYN also had a modest radiosensitizing effect in vitro and in vivo. GLYN was well tolerated and there were no acute toxicities found at its effective therapeutic doses in preclinical studies. These results suggest that GLYN is a promising new drug for use with chemotherapy and radiotherapy, and provide a compelling rationale for future studies of GLYN and related compounds. Copyright © 2014 Elsevier Inc. All rights reserved.
Design rules for carbazole derivatized n-alkyl methacrylate polymeric memristors
Czech Academy of Sciences Publication Activity Database
McFarlane, T. M.; Zdyrko, B.; Bandera, Y.; Worley, D.; Klep, O.; Jurča, M.; Tonkin, C.; Foulger, S. H.; Vilčáková, J.; Sáha, P.; Pfleger, Jiří
2018-01-01
Roč. 6, č. 10 (2018), s. 2533-2545 ISSN 2050-7526 Institutional support: RVO:61389013 Keywords : n-alkyl methacrylate polymers * charge transport * composites Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 5.256, year: 2016
Wang, Hongwei; Ou, Junjie; Lin, Hui; Liu, Zhongshan; Huang, Guang; Dong, Jing; Zou, Hanfa
2014-11-07
Two kinds of hybrid monolithic columns were prepared by using methacrylate epoxy cyclosiloxane (epoxy-MA) as functional monomer, containing three epoxy moieties and one methacrylate group. One column was in situ fabricated by ring-opening polymerization of epoxy-MA and 1,10-diaminodecane (DAD) using a porogenic system consisting of isopropanol (IPA), H2O and ethanol at 65°C for 12h. The other was prepared by free radical polymerization of epoxy-MA and ethylene dimethacrylate (EDMA) using 1-propanol and 1,4-butanediol as the porogenic solvents at 60°C for 12h. Two hybrid monoliths were investigated on the morphology and chromatographic assessment. Although two kinds of monolithic columns were prepared with epoxy-MA, their morphologies looked rather different. It could be found that the epoxy-MA-DAD monolith possessed higher column efficiencies (25,000-34,000plates/m) for the separation of alkylbenzenes than the epoxy-MA-EDMA monolith (12,000-13,000plates/m) in reversed-phase nano-liquid chromatography (nano-LC). Depending on the remaining epoxy or methacrylate groups on the surface of two pristine monoliths, the epoxy-MA-EDMA monolith could be easily modified with 1-octadecylamine (ODA) via ring-opening reaction, while the epoxy-MA-DAD monolith could be modified with stearyl methacrylate (SMA) via free radical reaction. The chromatographic performance for the separation of alkylbenzenes on SMA-modified epoxy-MA-DAD monolith was remarkably improved (42,000-54,000 plates/m) when compared with that on pristine epoxy-MA-DAD monolith, while it was not obviously enhanced on ODA-modified epoxy-MA-EDMA monolith when compared with that on pristine epoxy-MA-EDMA monolith. The enhancement of the column efficiency of epoxy-MA-DAD monolith after modification might be ascribed to the decreased mass-transfer resistence. The two kinds of hybrid monoliths were also applied for separations of six phenols and seven basic compounds in nano-LC. Copyright © 2014 Elsevier B.V. All
Jayabalan, M; Thomas, V; Rajesh, P N
2001-10-01
Polypropylene fumarate/phloroglucinol triglycidyl methacrylate oligomeric blend-based bone cement was studied. Higher the percentage of phloroglucinol triglycidyl methacrylate, lesser the setting time. An optimum setting time could be arrived with 50:50 blend composition of the two oligomers. Composite cement of 50:50 blend prepared with hydroxyapatite granules of particle size 125 microm binds bovine rib bones. The tensile strength of this adhesive bond was found to be 1.11 kPa. The thermal studies suggest the onset of cross-linking reaction in the cured blend if the blend is heated. The absence of softening endotherm in the cured blend shows the thermosetting-like amorphous nature of blend system, which may restrict the changes in creep properties. The in vitro biodegradation studies reveal possible association of calcium ions with negatively charged units of degrading polymer chain resulting in slow down of degradation. Relatively slow degradation was observed in Ringer's solution. The study reveals the potential use of polypropylene fumarate/phloroglucinol triglycidyl methacrylate as partially degradable polymeric cement for orthopaedic applications.
Tensile properties of polymethyl methacrylate coated natural fabric Sterculia urens
CSIR Research Space (South Africa)
Jayaramudu, J
2009-04-01
Full Text Available stress, Young's modulus and % elongation at break were determined using a Universal Testing Machine. The effect of alkali treatment and the polymethyl methacrylate coating on tensile properties of the fabric was studied. The morphology of the fabric...
Directory of Open Access Journals (Sweden)
S. Iskandar
2011-04-01
Full Text Available To obtain the degradable plastic, the graft copolymerization of methyl methacrylate onto starch and natural rubber latex was conducted by a simultaneous irradiation technique. Gamma-ray from cobalt-60 source was used as the initiator. The grafted copolymer of starch-polymethyl methacrylate and the grafted copolymer of natural rubber-polymethyl methacrylate were mixed in the blender, and dried it in the oven. The dried grafted copolymer mixture was then molded using hydraulic press machine. The effect of irradiation dose, composition of the grafted copolymer mixture, film forming condition and recycle effect was evaluated. The parameters observed were tensile strength, gel fraction and soil burial degradability of grafted copolymer mixture. It was found that the tensile strength of grafted copolymer mixture increased by -ray irradiation. Increasing of the grafted copolymer of natural rubber-polymethyl methacrylate content, the gel fraction and tensile strength of the grafted copolymer mixture increased. The tensile strength of the grafted copolymer mixture was increased from 18 MPa to 23 MPa after recycled (film forming reprocessed 3 times. The grafted copolymer mixture was degraded completely after soil buried for 6 months
Safranski, David L.; Crabtree, Jacob C.; Huq, Yameen R.; Gall, Ken
2011-01-01
Poly(β-amino ester) networks are being explored for biomedical applications, but they may lack the mechanical properties necessary for long term implantation. The objective of this study is to evaluate the effect of adding methyl methacrylate on networks' mechanical properties under simulated physiological conditions. The networks were synthesized in two parts: (1) a biodegradable crosslinker was formed from a diacrylate and amine, (2) and then varying concentrations of methyl methacrylate were added prior to photopolymerizing the network. Degradation rate, mechanical properties, and glass transition temperature were studied as a function of methyl methacrylate composition. The crosslinking density played a limited role on mechanical properties for these networks, but increasing methyl methacrylate concentration improved the toughness by several orders of magnitude. Under simulated physiological conditions, networks showed increasing toughness or sustained toughness as degradation occurred. This work establishes a method of creating degradable networks with tailorable toughness while undergoing partial degradation. PMID:21966028
An effective approach to synthesis of poly(methyl methacrylate)/silica nanocomposites
International Nuclear Information System (INIS)
Ding Xuefeng; Wang Zichen; Han Dongxue; Zhang Yuanjian; Shen Yanfei; Wang Zhijuan; Niu Li
2006-01-01
A novel synthetic route for nearly monodispersed poly(methyl methacrylate)/SiO 2 composite particles (PMSCP) is reported. Silica nanoparticles modified with oleic acid were used as 'seeds'. Methyl methacrylate (MMA) monomer was copolymerized with oleic acid via in situ emulsion polymerization, in the presence of an initiator; it resulted finally in the formation of composites with core-shell morphology. The composite particles were examined by transmission electron microscopy (TEM), scanning electron microscopy (SEM), x-ray photoelectron spectroscopy (XPS) and thermogravimetric analysis (TGA). The number of silica particles inside the composite particles increases with an increase in the silica concentration. The effect of grafted silica concentration on the morphology of PMSCP is also reported in detail. It was found by thermogravimetric analysis that PMSCP show a potential application for fire retardance
Energy Technology Data Exchange (ETDEWEB)
Murthy, S.S.; Nelson, W.L. (Washington Univ., Seattle, WA (USA). Dept. of Medicinal Chemistry)
1990-12-01
Enantiomers of metoprolol containing six deuterium atoms in the isopropyl methyl groups were prepared in two steps from the sodium salt of 4-(2-methoxyethyl)phenol (3) and the commercially available (2R)-and (2S)-glycidyl 3-nitrobenzenesulfonates ((2R)-2 and (2S)-2). The resulting (2R)- and (2S)-epoxides were opened using ({sup 2}H{sub 6})-isopropylamine. The enantiomeric excesses were 93 and 95% for the deuterated (2R)- and (2S)-enantiomers of metoprolol ((2R)-1 and (2S)-1), respectively, as determined by chiral column HPLC. (author).
Phase holograms in polymethyl methacrylate
Maker, P. D.; Muller, R. E.
1992-01-01
A procedure is described for the fabrication of complex computer-generated phase holograms in polymethyl methacrylate (PMMA) by means of partial-exposure e-beam lithography and subsequent carefully controlled partial development. Following the development, the pattern appears (rendered in relief) in the PMMA, which then acts as the phase-delay medium. The devices fabricated were designed with 16 equal phase steps per retardation cycle, were up to 3 mm square, and consisted of up to 10 millions of 0.3-2.0-micron square pixels. Data files were up to 60 Mb-long, and the exposure times ranged to several hours. A Fresnel phase lens was fabricated with a diffraction-limited optical performance of 83-percent efficiency.
Energy Technology Data Exchange (ETDEWEB)
Cengiz, Ugur, E-mail: ucengiz@gyte.edu.tr [Department of Chemical Engineering, Gebze Institute of Technology, Cayirova, 41400 Kocaeli (Turkey); Avci, Merih Z. [Polymer Science and Technology, Deparment of Chemistry, Istanbul Technical University, Maslak 34469, Istanbul (Turkey); Erbil, H. Yildirim [Department of Chemical Engineering, Gebze Institute of Technology, Cayirova, 41400 Kocaeli (Turkey); Sarac, A. Sezai [Polymer Science and Technology, Deparment of Chemistry, Istanbul Technical University, Maslak 34469, Istanbul (Turkey)
2012-05-15
A new statistical terpolymer containing perfluoroethyl alkyl methacrylate (Zonyl-TM), methyl methacrylate and butyl acrylate, poly(Zonyl-TM-ran-MMA-ran-BA) was synthesized in supercritical carbon dioxide at 200 bar and 80 Degree-Sign C using AIBN as an initiator by heterogeneous free radical copolymerization. Nanofibers of this terpolymer were produced by electrospinning from its DMF solution. The structural and thermal properties of terpolymers and electrospun poly(Zonyl-TM-MMA-BA) nanofibers were analyzed using Fourier transform infrared spectroscopy, nuclear magnetic resonance spectroscopy and differential scanning calorimetry. Nanofiber morphology was investigated by scanning electron microscopy. Electrospun nanofiber layer was found to be superhydrophobic with a water contact angle of 172 {+-} 1 Degree-Sign and highly oleophobic with hexadecane, glycerol and ethylene glycol contact angles of 70 {+-} 1 Degree-Sign , 167 {+-} 1 Degree-Sign and 163 {+-} 1 Degree-Sign respectively. The change of the contact angle results on the electrospun fiber layer and flat terpolymer surfaces by varying feed monomer composition were compared and discussed in the text.
International Nuclear Information System (INIS)
Fukano, K.; Kageyama, E.
1976-01-01
Aerosol is silica having a purity which is very high compared with that of silica gel and having, unlike silica gel, no micropores. To investigate the effects of impurities and micropores on the radiation-induced polymerization of styrene and methyl methacrylate adsorbed on silica gel, the radiation-induced polymerization of styrene and methyl methacrylate adsorbed on Aerosil was carried out. The results of both the styrene--Aerosil 300 system and the methyl methacrylate--Aerosil 300 system were similar to those of the styrene-silica gel and methyl methacrylate-silica gel systems, respectively. This suggests that in the radiation-induced polymerization of both styrene--silica gel and methyl methacrylate--silica gel systems the impurities and the presence of micropores have almost no effect on the reaction mechanism. The effect of aluminum as an impurity was investigated on the styrene--Aerosil MOX 170 system. It was found that aluminum accelerated the cationic polymerization
Radiation initiated polymerisation of phenyl methacrylate
International Nuclear Information System (INIS)
Raghunath, S.; Rao, M.H.; Rao, K.N.
1983-01-01
Radiation initiated polymerisation of phenyl methacrylate has been studied at various dose rates and temperature. Predominant chain transfer to the monomer was observed and ksub(tran)/Ksub(p) the chain transfer constant ratio was found to be 4 x 10 -2 .ksub(p)/ksub(tsup(1/2)) value determined by the kinetic data and the molecular weight data were 0.0821 and 0.0198, respectively. IR studies of polymer at low conversion showed the presence of terminal unsaturation which disappeared at saturation conversion, thus showing its participation in the formation of a three dimensional network. (author)
Figueiredo, Ana R P; Figueiredo, Andrea G P R; Silva, Nuno H C S; Barros-Timmons, Ana; Almeida, Adelaide; Silvestre, Armando J D; Freire, Carmen S R
2015-06-05
Antimicrobial bacterial cellulose/poly(2-aminoethyl methacrylate) (BC/PAEM) nanocomposites were prepared by in situ radical polymerization of 2-aminoethyl methacrylate, using variable amounts of N,N-methylenebis(acrylamide) (MBA) as cross-linker. The obtained nanocomposites were characterized in terms of their structure, morphology, thermal stability, mechanical properties and antibacterial activity. The ensuing composite membranes were significantly more transparent than those of pure BC and showed improved thermal and mechanical properties. The antibacterial activity of the obtained nanocomposites was assessed towards a recombinant bioluminescent Escherichia coli and only the non-crosslinked nanocomposite (BC/PAEM) proved to have antibacterial activity. Copyright © 2015 Elsevier Ltd. All rights reserved.
Styrene-butadiene rubber/halloysite nanotubes nanocomposites modified by methacrylic acid
International Nuclear Information System (INIS)
Guo Baochun; Lei Yanda; Chen Feng; Liu Xiaoliang; Du Mingliang; Jia Demin
2008-01-01
Methacrylic acid (MAA) was used to improve the performance of styrene-butadiene rubber (SBR)/halloysite nanotubes (HNTs) nanocomposites by direct blending. The detailed interaction mechanisms of MAA and the in situ formed zinc methacrylate (ZDMA) were revealed by X-ray diffraction (XRD), surface area and porosity analysis, X-ray photoelectron spectroscopy (XPS) together with crosslink density determination. The strong interfacial bonding between HNTs and rubber matrix is resulted through ZDMA and MAA intermediated linkages. ZDMA connects SBR and HNTs via grafting/complexation mechanism. MAA bonds SBR and HNTs through grafting/hydrogen bonding mechanism. Significantly improved dispersion of HNTs in virtue of the interactions between HNTs and MAA or ZDMA was achieved. Effects of MAA content on the vulcanization behavior, morphology and mechanical properties of the nanocomposites were investigated. Promising mechanical properties of MAA modified SBR/HNTs nanocomposites were obtained. The changes in vulcanization behavior, mechanical properties and morphology were correlated with the interactions between HNTs and MAA or ZDMA and the largely improved dispersion of HNTs
Styrene-butadiene rubber/halloysite nanotubes nanocomposites modified by methacrylic acid
Energy Technology Data Exchange (ETDEWEB)
Guo Baochun [Department of Polymer Materials and Engineering, South China University of Technology, Guangzhou 510640 (China)], E-mail: psbcguo@scut.edu.cn; Lei Yanda; Chen Feng; Liu Xiaoliang; Du Mingliang; Jia Demin [Department of Polymer Materials and Engineering, South China University of Technology, Guangzhou 510640 (China)
2008-12-30
Methacrylic acid (MAA) was used to improve the performance of styrene-butadiene rubber (SBR)/halloysite nanotubes (HNTs) nanocomposites by direct blending. The detailed interaction mechanisms of MAA and the in situ formed zinc methacrylate (ZDMA) were revealed by X-ray diffraction (XRD), surface area and porosity analysis, X-ray photoelectron spectroscopy (XPS) together with crosslink density determination. The strong interfacial bonding between HNTs and rubber matrix is resulted through ZDMA and MAA intermediated linkages. ZDMA connects SBR and HNTs via grafting/complexation mechanism. MAA bonds SBR and HNTs through grafting/hydrogen bonding mechanism. Significantly improved dispersion of HNTs in virtue of the interactions between HNTs and MAA or ZDMA was achieved. Effects of MAA content on the vulcanization behavior, morphology and mechanical properties of the nanocomposites were investigated. Promising mechanical properties of MAA modified SBR/HNTs nanocomposites were obtained. The changes in vulcanization behavior, mechanical properties and morphology were correlated with the interactions between HNTs and MAA or ZDMA and the largely improved dispersion of HNTs.
Neural Network Models for Free Radical Polymerization of Methyl Methacrylate
International Nuclear Information System (INIS)
Curteanu, S.; Leon, F.; Galea, D.
2003-01-01
In this paper, a neural network modeling of the batch bulk methyl methacrylate polymerization is performed. To obtain conversion, number and weight average molecular weights, three neural networks were built. Each was a multilayer perception with one or two hidden layers. The choice of network topology, i.e. the number of hidden layers and the number of neurons in these layers, was based on achieving a compromise between precision and complexity. Thus, it was intended to have an error as small as possible at the end of back-propagation training phases, while using a network with reduced complexity. The performances of the networks were evaluated by comparing network predictions with training data, validation data (which were not uses for training), and with the results of a mechanistic model. The accurate predictions of neural networks for monomer conversion, number average molecular weight and weight average molecular weight proves that this modeling methodology gives a good representation and generalization of the batch bulk methyl methacrylate polymerization. (author)
Institute of Scientific and Technical Information of China (English)
TANG Zhaoqi; LI Wei; LIU Lanqin; HUANG Lei; ZHOU Jin; YU Haiyin
2009-01-01
Controlled grafting of well-defined polymer brushes of methyl methacrylate (MMA) on the poly(vinylidene fluoride) (PVDF) powders was carded out by the surface-initiated atom transfer radical polymerization (ATRP). The ATRP initiator was anchored on the PVDF surface by alkaline treatment, followed by UV-induced bromination; then methyl methacrylate (MMA) was grafted onto the brominated PVDF by the ATRP technique. The chemical composition changes of PVDF were characterized by Fourier transform-infrared spectroscopy (FT-IR) and X-ray photoelectron spectroscopy (XPS). FT-IR and XPS results clearly indicated the successful graft of poly(methyl methacrylate) onto the PVDF surface.
Surface modification of hydroxyapatite with poly(methyl methacrylate) via surface-initiated ATRP
Energy Technology Data Exchange (ETDEWEB)
Wang Yan; Zhang Xi; Yan Jinliang; Xiao Yan [Shanghai Key Laboratory of Advanced Polymeric Materials, Key Laboratory for Ultrafine Materials of Ministry of Education, School of Materials Science and Engineering, East China University of Science and Technology, 130 Meilong Road, Shanghai 200237 (China); Lang Meidong, E-mail: mdlang@ecust.edu.cn [Shanghai Key Laboratory of Advanced Polymeric Materials, Key Laboratory for Ultrafine Materials of Ministry of Education, School of Materials Science and Engineering, East China University of Science and Technology, 130 Meilong Road, Shanghai 200237 (China)
2011-05-01
This article describes the fabrication of hydroxyapatite (HAP) nanocomposites grafted with poly(methyl methacrylate) (PMMA). Surface-initiated atom transfer radical polymerization (ATRP) of methyl methacrylate (MMA) was carried out from hydroxyapatite particles derivatized with ATRP initiators. The structure and properties of the nanocomposites were investigated by thermogravimetric analysis (TGA), transmission electron microscopy (TEM), differential scanning calorimeter (DSC) measurements, and contact angle analyses. TGA was used to estimate the grafting density of ATRP initiators (0.49 initiator/nm{sup 2}) and the amount of grafted PMMA on the HAP surface. The contact angle analyses indicated that grafting PMMA onto the HAP surface dramatically increased the hydrophobicity of the surface. Moreover, the HAP nanocomposites showed excellent dispersibility in both aqueous solution and organic solvent.
Surface modification of hydroxyapatite with poly(methyl methacrylate) via surface-initiated ATRP
International Nuclear Information System (INIS)
Wang Yan; Zhang Xi; Yan Jinliang; Xiao Yan; Lang Meidong
2011-01-01
This article describes the fabrication of hydroxyapatite (HAP) nanocomposites grafted with poly(methyl methacrylate) (PMMA). Surface-initiated atom transfer radical polymerization (ATRP) of methyl methacrylate (MMA) was carried out from hydroxyapatite particles derivatized with ATRP initiators. The structure and properties of the nanocomposites were investigated by thermogravimetric analysis (TGA), transmission electron microscopy (TEM), differential scanning calorimeter (DSC) measurements, and contact angle analyses. TGA was used to estimate the grafting density of ATRP initiators (0.49 initiator/nm 2 ) and the amount of grafted PMMA on the HAP surface. The contact angle analyses indicated that grafting PMMA onto the HAP surface dramatically increased the hydrophobicity of the surface. Moreover, the HAP nanocomposites showed excellent dispersibility in both aqueous solution and organic solvent.
Directory of Open Access Journals (Sweden)
Atiqa Bekhta
2016-10-01
Full Text Available The aim of our work is to synthesize a new phosphorus tri-functional epoxy resin tri-glycidyl ether tri-mercaptoethanol of phosphorus (TGETMEP in two stages. In the first stage, we got the precursor molecule of the epoxy matrix tri-mercaptoethanol phosphate (METR. The second step led us to the synthesis of tri-functional resin TMEP condensation with epichlorohydrin. The standard TGETMEP resin was characterized by the Fourier infrared transformation (FTIR and nuclear magnetic resonance (NMR, on one hand. The viscosimetric analysis was investigated by the Hebbelod capillary viscometer and rheometer Rheomat 01, on the other hand. The cross-linked resins and tertiary formulated composites have been studied by the rheometer 01 which was observed by means of SEM.
Simula, Alexandre; Anastasaki, Athina; Haddleton, David M
2016-02-01
The synthesis of hydrophilic, thermoresponsive, and zwitterionic polymethacrylates is reported by Cu(0)-mediated reversible deactivation radical polymerization in water and/or water/alcohol mixtures. The predisproportionation of [Cu(I) (PMDETA)Cl] in water prior to initiator and monomer addition is exploited to yield well-defined polymethacrylates with full monomer conversions in 30 min. The addition of supplementary halide salts (NaCl) enables the synthesis of various molecular weight poly[poly(ethylene glycol) methyl ether methacrylate] (PEGMA475) (DPn = 10-80, Mn ≈ 10,000-40 000 g mol(-1)) with full monomer conversion and narrow molecular weight distributions attained in all cases (Đ ≈ 1.20-1.30). A bifunctional PEG initiator (average Mn ≈ 1000 g mol(-1)) is utilized for the polymerization of a wide range of methacrylates including 2-dimethylaminoethyl methacrylate, 2-morpholinoethyl methacrylate, [2-(methacryloyloxy)ethyl]dimethyl-(3-sulfopropyl)ammonium hydroxide, and 2-methacryloyloxyethyl phosphorylcholine. Despite the high water content, high end group fidelity is demonstrated by in situ chain extensions and block copolymerizations with PEGMA475 yielding well-defined functional telechelic pentablock copolymers within 2.5 h. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
International Nuclear Information System (INIS)
Grishchuk, B.D.; Baranovskij, V.S.; Simchak, R.V.; Tulajdan, G.N.; Gorbovoj, P.M.
2006-01-01
Reaction of aryl diazonium tetrafluoro borates (I) with allyl ester of methacrylic acid in the water-acetone (1:5) medium is studied by means of IR spectroscopy and 1 H NMR. It is established that (I) reacts with aryl methacrylate in the presence of rhodanide-anion and catalytic quantities of copper salts with the formation of allyl esters of 2-thiocyanato-2-methyl-3-aryl propionic acids with the yield of 32-56%. Allyl fragment of biunsaturated compound shows no reaction under the tested conditions [ru
Polymerization of Methyl Methacrylate with Samarocene Complex Supported on Mesoporous Silica
Institute of Scientific and Technical Information of China (English)
无
2001-01-01
Samarocene complex was supported on a series of mesoporous silica with various pore sizes. Polymerization of methyl methacrylate (MMA) by these catalysts provide highly syndiotactic PMMAs with higher molecular weights compared with those obtained by solution polymerization with homogeneous catalyst system.
21 CFR 177.1030 - Acrylonitrile/butadiene/styrene/methyl methacrylate copolymer.
2010-04-01
... methacrylate copolymer identified in this section may be safely used as an article or component of articles... monomer content of the finished copolymer articles is not more than 11 parts per million as determined by... available from the Center for Food Safety and Applied Nutrition (HFS-200), Food and Drug Administration...
Mössbauer studies of iron doped poly(methyl methacrylate) before ...
Indian Academy of Sciences (India)
Unknown
Mössbauer studies of iron doped poly(methyl methacrylate) before and after ion beam modification. D R S SOMAYAJULU, C N MURTHY†, D K AWASTHI‡, N V PATEL and M SARKAR. Physics Department, Faculty of Science, MS University of Baroda, Vadodara 390 002, India. †Applied Chemistry Department, Faculty ...
Ye, Qiang; Park, Jonggu; Parthasarathy, Ranganathan; Pamatmat, Francis; Misra, Anil; Laurence, Jennifer S.; Marangos, Orestes; Spencer, Paulette
2013-01-01
There have been reports of the sensitivity of our current dentin adhesives to excess moisture, for example, water-blisters in adhesives placed on over-wet surfaces, and phase separation with concomitant limited infiltration of the critical dimethacrylate component into the demineralized dentin matrix. To determine quantitatively the hydrophobic/hydrophilic components in the aqueous phase when exposed to over-wet environments, model adhesives were mixed with 16, 33, and 50 wt % water to yield well-separated phases. Based upon high-performance liquid chromatography coupled with photodiode array detection, it was found that the amounts of hydrophobic BisGMA and hydrophobic initiators are less than 0.1 wt % in the aqueous phase. The amount of these compounds decreased with an increase in the initial water content. The major components of the aqueous phase were hydroxyethyl methacrylate (HEMA) and water, and the HEMA content ranged from 18.3 to 14.7 wt %. Different BisGMA homologues and the relative content of these homologues in the aqueous phase have been identified; however, the amount of crosslinkable BisGMA was minimal and, thus, could not help in the formation of a crosslinked polymer network in the aqueous phase. Without the protection afforded by a strong crosslinked network, the poorly photoreactive compounds of this aqueous phase could be leached easily. These results suggest that adhesive formulations should be designed to include hydrophilic multimethacrylate monomers and water compatible initiators. PMID:22331596
Energy Technology Data Exchange (ETDEWEB)
Wen, Shipeng; Zhou, Yao; Yao, Lu [State Key Laboratory of Chemical Resource Engineering, Beijing University of Chemical Technology, Beijing 100029 (China); Zhang, Liqun [State Key Laboratory of Organic-Inorganic Composites, Beijing University of Chemical Technology, Beijing 100029 (China); Chan, Tung W. [Department of Materials Science and Engineering, Virginia Polytechnic Institute and State University, VA 24061 (United States); Liang, Yongri [Beijing National Laboratory for Molecular Sciences, Joint Laboratory of Polymer Science and Materials, Institute of Chemistry, Chinese Academy of Sciences, Beijing 100190 (China); Liu, Li, E-mail: LiuL@mail.buct.edu.cn [State Key Laboratory of Chemical Resource Engineering, Beijing University of Chemical Technology, Beijing 100029 (China)
2013-11-10
Highlights: • In situ self-polymerization of unsaturated metal methacrylate was investigated mainly by the thermal effect. • UMM with low melting point can self-polymerize to a large extent. • The fine dispersion phase is composed of poly(UMM) nanoparticles formed by in situ self-polymerization in the rubber matrix. • The UMM crystals in the presence of peroxide and rubber undergo the processes of melting, diffusion, polymerization, and phase separation in this order. - Abstract: Unsaturated metal methacrylate (UMM) as one kind of functional filler has played an important role in reinforcing rubber materials. The in situ self-polymerization of UMM in UMM/rubber composite leads to the uniform dispersion of poly(UMM) in the rubber matrix, while the crosslinking of rubber and grafting between UMM and rubber chains occur simultaneously, making it difficult to clarify the effect of the in situ polymerization on the dispersion of poly(UMM) in the rubber matrix. In this work, we investigated the dispersion mechanism of UMM without rubber matrix for the first time using differential scanning calorimetry (DSC) and Fourier transform infrared (FTIR) spectroscopy. Three types of UMMs including zinc methacrylate (Zn(MA){sub 2}), sodium methacrylate (Na(MA)) and samarium methacrylate (Sm(MA){sub 3}) were chosen to investigate the in situ self-polymerization of UMM. Based on DSC results, we conclude that the crystals with low melting point tend to self-polymerize first and generate a large amount of heat in the presence of peroxide. The high heat of reaction can melt the crystals with high melting point, and more UMM molecules are dissolved in the rubber matrix, thus increasing the extent of the in situ polymerization. Hence, the UMM with low melting point can self-polymerize to a large extent. Our findings provide in-depth understanding of the dispersion mechanism of UMM in rubber.
International Nuclear Information System (INIS)
Wen, Shipeng; Zhou, Yao; Yao, Lu; Zhang, Liqun; Chan, Tung W.; Liang, Yongri; Liu, Li
2013-01-01
Highlights: • In situ self-polymerization of unsaturated metal methacrylate was investigated mainly by the thermal effect. • UMM with low melting point can self-polymerize to a large extent. • The fine dispersion phase is composed of poly(UMM) nanoparticles formed by in situ self-polymerization in the rubber matrix. • The UMM crystals in the presence of peroxide and rubber undergo the processes of melting, diffusion, polymerization, and phase separation in this order. - Abstract: Unsaturated metal methacrylate (UMM) as one kind of functional filler has played an important role in reinforcing rubber materials. The in situ self-polymerization of UMM in UMM/rubber composite leads to the uniform dispersion of poly(UMM) in the rubber matrix, while the crosslinking of rubber and grafting between UMM and rubber chains occur simultaneously, making it difficult to clarify the effect of the in situ polymerization on the dispersion of poly(UMM) in the rubber matrix. In this work, we investigated the dispersion mechanism of UMM without rubber matrix for the first time using differential scanning calorimetry (DSC) and Fourier transform infrared (FTIR) spectroscopy. Three types of UMMs including zinc methacrylate (Zn(MA) 2 ), sodium methacrylate (Na(MA)) and samarium methacrylate (Sm(MA) 3 ) were chosen to investigate the in situ self-polymerization of UMM. Based on DSC results, we conclude that the crystals with low melting point tend to self-polymerize first and generate a large amount of heat in the presence of peroxide. The high heat of reaction can melt the crystals with high melting point, and more UMM molecules are dissolved in the rubber matrix, thus increasing the extent of the in situ polymerization. Hence, the UMM with low melting point can self-polymerize to a large extent. Our findings provide in-depth understanding of the dispersion mechanism of UMM in rubber
In situ stabilizer formation from methacrylic acid macromonomers in emulsion polymerization
Schreur-Piet, Ingeborg; Heuts, Johan P.A.
2017-01-01
Oligomers of methacrylic acid containing a propenyl ω-endgroup (i.e. MAA-macromonomers) were synthesized by cobalt-mediated catalytic chain transfer polymerization and used as precursors to stabilizers in emulsion polymerization. It was found that only in those polymerizations in which these
Radiation copolymerization of tributyltin methacrylate and methylmathacrylate
International Nuclear Information System (INIS)
Zhao Binxi; Zhu Xiaohong; Murat; Han Zhewen
1987-01-01
The copolymer of tributytin methacrylate and methylmethacrylate is a useful self-polishing antifouling paints materials. It was synthesized by radiation polymerization using 60 Co γ ray at room temperature. The copolymerization kinetics of the pair of monomers was studied. The relationship between the reaction rate and the dose rate was found to be R p = K p ·I -053 and the reactivity ratios were measured to be less than 1. The overall activition energy was 1.29 x 10 4 J/mol. It was supposed that the copolymerization was of radical machanism
A high-throughput readout architecture based on PCI-Express Gen3 and DirectGMA technology
International Nuclear Information System (INIS)
Rota, L.; Vogelgesang, M.; Perez, L.E. Ardila; Caselle, M.; Chilingaryan, S.; Dritschler, T.; Zilio, N.; Kopmann, A.; Balzer, M.; Weber, M.
2016-01-01
Modern physics experiments produce multi-GB/s data rates. Fast data links and high performance computing stages are required for continuous data acquisition and processing. Because of their intrinsic parallelism and computational power, GPUs emerged as an ideal solution to process this data in high performance computing applications. In this paper we present a high-throughput platform based on direct FPGA-GPU communication. The architecture consists of a Direct Memory Access (DMA) engine compatible with the Xilinx PCI-Express core, a Linux driver for register access, and high- level software to manage direct memory transfers using AMD's DirectGMA technology. Measurements with a Gen3 x8 link show a throughput of 6.4 GB/s for transfers to GPU memory and 6.6 GB/s to system memory. We also assess the possibility of using the architecture in low latency systems: preliminary measurements show a round-trip latency as low as 1 μs for data transfers to system memory, while the additional latency introduced by OpenCL scheduling is the current limitation for GPU based systems. Our implementation is suitable for real-time DAQ system applications ranging from photon science and medical imaging to High Energy Physics (HEP) systems
International Nuclear Information System (INIS)
Yoshida, Masaru; Kumakura, Minoru; Kaetsu, Isao
1979-01-01
Porous flat circular capsules including KCl as a drug were prepared by radiation-induced polymerization of methyl methacrylate at room temperature in the presence of polyethylene glycol No. 600. The porous structure can be controlled by the methyl methacrylate-polyethylene glycol No. 600 composition. The amount of drug released was linearly related to the square root of time. The magnitude of drug release increased roughly in proportional to the water content of capsule, which can be related to porosity in the capsule. (author)
Preparation of Methacrylate End-functionalized Poly(2-ethyl-2-oxazoline) Macromonomers
Weber, C.; Becer, C.R.; Baumgaertel, A.; Hoogenboom, R.; Schubert, U.S.
2009-01-01
Three methods for the functionalization of 2-ethyl-2-oxazoline (EtOx) oligomers with a methacrylate or methacrylamide unit are compared to identify the best suitable route to obtain such macromolecules. In the first method, a functional initiator, namely methacryloyl chloride, was used for the
International Nuclear Information System (INIS)
Wang Yuan; Zhang Dengsong; Shi Liyi; Li Li; Zhang Jianping
2008-01-01
Novel ternary nanocomposite trialkoxysilane-capped poly(methyl methacrylate)/zirconia/titania optical films were successfully prepared through a nonaqueous in situ sol-gel method. The acrylic monomers used were methyl methacrylate (MMA) and 3-(trimethoxysilyl)propyl methacrylate (MSMA). PMMA/ZrO 2 -TiO 2 incorporating networks formed from alcoholysis of poly(MMA-co-MSMA), zirconium n-butoxide and titanium isoproproxide. The structure, morphology and property of the obtained nanocomposite films were investigated by X-ray photoelectron spectra, Fourier transform infrared spectroscopy, field emission scanning electron microscopy, scanning probe microscopy, thermogravimetric analyses, UV-vis spectrum and spectro-ellipsometer. The nanoparticle size, roughness, thermal stability, UV-shielding property, and refractive index of nanocomposite films increase with the increasing of inorganic contents. The formation mechanism and reason of such improvements were examined and interpreted in a theoretical model. The nanocomposite films possess interesting properties in thermal stability and optical response due to the uniform incorporating networks between organic polymer chains and inorganic clusters
Energy Technology Data Exchange (ETDEWEB)
Wang Yuan [Research Center of Nano Science and Technology, Department of Chemistry, Shanghai University, Shanghai 200444 (China); Zhang Dengsong [Research Center of Nano Science and Technology, Department of Chemistry, Shanghai University, Shanghai 200444 (China)], E-mail: dszhang@shu.edu.cn; Shi Liyi [Research Center of Nano Science and Technology, Department of Chemistry, Shanghai University, Shanghai 200444 (China)], E-mail: sly0726@163.com; Li Li; Zhang Jianping [Research Center of Nano Science and Technology, Department of Chemistry, Shanghai University, Shanghai 200444 (China)
2008-08-15
Novel ternary nanocomposite trialkoxysilane-capped poly(methyl methacrylate)/zirconia/titania optical films were successfully prepared through a nonaqueous in situ sol-gel method. The acrylic monomers used were methyl methacrylate (MMA) and 3-(trimethoxysilyl)propyl methacrylate (MSMA). PMMA/ZrO{sub 2}-TiO{sub 2} incorporating networks formed from alcoholysis of poly(MMA-co-MSMA), zirconium n-butoxide and titanium isoproproxide. The structure, morphology and property of the obtained nanocomposite films were investigated by X-ray photoelectron spectra, Fourier transform infrared spectroscopy, field emission scanning electron microscopy, scanning probe microscopy, thermogravimetric analyses, UV-vis spectrum and spectro-ellipsometer. The nanoparticle size, roughness, thermal stability, UV-shielding property, and refractive index of nanocomposite films increase with the increasing of inorganic contents. The formation mechanism and reason of such improvements were examined and interpreted in a theoretical model. The nanocomposite films possess interesting properties in thermal stability and optical response due to the uniform incorporating networks between organic polymer chains and inorganic clusters.
Refractive microlenses produced by excimer laser machining of poly(methyl methacrylate)
DEFF Research Database (Denmark)
Jensen, Martin Frøhling; Krühne, Ulrich; H., L.
2005-01-01
A method has been developed whereby refractive microlenses can be produced in poly (methyl methacrylate) by excimer laser irradiation at λ = 248 nm. The lenses are formed by a combined photochemical and thermal process. The lenses are formed as depressions in the substrate material (negative foca...
Rheological properties of homogeneous and heterogeneous poly(2-hydroxyethyl methacrylate) hydrogels
Czech Academy of Sciences Publication Activity Database
Karpushkin, Evgeny; Dušková-Smrčková, Miroslava; Remmler, T.; Lapčíková, Monika; Dušek, Karel
2012-01-01
Roč. 61, č. 2 (2012), s. 328-336 ISSN 0959-8103 R&D Projects: GA AV ČR KAN200520804 Institutional research plan: CEZ:AV0Z40500505 Keywords : hydrogel * 2-hydroxyethyl methacrylate * phase separation Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.125, year: 2012
Institute of Scientific and Technical Information of China (English)
Ismet KAYA; Cigdem Yigit PALA
2014-01-01
In this work,some thermodynamic properties of poly( cyclohexyl methacrylate)were studied by inverse gas chromatography( IGC). For this purpose,the polymeric substance was coated on Chromosorb W and which was filled into a glass column. The retention times(tr)of the probes were determined from the interactions of poly(cyclohexyl methacrylate)with n-pentane,n-hexane,n-heptane,n-octane,n-decane, methanol,ethanol,2-propanol,butanol,acetone,ethyl methyl ketone,benzene,toluene and o-xylene by IGC technique. Then,the specific volume(V0g)was determined for each probe molecule. By using(1/T;lnV0g) graphics,the glass transition temperature of poly( cyclohexyl methacrylate)was found to be 373 K. The adsorp-tion heat under the glass transition temperature(ΔH a ),and partial molar heat of sorption above the glass tran-sition(ΔHS1 ),partial molar free energy of sorption(ΔGS1 )and partial molar entropy of sorption(ΔSS1 )belong-ing to sorption for every probe were calculated. The partial molar heat of mixing at infinite dilution(ΔH∞1 ), partial molar free energy of mixing at infinite dilution(ΔG∞1 ),Flory-Huggins interaction parameter(χ∞12 )and weight fraction activity coefficient(a1/w1)∞ values of polymer-solute systems were calculated at different col-umn temperatures. The solubility parameters(δ2 )of the polymer were obtained by IGC technique.
Kaya, Ismet; Pala, Cigdem Yigit
2014-07-01
In this work, some thermodynamic properties of poly (cyclohexyl methacrylate) were studied by inverse gas chromatography (IGC). For this purpose, the polymeric substance was coated on Chromosorb W and which was filled into a glass column. The retention times (t(r)) of the probes were determined from the interactions of poly (cyclohexyl methacrylate) with n-pentane, n-hexane, n-heptane, n-octane, n-decane, methanol, ethanol, 2-propanol, butanol, acetone, ethyl methyl ketone, benzene, toluene and o-xylene by IGC technique. Then, the specific volume (Vg(0)) was determined for each probe molecule. By using (1/T; lnVg(0)) graphics, the glass transition temperature of poly (cyclohexyl methacrylate) was found to be 373 K. The adsorption heat under the glass transition temperature (deltaH(a)), and partial molar heat of sorption above the glass transition (deltaH1(S)), partial molar free energy of sorption (deltaG1(S)) and partial molar entropy of sorption (deltaS1(S)) belonging to sorption for every probe were calculated. The partial molar heat of mixing at infinite dilution (deltaH1(infinity)), partial molar free energy of mixing at infinite dilution (deltaG1(infinity)), Flory-Huggins interaction parameter (chi12(infinity)) and weight fraction activity coefficient (a1/w1)(infinity) values of polymer-solute systems were calculated at different column temperatures. The solubility parameters (delta2) of the polymer were obtained by IGC technique.
Redox Polymerization of Methyl Methacrylate in the Fluorous Triphasic System
Institute of Scientific and Technical Information of China (English)
Shi Zhen CHEN; Yun Peng BAI; Zhao Long LI
2006-01-01
Methyl methacrylate (MMA) was polymerized by using of benzoyl peroxide (BPO) and N, N-dimethylaniline (DMA) as an redox initiator in fluorous triphasic system at room temperature.The polymerization was occurred in both initiator layer and monomer layer in a U-tube. It was found that PMMA obtained from the initiator layer with relatively narrow polydispersity.(PDI =1.38)
Bio-based methacrylic acid via catalytic decarboxylation of itaconic and citric acids
Methacrylic acid is an important commodity monomer for the plastics industry that is produced industrially from acetone, hydrogen cyanide and concentrated sulfuric acid via the acetone cyanohydrin (ACH) process. Disadvantages to the ACH process include nonrenewable starting materials, stoichiometric...
Directory of Open Access Journals (Sweden)
Yoshinori Kadoma
2012-05-01
Full Text Available The NMR chemical shift, i.e., the π-electron density of the double bond, of acrylates and methacrylates is related to the reactivity of their monomers. We investigated quantitative structure-property relationships (QSPRs between the base-catalyzed hydrolysis rate constants (k1 or the rate constant with glutathione (GSH (log kGSH for acrylates and methacrylates and the 13C NMR chemical shifts of their α,β-unsaturated carbonyl groups (δCα and δCβ or heat of formation (Hf calculated by the semi-empirical MO method. Reported data for the independent variables were employed. A significant linear relationship between k1 and δCβ, but not δCα, was obtained for methacrylates (r2 = 0.93, but not for acrylates. Also, a significant relationship between k1 and Hf was obtained for both acrylates and methacrylates (r2 = 0.89. By contrast, log kGSH for acrylates and methacrylates was linearly related to their δCβ (r2 = 0.99, but not to Hf. These findings indicate that the 13C NMR chemical shifts and calculated Hf values for acrylates and methacrylates could be valuable for estimating the hydrolysis rate constants and GSH reactivity of these compounds. Also, these data for monomers may be an important tool for examining mechanisms of reactivity.
Directory of Open Access Journals (Sweden)
Liang Ma
2017-02-01
Full Text Available Surface-initiated atom transfer radical polymerization (SI-ATRP is one of the most versatile techniques to modify the surface properties of materials. Recent developed metal-free SI-ATRP makes such techniques more widely applicable. Herein photo-induced metal-free SI-ATRP of methacrylates, such as methyl methacrylate, N-isopropanyl acrylamide, and N,N-dimethylaminoethyl methacrylate, on the surface of SBA-15 was reported to fabricate organic-inorganic hybrid materials. A SBA-15-based polymeric composite with an adjustable graft ratio was obtained. The structure evolution during the SI-ATRP modification of SBA-15 was monitored and verified by FT-IR, XPS, TGA, BET, and TEM. The obtained polymeric composite showed enhanced adsorption ability for the model compound toluene in aqueous conditions. This procedure provides a low-cost, readily available, and easy modification method to synthesize polymeric composites without the contamination of metal.
Arora, Sheen Juneja; Arora, Aman; Upadhyaya, Viram; Jain, Shilpi
2016-01-01
As, the longevity of provisional restorations is related to, a perfect adaptation and a strong, long-term union between restoration and teeth structures, therefore, evaluation of marginal leakage of provisional restorative materials luted with cements using the standardized procedures is essential. To compare the marginal leakage of the provisional crowns fabricated from Autopolymerizing acrylic resin crowns and bisphenol A-glycidyl dimethacrylate (BIS-GMA) resin crowns. To compare the marginal leakage of the provisional crowns fabricated from autopolymerizing acrylic resin crowns and BIS-GMA resin crowns cemented with different temporary luting cements. To compare the marginal leakage of the provisional crowns fabricated from autopolymerizing acrylic resin (SC-10) crowns cemented with different temporary luting cements. To compare the marginal leakage of the provisional crowns fabricated from BIS-GMA resin crowns (Protemp 4) cemented with different temporary luting cements. Freshly extracted 60 maxillary premolars of approximately similar dimensions were mounted in dental plaster. Tooth reduction with shoulder margin was planned to use a customized handpiece-holding jig. Provisional crowns were prepared using the wax pattern fabricated from computer aided designing/computer aided manufacturing milling machine following the tooth preparation. Sixty provisional crowns were made, thirty each of SC-10 and Protemp 4 and were then cemented with three different luting cements. Specimens were thermocycled, submerged in a 2% methylene blue solution, then sectioned and observed under a stereomicroscope for the evaluation of marginal microleakage. A five-level scale was used to score dye penetration in the tooth/cement interface and the results of this study was analyzed using the Chi-square test, Mann-Whitney U-test, Kruskal-Wallis H-test and the results were statistically significant P provisional crowns cemented with three different luting cements along the axial walls of
Liu, Wan-Ling; Lirio, Stephen; Yang, Yicong; Wu, Lin-Tai; Hsiao, Shu-Ying; Huang, Hsi-Ya
2015-05-22
In this study, an organic polymer monolithic columns, which were prepared via in situ polymerization of alkyl methacrylate-ester (AMA), divinylbenzene (DVB) and vinylbenzyl trimethylammonium chloride (VBTA, charged monomer), were developed as adsorbent for solid-phase microextraction (SPME). Different parameters affecting the extraction efficiency for nine (9) non-steroidal anti-inflammatory drugs (NSAIDs) such as the ratio of the stearyl methacrylate (SMA) to DVB monomer, column length, sample pH, extraction flow rate and desorption solvent were investigated to obtain the optimal SPME condition. Also, the permeability for each poly(AMA-DVB-VBTA) monolithic column was investigated by adding porogenic solvent (poly(ethylene glycol), PEG). Using the optimized condition, a series of AMA-based poly(AMA-DVB-VBTA) monolith columns were developed to determine the effect the extraction efficiency of NSAIDs by varying the alkyl chain length of the methacrylate ester (methyl-, butyl-, octyl-, or lauryl-methacrylate; (MMA, BMA, OMA, LMA)). Results showed that decreasing the AMA chain length increases the extraction efficiency of some NSAIDs (i.e. sulindac (sul), naproxen (nap), ketoprofen (ket) and indomethacin (idm)). Among the poly(AMA-DVB-VBTA) monolithic columns, poly(BMA-DVB-VBTA) showed a highly repeatable extraction efficiency for NSAIDs with recoveries ranging from 85.0 to 100.2% with relative standard deviation (RSD) less than 6.8% (n=3). The poly(BMA-DVB-VBTA) can also be reused for at least 50 times without any significant effect in extraction efficiency for NSAIDs. Finally, using the established conditions, the poly(BMA-DVB-VBTA) was used to extract trace-level NSAIDs (100μgL(-1)) in river water with good recoveries ranging from 75.8 to 90.8% (RSD<14.9%). Copyright © 2015 Elsevier B.V. All rights reserved.
Wettability and ζ potentials of a series of methacrylate polymers and copolymers
Hogt, A.H.; Gregonis, D.E.; Andrade, J.D.; Kim, S.W.; Dankert, J.; Feijen, Jan
1985-01-01
Polymers and copolymers of different methacrylates were synthesized and coated on glass slides. The surfaces of the polymer films were characterized by their water contact angles and potentials using the Wilhelmy plate technique and streaming potential measurements, respectively. From contact-angle
Heinzmann, Christian; Salz, Ulrich; Moszner, Norbert; Fiore, Gina L; Weder, Christoph
2015-06-24
Hydrogen-bonded, side-chain-functionalized supramolecular poly(alkyl methacrylate)s were investigated as light- and temperature-responsive reversible adhesives that are useful for bonding and debonding on demand applications. Here, 2-hydroxyethyl methacrylate (HEMA) was functionalized with 2-ureido-4[1H]pyrimidinone (UPy) via a hexamethylenediisocyanate (HMDI) linker, to create a monomer (UPy-HMDI-HEMA) that serves to form supramolecular cross-links by way of forming quadruple hydrogen bonded dimers. UPy-HMDI-HEMA was copolymerized with either hexyl methacrylate or butyl methacrylate to create copolymers comprising 2.5, 5, or 10 mol % of the cross-linker. The mechanical properties of all (co)polymers were investigated with stress-strain experiments and dynamic mechanical analysis. Furthermore, the adhesive properties were studied at temperatures between 20 and 60 °C by testing single lap joints formed with stainless steel substrates. It was found that increasing the concentration of the UPy-HMDI-HEMA cross-linker leads to improved mechanical and adhesive properties at elevated temperatures. Concurrently, the reversibility of the bond formation remained unaffected, where rebonded samples displayed the same adhesive strength as regularly bonded samples. Debonding on demand abilities were also tested exemplarily for one copolymer, which for light-induced debonding experiments was blended with a UV-absorber that served as light-heat converter. Single lap joints were subjected to a constant force and heated or irradiated with UV light until debonding occurred. The necessary debonding temperature was comparable for direct heating and UV irradiation and varied between 28 and 82 °C, depending on the applied force. The latter also influenced the debonding time, which under the chosen conditions ranged from 30 s to 12 min.
Hydrogel tissue expanders for stomatology. Part I. methacrylate-based polymers
Czech Academy of Sciences Publication Activity Database
Hrib, Jakub; Širc, Jakub; Lesný, P.; Hobzová, Radka; Dušková-Smrčková, Miroslava; Michálek, Jiří; Šmucler, R.
2017-01-01
Roč. 28, č. 1 (2017), s. 1-8, č. článku 12. ISSN 0957-4530 R&D Projects: GA MŠk(CZ) LQ1604; GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:61389013 Keywords : hydrogel * tissue expander * methacrylates Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 2.325, year: 2016
Effect of epoxidation on 30% poly(methyl methacrylate)-grafted natural rubber polymer electrolytes
Energy Technology Data Exchange (ETDEWEB)
Nazir, Khuzaimah; Aziz, Ahmad Fairoz [Faculty of Applied Sciences, Universiti Teknologi MARA, 40450 Shah Alam, Selangor (Malaysia); Adam, Nurul Ilham [Faculty of Applied Sciences, Universiti Teknologi MARA, KampusTapah, 35400 Tapah Road, Tapah, Perak (Malaysia); Yahya, Muhd Zu Azhan [Faculty of Defence Sciences and Technology, Universiti Pertahanan Nasional Malaysia, Kem Sungai Besi, 57000 Kuala Lumpur (Malaysia); Ali, Ab Malik Marwan [Institute of Science, Universiti Teknologi MARA, 40450 Shah Alam, Selangor (Malaysia)
2015-08-28
Epoxidized 30% poly(methyl methacrylate)-grafted natural rubber (EMG 30) as a polymer host in solid polymer electrolytes (SPEs) has been investigated. EMG30 was synthesized via performicepoxidation method onto 30% poly(methyl methacrylate)-grafted natural rubber (MG30) and the formations of epoxy group were discussed. The EMG30 were characterized by proton nuclear magnetic resonance ({sup 1}HNMR) to investigate their chemical structure and differential scanning calorimeter to determine their crystallinity. A new peak in {sup 1}HNMR spectra (2.71 ppm) confirmed the appearance of epoxy group. SPE based on EMG30 doped with 40 wt% LiCF{sub 3}SO{sub 3} show the highest conductivity. The complexation between EMG30 and LiCF{sub 3}SO{sub 3} were confirmed by attenuated total reflection Fourier transform infrared (ATR-FTIR)
Effect of epoxidation on 30% poly(methyl methacrylate)-grafted natural rubber polymer electrolytes
International Nuclear Information System (INIS)
Nazir, Khuzaimah; Aziz, Ahmad Fairoz; Adam, Nurul Ilham; Yahya, Muhd Zu Azhan; Ali, Ab Malik Marwan
2015-01-01
Epoxidized 30% poly(methyl methacrylate)-grafted natural rubber (EMG 30) as a polymer host in solid polymer electrolytes (SPEs) has been investigated. EMG30 was synthesized via performicepoxidation method onto 30% poly(methyl methacrylate)-grafted natural rubber (MG30) and the formations of epoxy group were discussed. The EMG30 were characterized by proton nuclear magnetic resonance ( 1 HNMR) to investigate their chemical structure and differential scanning calorimeter to determine their crystallinity. A new peak in 1 HNMR spectra (2.71 ppm) confirmed the appearance of epoxy group. SPE based on EMG30 doped with 40 wt% LiCF 3 SO 3 show the highest conductivity. The complexation between EMG30 and LiCF 3 SO 3 were confirmed by attenuated total reflection Fourier transform infrared (ATR-FTIR)
Effect of epoxidation on 30% poly(methyl methacrylate)-grafted natural rubber polymer electrolytes
Nazir, Khuzaimah; Aziz, Ahmad Fairoz; Adam, Nurul Ilham; Yahya, Muhd Zu Azhan; Ali, Ab Malik Marwan
2015-08-01
Epoxidized 30% poly(methyl methacrylate)-grafted natural rubber (EMG 30) as a polymer host in solid polymer electrolytes (SPEs) has been investigated. EMG30 was synthesized via performicepoxidation method onto 30% poly(methyl methacrylate)-grafted natural rubber (MG30) and the formations of epoxy group were discussed. The EMG30 were characterized by proton nuclear magnetic resonance (1HNMR) to investigate their chemical structure and differential scanning calorimeter to determine their crystallinity. A new peak in 1HNMR spectra (2.71 ppm) confirmed the appearance of epoxy group. SPE based on EMG30 doped with 40 wt% LiCF3SO3 show the highest conductivity. The complexation between EMG30 and LiCF3SO3 were confirmed by attenuated total reflection Fourier transform infrared (ATR-FTIR).
Cheng, Weiwei; Liu, Guoqin; Wang, Xuede; Han, Lipeng
2017-11-08
Acid-washed oil palm wood-based activated carbon (OPAC) has been investigated for its potential application as a promising adsorbent in the removal of glycidyl esters (GEs) from both palm oil and oil model (hexadecane) solution. It was observed that the removal rate of GEs in palm oil was up to >95%, which was significantly higher than other adsorbents used in this study. In batch adsorption system, the adsorption efficiency and performance of acid-washed OPAC were evaluated as a function of several experimental parameters such as contact time, initial glycidyl palmitate (PGE) concentration, adsorbent dose, and temperature. The Langmuir, Freundlich, and Dubinin-Radushkevich models were used to describe the adsorption equilibrium isotherm, and the equilibrium data were fitted best by the Langmuir model. The maximum adsorption capacity of acid-washed OPAC was found to be 36.23 mg/g by using the Langmuir model. The thermodynamic analysis indicated that the adsorption of PGE on acid-washed OPAC was an endothermic and physical process in nature. The experimental data were fitted by using pseudo-first-order, pseudo-second-order, and intraparticle diffusion models. It was found that the kinetic of PGE adsorption onto acid-washed OPAC followed well the pseudo-second-order model for various initial PGE concentrations and the adsorption process was controlled by both film diffusion and intraparticle diffusion. The desorption test indicated the removal of GEs from palm oil was attributed to not only the adsorption of GEs on acid-washed OPAC, but also the degradation of GEs adsorbed at activated sites with acidic character. Furthermore, no significant difference between before and after PGE adsorption in oil quality was observed.
International Nuclear Information System (INIS)
Becker-Guedes, Fabio; Azevedo, Eduardo R. de; Bonagamba, Tito J.; Schmidt-Rohr, Klaus
2001-01-01
Slow side group dynamics in a series of five poly(alkyl methacrylate)s with varying side group sizes (PMAA, PMMA, PEMA, PiBMA, and PcHMA, with -H, -CH 3 , -CH 2 CH 3 , -CH 2 CH(CH 3 ) 2 , and -cyclohexyl alkyl substituents, respectively) have been studied quantitatively by center band-only detection of exchange (CODEX) and pure exchange (PUREX) 13 C solid-state nuclear magnetic resonance (NMR). Flips and small-angle motions of the ester groups associated with the β-relaxation are observed distinctly, and the fraction of slowly flipping groups has been measured with 3% precision. In PMMA, 34% of side groups flip, while the fraction is 31% in PEMA at 25 C. Even the large isobutyl ether and cyclohexylester side groups can flip in the glassy state, although the flipping fraction is reduced to 22% and ∼10%, respectively. In poly methacrylic acid, no slow side group flips are detected. In PMMA, the flipping fraction is temperature-independent between 25 C and 80 C, while in Pemal it increases continuously from 31 to 60% between 25 C and 60 C. A similar doubling is also observed in Pi BMA. (author)
Directory of Open Access Journals (Sweden)
Yun Hyeok Kim
2018-04-01
Full Text Available A high performance ladder-like structured methacrylate siloxane hybrid material (LMSH was fabricated via simple hydrolytic sol–gel reaction, followed by free-radical polymerization. A structurally ordered siloxane backbone, the ladder-like structure, which is an essential factor for high performance, could be achieved by a short period of sol–gel reaction in only 4 h. This results in superior optical (Transmittance > 90% at 550 nm, thermal (T5 wt % decomposition > 400 ℃ , mechanical properties(elastic recovery = 0.86, hardness = 0.6 GPa compared to the random- and even commercialized cage-structured silsesquioxane, which also has ordered structure. It was investigated that the fabricated ladder-like structured MSH showed the highest overall density of organic/inorganic co-networks that are originated from highly ordered siloxane network, along with high conversion rate of polymerizable methacrylate groups. Our findings suggest a potential of the ladder-like structured MSH as a powerful alternative for the methacrylate polysilsesquioxane, which can be applied to thermally stable and flexible optical coatings, even with an easier and simpler preparation process.
Czech Academy of Sciences Publication Activity Database
Koubková, Jana; Macková, Hana; Proks, Vladimír; Trchová, Miroslava; Brus, Jiří; Horák, Daniel
2015-01-01
Roč. 53, č. 19 (2015), s. 2273-2284 ISSN 0887-624X R&D Projects: GA MŠk(CZ) LH14318; GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:61389013 Keywords : adsorption * grafting * hydrophilic polymers Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.114, year: 2015
Czech Academy of Sciences Publication Activity Database
Grama, Silvia; Horák, Daniel
2015-01-01
Roč. 64, Suppl. 1 (2015), S11-S17 ISSN 0862-8408 R&D Projects: GA MŠk(CZ) EE2.3.30.0029; GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:61389013 Keywords : microspheres * monodisperse * silica Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.643, year: 2015 http://www.biomed.cas.cz/physiolres/pdf/64%20Suppl%201/64_S11.pdf
Microindentation of Polymethyl Methacrylate (PMMA Based Bone Cement
Directory of Open Access Journals (Sweden)
F. Zivic
2011-12-01
Full Text Available Characterization of polymethyl methacrylate (PMMA based bone cement subjected to cyclical loading using microindentation technique is presented in this paper. Indentation technique represents flexible mechanical testing due to its simplicity, minimal specimen preparation and short time needed for tests. The mechanical response of bone cement samples was studied. Realised microindentation enabled determination of the indentation testing hardness HIT and indentation modulus EIT of the observed bone cement. Analysis of optical photographs of the imprints showed that this technique can be effectively used for characterization of bone cements.
Costela, A.; García-Moreno, I.; Mallavia, Ricardo; Amat-Guerri, F.; Barroso, J.; Sastre, R.
1998-06-01
We report on the lasing action of two newly synthesized 2-(2'-hydroxyphenyl) benzimidazole derivatives copolymerized with methyl methacrylate. The laser samples were transversely pumped with a N 2 laser at 337 nm. The influence on the proton-transfer laser performance of the distance between the chromophore group and the polymeric main chain and of the rigidity of the polymeric host matrix, were studied. Significant increases in lasing efficiency and photostability are demonstrated for some of the new materials, as compared to those previously obtained with related proton-transfer dyes also covalently bound to methacrylic monomers.
Directory of Open Access Journals (Sweden)
Ariyanti Sarwono
2008-11-01
Full Text Available Influence of initiator types and emulsion polymerization techniques to particle size of copolymerization styrene-butyl acrylate-methyl methacrylate. Copoly(styrene/butyl acrylic/methyl methacrylic was prepared by emulsion polymerization method. This paper describes effect of insiator types i.e. ammonium persulfate (APS, hydrogen peroxide, ters-butyl peroxide (TBHP, initiator redox (H2O2/ascorbic acid and polymerization techniques i.e. batch and semicontinue to particle size distribution of copoly(styrene/butyl acrylic/methyl methacrylic. Initiator TBHP and H2O2 could not initiate copolymerization properly, but initiator APS and redox initiate copolymerization with batch and semi continue techniques could well perform. The higher concentration of APS, the greater particle size of the copolymer, but the copolymer is polymodal. Initiator redox (H2O2/ascorbic acid produced greater particle size than initiator redox (ascorbic acid/ H2O2.
High temperature initiator-free RAFT polymerization of methyl methacrylate in a microwave reactor
Paulus, R.M.; Becer, C.R.; Hoogenboom, R.; Schubert, U.S.
2009-01-01
The reversible additionfragmentation chain transfer (RAFT) polymerization of methyl methacrylate (MMA) was investigated under microwave irradiation. At first, a comparison was made between microwave and thermal heating for the RAFT polymerization of MMA with azobis(isobutyronitrile) (AIBN) as
Dickison, P; Smith, S D
2018-01-01
Allergic contact dermatitis (ACD) secondary to acrylates and methacrylates is a well- described occurrence, particularly in those who wear or handle gel nail varnish. Management involves avoidance of the identified allergen. The cause of chronic urticaria (CI) is often not identified, and CU is not known to be associated with acrylates or methacrylates. We report a case of a 50-year-old woman who initially presented with hand dermatitis exacerbated by gel nail varnish on a background of CU. Avoiding all nail varnishes because of her ACD also resulted in improvement of her CU. To our knowledge, this is the first documented case of CU secondary to the acrylates and methacrylates found in nail cosmetics. © 2017 British Association of Dermatologists.
International Nuclear Information System (INIS)
Byun, Hun-Soo; Jang, Yoon-Seok; Yoo, Ki-Pung
2010-01-01
The solubility curves for the (carbon dioxide + 2-phenoxyethyl acrylate) and (carbon dioxide + 2-phenoxyethyl methacrylate) systems were determined by a static view cell apparatus at five temperatures (313.2, 333.2, 353.2, 373.2, and 393.2) K as well as pressures up to 31.43 MPa. Two {carbon dioxide + (meth)acrylate} systems had continuous critical mixture curves with maxima in pressure located between the critical temperatures of carbon dioxide and 2-phenoxyethyl (meth)acrylate. The solubility of 2-phenoxyethyl (meth)acrylate in the {carbon dioxide + 2-phenoxyethyl (meth)acrylate} systems increases as the temperature increases at a fixed pressure. The (carbon dioxide + 2-phenoxyethyl acrylate) and (carbon dioxide + 2-phenoxyethyl methacrylate) systems exhibit type-I phase behaviour. The experimental results for the (carbon dioxide + 2-phenoxyethyl acrylate) and (carbon dioxide + 2-phenoxyethyl methacrylate) systems correlate with the Peng-Robinson equation of state using a van der Waals one-fluid mixing rule including two adjustable parameters. The critical properties of 2-phenoxyethyl acrylate and 2-phenoxyethyl methacrylate were predicted with the Joback and Lee-Kesler method.
Energy Technology Data Exchange (ETDEWEB)
Zhou, D.Y.; Wang, G.Z.; Tan, C.L.; Rao, M.M.; Liao, Y.H. [School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Li, W.S.; Li, G.L. [School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Key Lab of Technology on Electrochemical Energy Storage and Power Generation in Guangdong Universities, Guangzhou 510006 (China)
2008-10-01
A copolymer, polyacrylonitrile-methyl methacrylate P(AN-MMA), was synthesized by suspension polymerization with acrylonitrile (AN) and methyl methacrylate (MMA) as monomers. With this copolymer, polymer membrane was prepared by phase inversion. The performances of the polymer were characterized by FTIR, SEM, DSC/TG, EIS and LSV. The copolymer contains CH{sub 2}, CN and CO bonds, and shows its thermal stability up to 300 C. The polymer membrane has a porous structure with an average pore diameter of 0.5 {mu}m. The conductivity of the polymer electrolyte is 1.25 mS cm{sup -1} at room temperature, and it is electrochemically stable up to 5 V (vs. Li). Using the polymer electrolyte as the gel polymer electrolyte (GPE), the cell Li/GPE/LiCoO{sub 2} shows its cyclic stability as good as the cell with liquid electrolyte. (author)
Directory of Open Access Journals (Sweden)
Sumeet Jain
2016-01-01
Full Text Available Squamous cell carcinoma of the eyelid is the second most common malignant neoplasm of the eye with the incidence of 0.09 and 2.42 cases/100 000 people. Orbital invasion is a rare complication but, if recognized early, can be treated effectively with exenteration. Although with advancements in technology such as computer-aided design and computer-aided manufacturing, material science, and retentive methods like implants, orbital prosthesis with stock ocular prosthesis made of methyl methacrylate retained by anatomic undercuts is quiet effective and should not be overlooked and forgotten. This clinical report describes prosthetic rehabilitation of two male patients with polymethyl methacrylate resin orbital prosthesis after orbital exenteration, for squamous cell carcinoma of the upper eyelid. The orbital prosthesis was sufficiently retained by hard and soft tissue undercuts without any complications. The patients using the prosthesis are quite satisfied with the cosmetic results and felt comfortable attending the social events.
Molecular changes in copolymers of styrene and methyl methacrylate caused by radiation
International Nuclear Information System (INIS)
Busfield, W.K.; O'Donnell, J.H.; Smith, C.A.
1976-01-01
Homopolymers of styrene and methyl methacrylate and copolymers of these monomers were irradiated in vacuo at room temperature using 60 Co γ-radiation to various doses. The gaseous radiolysis products of the polymers were analysed by gas chromatography. The radiation chemical yield, G values, of the gaseous and liquid products were calculated for the homopolymers and copolymers. The G values obtained for the homopolymers were compared with those obtained by previous workers. The graphs of G value versus composition (% Styrene) showed a marked deviation from linearity which indicated that the styrene in the copolymer had a greater effect on the behaviour than did the methyl methacrylate units. It has been postulated that the benzene ring on the styrene unit acts in some way as an energy sink, and hence protects the copolymer from radiation damage in an analogous way to that suggested for hydrocarbon mixtures. Mechanisms for the process are discussed. (author)
International Nuclear Information System (INIS)
Lin, S.M.; Ching, C.H.; Tseng, C.L.; Yang, M.H.
1985-01-01
The analysis of tin in biological materials is rarely reported. In this study instrumental neutron activation analysis was used to determine the tin together with some other trace elements in various organs of rats treated with trialkyltin-methacrylic copolymer. No appreciable accumulation of tin and variation of distribution of trace elements (Cr, Fe, Zn and Co) in various organs were found. The pathological changes in the liver sections can not be observed either. This, therefore, indicates that the toxicity of trialkyltin-methacrylic copolymer is low, if any. (author)
Koushki, Amin Reza; Goodarzi, Massoud; Paidar, Moslem
2016-12-01
In the present research, 6-mm-thick 5083-H321 aluminum alloy was joined by the double-pulsed gas metal arc welding (DP-GMAW) process. The objective was to investigate the influence of the shielding gas composition on the microstructure and properties of GMA welds. A macrostructural study indicated that the addition of nitrogen and oxygen to the argon shielding gas resulted in better weld penetration. Furthermore, the tensile strength and bending strength of the welds were improved when oxygen and nitrogen (at concentrations as high as approximately 0.1vol%) were added to the shielding gas; however, these properties were adversely affected when the oxygen and nitrogen contents were increased further. This behavior was attributed to the formation of excessive brown and black oxide films on the bead surface, the formation of intermetallic compounds in the weld metal, and the formation of thicker oxide layers on the bead surface with increasing nitrogen and oxygen contents in the argon-based shielding gas. Analysis by energy-dispersive X-ray spectroscopy revealed that most of these compounds are nitrides or oxides.
Directory of Open Access Journals (Sweden)
Amelian Aleksandra
2017-03-01
Full Text Available Taste of a pharmaceutical formulation is an important parameter for the effectiveness of pharmacotherapy. Cetirizine dihydrochloride (CET is a second-generation antihistamine that is commonly administered in allergy treatment. CET is characterized by extremely bitter taste and it is a great challenge to successfully mask its taste; therefore the goal of this work was to formulate and characterize the microparticles obtained by the spray drying method with CET and poly(butyl methacrylate-co-(2-dimethylaminoethyl methacrylate-co-methyl methacrylate 1:2:1 copolymer (Eudragit E PO as a barrier coating. Assessment of taste masking by the electronic tongue has revealed that designed formulations created an effective taste masking barrier. Taste masking effect was also confirmed by the in vivo model and the in vitro release profile of CET. Obtained data have shown that microparticles with a drug/polymer ratio (0.5:1 are promising CET carriers with efficient taste masking potential and might be further used in designing orodispersible dosage forms with CET.
Energy Technology Data Exchange (ETDEWEB)
Zhang Lin [Department of Chemistry, Nanchang University, 999 Xuefu Avenue, Nanchang 330031 (China); Institute of Polymers, Nanchang University, 999 Xuefu Avenue, Nanchang 330031 (China); Li Fan, E-mail: lfan@ncu.edu.cn [Institute of Polymers, Nanchang University, 999 Xuefu Avenue, Nanchang 330031 (China); Chen Yiwang, E-mail: ywchen@ncu.edu.cn [Department of Chemistry, Nanchang University, 999 Xuefu Avenue, Nanchang 330031 (China); Institute of Polymers, Nanchang University, 999 Xuefu Avenue, Nanchang 330031 (China); Wang Xiaofeng [Institute of Polymers, Nanchang University, 999 Xuefu Avenue, Nanchang 330031 (China)
2011-08-15
In this paper, a new and simple approach for in-situ preparation of transparent ZnO/poly(metyl methacrylate) (ZnO/PMMA) nanocomposite films was developed. Poly(methyl methacrylate)-co-poly(zinc methacrylate acetate) (PMMA-co-PZnMAAc) copolymer was synthesized via free-radical polymerization between methyl methacrylate (MMA) and zinc methacrylate acetate (ZnMAAc), where asymmetric ZnMAAc with only one terminal double bond (C=C) was applied to act as the precursor for ZnO nanocrystals and could avoid cross-link. Subsequently, transparent ZnO/PMMA nanocomposite films were obtained by in-situ thermal decomposition. Scanning electron microscope (SEM) image revealed that ZnO nanocrystals were homogeneously dispersed in PMMA matrix. With thermal decomposition time increasing, the absorption intensity in UV region and photoluminescence intensity of ZnO/PMMA nanocomposite films enhanced. However, the optical properties diminished when the thermal decomposition temperature increased. The TGA measurement displayed ZnO/PMMA nanocomposite films prepared by the in-situ synthesis method possessed better thermal stability compared with those prepared by the physical blending method and pristine PMMA films. - Highlights: > ZnO/PMMA hybrid films were prepared via free-radical polymerization and in-situ thermal decomposition. > ZnO NCs are homogeneously dispersed in the PMMA matrix and these films have good optical properties. > Thermal stability of these films is improved compared with those of physically blending ones.
International Nuclear Information System (INIS)
Zhang Lin; Li Fan; Chen Yiwang; Wang Xiaofeng
2011-01-01
In this paper, a new and simple approach for in-situ preparation of transparent ZnO/poly(metyl methacrylate) (ZnO/PMMA) nanocomposite films was developed. Poly(methyl methacrylate)-co-poly(zinc methacrylate acetate) (PMMA-co-PZnMAAc) copolymer was synthesized via free-radical polymerization between methyl methacrylate (MMA) and zinc methacrylate acetate (ZnMAAc), where asymmetric ZnMAAc with only one terminal double bond (C=C) was applied to act as the precursor for ZnO nanocrystals and could avoid cross-link. Subsequently, transparent ZnO/PMMA nanocomposite films were obtained by in-situ thermal decomposition. Scanning electron microscope (SEM) image revealed that ZnO nanocrystals were homogeneously dispersed in PMMA matrix. With thermal decomposition time increasing, the absorption intensity in UV region and photoluminescence intensity of ZnO/PMMA nanocomposite films enhanced. However, the optical properties diminished when the thermal decomposition temperature increased. The TGA measurement displayed ZnO/PMMA nanocomposite films prepared by the in-situ synthesis method possessed better thermal stability compared with those prepared by the physical blending method and pristine PMMA films. - Highlights: → ZnO/PMMA hybrid films were prepared via free-radical polymerization and in-situ thermal decomposition. → ZnO NCs are homogeneously dispersed in the PMMA matrix and these films have good optical properties. → Thermal stability of these films is improved compared with those of physically blending ones.
Stable Poly(methacrylic acid Brush Decorated Silica Nano-Particles by ARGET ATRP for Bioconjugation
Directory of Open Access Journals (Sweden)
Marcello Iacono
2015-08-01
Full Text Available The synthesis of polymer brush decorated silica nano-particles is demonstrated by activator regeneration by electron transfer atom transfer radical polymerization (ARGET ATRP grafting of poly(tert-butyl methacrylate. ATRP initiator decorated silica nano-particles were obtained using a novel trimethylsiloxane derivatised ATRP initiator obtained by click chemistry. Comparison of de-grafted polymers with polymer obtained from a sacrificial initiator demonstrated good agreement up to 55% monomer conversion. Subsequent mild deprotection of the tert-butyl ester groups using phosphoric acid yielded highly colloidal and pH stable hydrophilic nano-particles comprising approximately 50% methacrylic acid groups. The successful bio-conjugation was achieved by immobilization of Horseradish Peroxidase to the polymer brush decorated nano-particles and the enzyme activity demonstrated in a conversion of o-phenylene diamine dihydrochloride assay.
International Nuclear Information System (INIS)
Pietrucha, K.
1991-01-01
Upon γ-irradiation of aqueous emulsions of methyl methacrylate embedded into chrome tanned skin, the formation of graft copolymers is observed. The number-average molecular weight of the grafted poly(methyl methacrylate) side chains was in the range of 430000 (for a dose of 10 kGy) and practically independent of grafting degree. However, the number of branches per graft copolymer molecule increases from 0.3 to 0.8 when the degree of grafting increases from 32% to 88%. Similarly, the radiation yield, i.e. the number of branches formed per 100 eV of energy absorbed in the substrate polymer increases from 0.75 to 1.94. The value and meaning of molecular weight of graft copolymer is discussed along with the mechanism of polymer chain termination. (author) 14 refs.; 3 figs.; 4 tabs
Institute of Scientific and Technical Information of China (English)
史建明; 包永忠; 黄志明; 翁志学
2004-01-01
Methyl methacrylate (MMA) emulsion polymerization in the presence of nanometer calcium carbonate (nano-CaCO3) surface modified with (-methacryloxypropyltrimethoxysilane (MPTMS) was carried out to prepare poly (methyl methacrylate) (PMMA)/nano-CaCO3 composite. The reaction between nano-CaCO3 and MPTMS, and the grafting of PMMA onto nano-CaCO3 were confirmed by infrared spectrum. The grafting ratio and grafting efficiency of PMMA on nano-CaCO3 modified with MPTMS were much higher than that on nano-CaCO3 modified with stearic acid. The grafting ratio of PMMA increased as the weight ratio between MMA and nano-CaCO3 increased, while the grafting efficiency of PMMA decreased. Transmission electron micrograph showed that nano-CaCO3 covered with PMMA was formed by in-situ emulsion polymerization.
Institute of Scientific and Technical Information of China (English)
无
2007-01-01
An exfoliated layered double hydroxides/poly(methyl methacrylate) (LDHs/PMMA) nanocomposite was prepared by in situ solution polymerization of methyl methacrylate (MMA) in the presence of 4-vinylbenzenesulfonate intercalated LDHs(MgAl-VBS LDHs). MgAl-VBS LDHs was prepared by the ion exchange method, and the structure and composition of the MgAl-VBS LDHs were determined by X-ray diffraction (XRD), infrared spectroscopy and elemental analysis. XRD and transmission electron microscopy (TEM) were employed to examine the structure of LDHs/PMMA nanocomposite. It was indicated that the LDHs layers were well exfoliated and dispersed in the PMMA matrix. The grafting of PMMA onto LDHs was confirmed by the extraction result and the weight fraction of grafted PMMA increased as the weight fraction of LDHs in the nanocomposites increased.
International Nuclear Information System (INIS)
İlter, Zülfiye; Demir, Abdullah; Kaya, İsmet
2016-01-01
Highlights: • Thermodynamic of methacrylate-co-styrene polymers were studied by the inverse gas chromatography. • The sorption parameters of polymer-solute systems were determined under glass transition temperature of polymers. • The solubility parameter (δ 2 ) of the polymer was obtained from the slope and intercepts. • Flory-Huggins interaction parameter (χ 12 ∞ ) were determined for polymer-solute systems. - Abstract: In this study, some thermodynamic properties of poly(7-methoxy-2-acetylbenzofurane methyl methacrylate-co-styrene) Poly(MABMM-co-St) and poly(2-acetylbenzofurane methyl methacrylate-co-styrene) Poly(ABMM-co-St) were studied by the inverse gas chromatography (IGC) technique. The retention times (t r ) of selected organic probes were determined from the interactions with Poly(MABMM-co-St) and Poly(ABMM-co-St) of four groups of solvents with different chemical natures and polarities. Then, specific volume (V g 0 ) values of probes were calculated at different column temperatures. The glass transition temperatures (T g ) of Poly(MABMM-co-St) and Poly(ABMM-co-St) were found as 393, 413 K from inverse gas chromatography measurements, respectively. Under the glass transition temperatures adsorption heat (ΔH a ) and above the glass transition molar heat (ΔH 1 S ), free energies (ΔG 1 S ) and entropies (ΔS 1 S ) belonging to sorption for every probe were calculated from inverse gas chromatography measurements. The partial molar heat (ΔH 1 ∞ ), partial molar free energy (ΔG 1 ∞ ), Flory-Huggins interaction parameter (χ 12 ∞ ) and weight fraction activity coefficient (a 1 /w 1 ) ∞ , values for infinite dilute solutions were calculated for polymer-probe systems. The solubility parameter (δ 2 ) of the polymer was obtained from the slope and intercepts of Flory-Huggins interaction parameter (χ 12 ∞ ) graphs with solubility parameters (δ 1 ) of probes.
Radiation initiated polymerisation of phenyl methacrylate. [Gamma radiation
Energy Technology Data Exchange (ETDEWEB)
Raghunath, S.; Rao, M.H.; Rao, K.N. (Bhabha Atomic Research Centre, Bombay (India). Chemistry Div.)
1983-01-01
Radiation initiated polymerisation of phenyl methacrylate has been studied at various dose rates and temperature. Predominant chain transfer to the monomer was observed and ksub(tran)/Ksub(p) the chain transfer constant ratio was found to be 4 x 10/sup -2/.ksub(p)/ksub(tsup(1/2)) value determined by the kinetic data and the molecular weight data were 0.0821 and 0.0198, respectively. IR studies of polymer at low conversion showed the presence of terminal unsaturation which disappeared at saturation conversion, thus showing its participation in the formation of a three dimensional network.
Venkatesh, R.; Klumperman, B.
2004-01-01
The atom transfer radical (co)polymerization (ATRP) of methyl methacrylate (MMA) with 1-octene was investigated. Well controlled homopolymer of MMA was obtained with 2,2,2-trichoroethanol (TCE) and p-toluenesulfonyl chloride (pTsCl), although, uncontrolled copolymerization occurred when pTsCl was
Morphology and film formation of poly(butyl methacrylate)-polypyrrole core-shell latex particles
Huijs, F; Lang, J
Core-shell latex particles made of a poly(butyl methacrylate) (PBMA) core and a thin polypyrrole (PPy) shell were synthesized by two-stage polymerization. In the first stage, PBMA latex particles were synthesized in a semicontinuous process by free-radical polymerization. PBMA latex particles were
Rajasekaran, Divya; Maji, Pradip K
2018-04-01
This paper deals with the utilization of plastic wastes to a useful product. The major plastic pollutants that are considered to be in maximum use i.e. PET bottle and PE bags have been taken for consideration for recycling. As these two plastic wastes are not compatible, poly (ethylene-co-methacrylic acid) copolymer has been used as compatibilizer to process these two plastic wastes. Effect of dose of poly (ethylene-co-methacrylic acid) copolymer as compatibilizer has been studied here. It has been shown that only 3 wt% of poly (ethylene-co-methacrylic acid) copolymer is sufficient to make 3:1 mass ratio of PET bottle and polyethylene bags compatible. Compatibility has been examined through mechanical testing, thermal and morphological analysis. After analysing the property of recyclates, better mechanical and thermal property has been observed. Almost 500% of tensile property has been improved by addition of 3 wt% of poly (ethylene-co-methacrylic acid) copolymer in 3:1 mass ratio blend of PET bottle and PE bags than that of pristine blend. Morphological analysis by FESEM and AFM has also confirmed the compatibility of the blend. Experimental data showed better performance than available recycling process. Copyright © 2018 Elsevier Ltd. All rights reserved.
Shirinzad, Mehdi; Rezaei-Soufi, Loghman; Mirtorabi, Maryam Sadat; Vahdatinia, Farshid
2016-03-01
Composite restorations must have tooth-like optical properties namely color and translucency and maintain them for a long time. This study aimed to compare the effect of accelerated artificial aging (AAA) on the translucency of three methacrylate-based composites (Filtek Z250, Filtek Z250XT and Filtek Z350XT) and one silorane-based composite resin (Filtek P90). For this in vitro study, 56 composite discs were fabricated (n=14 for each group). Using scanning spectrophotometer, CIE L*a*b* parameters and translucency of each specimen were measured at 24 hours and after AAA for 384 hours. Data were analyzed using one-way ANOVA, Tukey's test and paired t-test at P=0.05 level of significance. The mean (±standard deviation) translucency parameter for Filtek Z250, Filtek Z250XT, Filtek Z350XT and Filtek P90 was 5.67±0.64, 4.59±0.77, 7.87±0.82 and 4.21±0.71 before AAA and 4.25±0.615, 3.53±0.73, 5.94±0.57 and 4.12±0.54 after AAA, respectively. After aging, the translucency of methacrylate-based composites decreased significantly (P0.05). The AAA significantly decreased the translucency of methacrylate-based composites (Filtek Z250, Filtek Z250XT and Filtek Z350XT) but no change occurred in the translucency of Filtek P90 silorane-based composite.
Polypropylene fibers modified by plasma treatment for preparation of Ag nanoparticles.
Tseng, Chun-Hao; Wang, Cheng-Chien; Chen, Chuh-Yung
2006-03-09
A novel method for preparing poly(propylene-graft-2-methacrylic acid 3-(bis-carboxymethylamino)-2-hydroxy-propyl ester)-silver fibers (PPG-IAg fibers) by plasma-induced grafting polymerization is presented in this study. The chelating groups, -N(CH2COO-)2 (GMA-IDA), on the surface of the PPG-I fibers are the coordination sites for chelating silver ions. At these sites, Ag nanoparticles were grown first by reduction with UV light with a wavelength of 366 nm, and second, through immersion in a 24% formaldehyde solution with pH values set variously at 2, 5, 8, and 11. The characteristics of the PPG-I fibers with differing durations of plasma treatment were monitored by using a Fourier transform infrared (FT-IR) spectroscope. Scanning electronic microscopy (SEM) and elemental analysis show that the percentage of GMA-IDA grafted onto PP fiber reaches a maximum when the plasma treatment time is 3 min. Plasma treatment time beyond a certain length of time results in an abundance of free radicals and causes considerable cross-linking on the fiber surface which thus decreases the extent of grafting. Moreover, the crystalline phase of Ag nanoparticles is identified by using X-ray diffraction (XRD). When the PPG-I fibers are reduced by the UV light method, SEM and TEM microscopes reveal that the size of the Ag nanoparticles on the fiber surface decreases significantly with the increase of pH values in aqueous solutions. Notably, in the reduction of formaldehyde solution, the particle size of Ag nanoparticles reaches a minimum at the lowest pH value. The TEM observations show that Ag nanoparticles are distributed both in the exterior and interior of the grafting layer. In addition, under high pH values the distribution of the Ag nanoparticles permeate more deeply in the GMA-IDA grafting layer due to the swelling effect of the GMA-IDA polymer.
International Nuclear Information System (INIS)
Kumar, R.N.; Quah, S.H.; Kong, K.W.; Rozman, H.D.; Tin, W.C.
1999-01-01
Epoxidized Natural Rubber (ENR) had been earlier found to impart toughness to otherwise brittle epoxy resin. Since the high viscosity of solutions of ENR in reactive solvent glycidyl methacrylate,imposed a limitation to the incorporation of higher percentages of the elastomer to the epoxy systems, experiments were initiated to employ the liquid elastomer, namely, epoxidized polybutadiene In the formulations. 'Mixture Design', a statistical experimental design, was adopted to study the effect of compositional and process variables on the curing of surface coatings formulated from the above system by UV radiation initiated by cationic photo-initiators. This paper also reports the results of the experiments carded out with epoxidized soybean oil Employed as a flexibilizer in the cycloaliphatic epoxy-ENR system
An Investigation of Low Biofouling Copper-charged Membranes
Asapu, Sunitha
with increased biofouling resistance. The goal of this project was to develop low-biofouling nanofiltration cellulose acetate (CA) membranes through functionalization with metal chelating ligands charged with biocidal metal ions, i.e. copper ions. To this end, glycidyl methacrylate (GMA), an epoxy, was used to attach a chelating agent, iminodiacetic acid (IDA) to facilitate the charging of copper to the membrane surface. Both CA and CA-GMA membranes were cast using the phase-inversion method. The CA-GMA membranes were then charged with copper ions to make them low biofouling. Pore size distribution analysis of CA and copper charged membranes were conducted using various molecular weights of polyethylene glycol (PEG). CA and copper-charged membranes were characterized using Fourier Transform Infrared (FTIR), contact angle to measure hydrophilicity changes, and using scanning electron microscope (SEM) coupled with X-ray energy dispersive spectroscopy EDS to monitor copper leaching. Permeation experiments were conducted with distilled (DI) water, protein solutions, and synthetic brackish water containing microorganisms. The DI water permeation of the copper-charged membranes was initially lower than the CA membranes. The membranes were then subjected to bovine serum albumin (BSA) and lipase filtration. The copper-charged membranes showed higher pure water flux values for both proteins as compared to CA membranes. The rejection of BSA and lipase was the same for both the copper charged and CA membranes. The filtration with the synthetic brackish water showed that copper-charged membranes had higher flux values as compared to CA membranes, and biofouling analysis showed more bacteria on the CA membranes as compared to copper-charged membranes. Therefore, the copper-charged membranes made here have shown a potential to be used as low-biofouling membranes in the future.
Syringyl Methacrylate, a Hardwood Lignin-Based Monomer for High-Tg Polymeric Materials.
Holmberg, Angela L; Reno, Kaleigh H; Nguyen, Ngoc A; Wool, Richard P; Epps, Thomas H
2016-05-17
As viable precursors to a diverse array of macromolecules, biomass-derived compounds must impart wide-ranging and precisely controllable properties to polymers. Herein, we report the synthesis and subsequent reversible addition-fragmentation chain-transfer polymerization of a new monomer, syringyl methacrylate (SM, 2,6-dimethoxyphenyl methacrylate), that can facilitate widespread property manipulations in macromolecules. Homopolymers and heteropolymers synthesized from SM and related monomers have broadly tunable and highly controllable glass transition temperatures ranging from 114 to 205 °C and zero-shear viscosities ranging from ∼0.2 kPa·s to ∼17,000 kPa·s at 220 °C, with consistent thermal stabilities. The tailorability of these properties is facilitated by the controlled polymerization kinetics of SM and the fact that one vs two o -methoxy groups negligibly affect monomer reactivity. Moreover, syringol, the precursor to SM, is an abundant component of depolymerized hardwood (e.g., oak) and graminaceous (e.g., switchgrass) lignins, making SM a potentially sustainable and low-cost candidate for tailoring macromolecular properties.
A Hydrogen Ion-Selective Sensor Based on Non-Plasticised Methacrylic-acrylic Membranes
Directory of Open Access Journals (Sweden)
Musa Ahmad
2002-08-01
Full Text Available A methacrylic-acrylic polymer was synthesised for use as a non-plasticised membrane for hydrogen ion-selective sensor incorporating tridodecylamine as an ionophore. The copolymer consisted of methyl methacrylate and n-butyl acrylate monomers in a ratio of 2:8. Characterisation of the copolymer using FTNMR demonstrated that the amount of each monomer incorporated during solution polymerisation was found to be similar to the amount used in the feed before polymerisation. The glass transition temperature of the copolymer determined by differential scanning calorimetry was -30.9 ºC. Potentiometric measurements conducted showed a linear pH response range of 4.3 – 9.6 with the response slope of 56.7 mV/decade. The selectivity of the sensors towards hydrogen ions was similar to other plasticiser based membrane electrodes and the logarithmic selectivity coefficients for discrimination against interference cations is close to –9.7. However, the incorporation of a lipophilic anion as membrane additive is essential in ensuring optimum performance of the hydrogen ion sensor.
Energy Technology Data Exchange (ETDEWEB)
Rabelo, D. E-mail: denilson@quimica.ufg.br; Lima, E.C.D.; Barbosa, D.P.; Silva, V.J.; Silva, O.; Azevedo, R.B.; Silva, L.P.; Lemos, A.P.C.; Morais, P.C
2002-11-01
Preparation and characterization of nanosized magnetic particles using alkaline oxidation of ferrous ion retained in acrylonitrile-methyl methacrylate-divinylbenzene (AN-MMA-DVB) spherical micron-sized polymer template is described. Atomic absorption, transmission electron microscopy and magnetic resonance were used to investigate chemically cycled nanoparticle-based composites. The resonance field shifts towards higher values as the nanoparticle concentration reduces in the polymeric template, following two very distinct regimes.
International Nuclear Information System (INIS)
Pietrucha, K.; Kroh, J.
1984-01-01
Investigations on the stratigraphic distribution of poly/methyl methacrylate/ in leather follow our earlier experiments on radiation grafting of vinyl monomers in situ. Polymer distribution was determined for pigskins and cattlehides tanned with basic sulphates of chromium/III/. 14 C-labelled methyl methacrylate was used in present experiments. Precision slicing technique was employed to cut consecutive slices parallel to the grain surface of the radiation modified leather. Quantative analysis of polymer distribution in leather was based on radioactivity measurements. Each layer was burned in Oxymat apparatus and resulting 14 CO 2 was analysed by liquid scintillation method. On the basis of radioactivity measurements and visual observations with light microscope conclusion on desirable distribution of polymer was reached. In the midcorium part of leather polymer is evenly distributed and its content is much higher than for outer layers next to surface and flesh. Mechanism of relevant processes as well as formation and role played by peroxide compounds is discussed
International Nuclear Information System (INIS)
Pietrucha, K.; Kroh, J.
1985-01-01
Investigations on the stratigraphic distribution of poly(methyl methacrylate) in leather follow our earlier experiments on radiation grafting of vinyl monomers in situ. Polymer distribution was determined for pigskins and cattlehides tanned with basic sulphates of chromium (III). 14 C-labelled methyl methacrylate was used in present experiments. Precision slicing technique was employed to cut consecutive slices parallel to the grain surface of the radiation modified leather. Quantitative analysis of polymer distribution in leather was based on radioactivity measurements. Each layer was burned in Oxymat apparatus and resulting 14 CO 2 was analysed by liquid scintillation method. On the basis of radioactivity measurements and visual observations with light microscope conclusion on desirable distribution of polymer was reached. In the midcorium part of leather polymer is evenly distributed and its content is much higher than for outer layers next to surface and flesh. Mechanism of relevant processes as well as formation and role played by peroxide compounds are discussed. (author)
Energy Technology Data Exchange (ETDEWEB)
Karaman, Mustafa, E-mail: karamanm@selcuk.edu.tr [Department of Chemical Engineering, Selcuk University (Turkey); Advanced Technology Research and Application Center, Selcuk University (Turkey); Cabuk, Nihat [Department of Chemical Engineering, Selcuk University (Turkey)
2012-08-31
Poly(2-(diisopropylamino)ethyl methacrylate) (PDPAEMA) thin films were deposited on low temperature substrates by initiated chemical vapor deposition (iCVD) method using tertbutyl peroxide as an initiator. Very high deposition rates up to 38 nm/min were observed at low filament temperatures due to the use of the initiator. Fourier transform infrared spectroscopy and X-ray photoelectron spectroscopy show the formation of PDPAEMA films with high retention of tertiary amine functionality which is responsible for pH induced changes in the wetting behavior of the surfaces. As-deposited PDPAEMA thin films on flat Si surface showed a reversible switching of water contact angle values between 87 Degree-Sign and 28 Degree-Sign ; after successive treatments of high and low pH water solutions, respectively. Conformal and non-damaging nature of iCVD allowed to functionalize fragile and rough electrospun poly(methyl methacrylate) fiber mat surfaces by PDPAEMA, which creates a surface with a switching behavior between superhydrophobic and approaching superhydrophilic with contact angle values of 155 {+-} 3 Degree-Sign and 22 {+-} 5 Degree-Sign , respectively. - Highlights: Black-Right-Pointing-Pointer Poly(2-diisopropylaminoethyl methacrylate) thin films were deposited by a dry process. Black-Right-Pointing-Pointer Initiated chemical vapor deposition can produce thin films on fragile substrates. Black-Right-Pointing-Pointer We report a reversible pH-induced transition from hydrophilic to super-hydrophobic.
Directory of Open Access Journals (Sweden)
Ioanna Savva
2012-01-01
Full Text Available Magnetoresponsive polymer-based fibrous nanocomposites belonging to the broad category of stimuli-responsive materials, is a relatively new class of “soft” composite materials, consisting of magnetic nanoparticles embedded within a polymeric fibrous matrix. The presence of an externally applied magnetic field influences the properties of these materials rendering them useful in numerous technological and biomedical applications including sensing, magnetic separation, catalysis and magnetic drug delivery. This study deals with the fabrication and characterization of magnetoresponsive nanocomposite fibrous membranes consisting of methacrylic random copolymers based on methyl methacrylate (MMA and 2-(acetoacetoxyethyl methacrylate (AEMA (MMA-co-AEMA and oleic acid-coated magnetite (OA·Fe3O4 nanoparticles. The AEMA moieties containing β-ketoester side-chain functionalities were introduced for the first time in this type of materials, because of their inherent ability to bind effectively onto inorganic surfaces providing an improved stabilization. For membrane fabrication the electrospinning technique was employed and a series of nanocomposite membranes was prepared in which the polymer content was kept constant and only the inorganic (OA·Fe3O4 content varied. Further to the characterization of these materials in regards to their morphology, composition and thermal properties, assessment of their magnetic characteristics disclosed tunable superparamagnetic behaviour at ambient temperature.
Directory of Open Access Journals (Sweden)
Alexander Mixa
2008-01-01
Full Text Available Membrane-based separation of phenol/water mixtures with concentrations of phenol between 3 wt% and 8 wt% in the feed has been performed with nonmodified as well as cross-linked ethylene-methacrylic acid (E-MAA copolymers with different amounts of methacrylic acid. As cross-linking agents, aluminium acetyl acetonate, which leads to ionically cross-linked membranes, and 2,3,5,6-tetramethyl-1,4-phenylene diamine and glycerine digycidether, leading to covalently cross-linked membranes, have been used. Generally, it was found that with increasing phenol content in the feed, the total flux is increasing whereas the enrichment factor is decreasing. Using nonmodified membranes with higher methacrylic acid monomer content in the polymer, lower fluxes and higher enrichment factors were observed. Investigation of different cross-linked membranes showed that with high phenol concentration in the feed, ionic cross-linking seems to be very promising. Furthermore, variation of feed temperature shows that ionically cross-linked membranes reached higher fluxes as well as higher enrichment factors at elevated temperatures. The temperature-dependent data were fitted based on an Arrhenius-type equation, and activation energies for the permeation of phenol and water through the membrane were calculated.
Berber, Hale; Alpdogan, Güzin
2017-01-01
In this study, poly(glycidyl methacrylate-methyl methacrylate-divinylbenzene) was synthesized in the form of microspheres, and then functionalized by 2-aminobenzothiazole ligand. The sorption properties of these functionalized microspheres were investigated for separation, preconcentration and determination of Al(III), Fe(II), Co(II), Cu(II), Cd(II) and Pb(II) ions using flame atomic absorption spectrometry. The optimum pH values for quantitative sorption were 2 - 4, 5 - 8, 6 - 8, 4 - 6, 2 - 6 and 2 - 3 for Al(III), Fe(II), Co(II), Cu(II), Cd(II) and Pb(II), respectively, and also the highest sorption capacity of the functionalized microspheres was found to be for Cu(II) with the value of 1.87 mmol g -1 . The detection limits (3σ; N = 6) obtained for the studied metals in the optimal conditions were observed in the range of 0.26 - 2.20 μg L -1 . The proposed method was successfully applied to different beverage samples for the determination of Al(III), Fe(II), Co(II), Cu(II), Cd(II) and Pb(II) ions, with the relative standard deviation of <3.7%.
International Nuclear Information System (INIS)
Figueroa de Paz, Y. M.
2014-01-01
One of the traditional objectives in research has been the development of new and useful materials that combine the properties of polymers with metals. Synthesis of monomers containing metal, followed by a polymerization process, is a method to introduce metal ions in the structure of a polymer, and the gamma radiation was easily applied to initiate polymerization. The coordination polymers have high insolubility, which is a general problem of these materials, besides the lack of structural information available. Also, due to the difficulty of obtaining single crystals, it has hindered the identification of the structures of some coordination polymers, requiring the use of indirect methods for structural characterization. In this work the synthesis of silver poly-methacrylate (PMAAg), was performed using the gamma radiation as polymerization initiator, having as precursor to silver methacrylate monomer (MAAg). The combination of spectroscopic methods revealed structural changes in the coordination polymers. With scanning electron microscopy, it was observed that the morphology of the monomer and its polymers is fiber, which grows with increasing radiation dose; furthermore, this increase in size is related to Bet analysis result, since the monomer has a bigger superficial area to the irradiated polymers. In monomer and irradiated polymers the crystalline structure CCC was observed by X-ray diffraction. By thermogravimetric analysis the decomposition temperature of the products was determined, finding around 150 degrees C. The infrared spectroscopy confirmed the silver methacrylate polymerization, as with increasing radiation dose, also increases the degree of polymerization; likewise the form of coordination of the monomer was determined and its irradiated polymers which corresponds to a bi-dentate chelate, confirmed by X-ray photoelectron spectroscopy. (Author)
Le Nôtre, Jérôme; Witte-van Dijk, Susan C M; van Haveren, Jacco; Scott, Elinor L; Sanders, Johan P M
2014-09-01
Methacrylic acid, an important monomer for the plastics industry, was obtained in high selectivity (up to 84%) by the decarboxylation of itaconic acid using heterogeneous catalysts based on Pd, Pt and Ru. The reaction takes place in water at 200-250 °C without any external added pressure, conditions significantly milder than those described previously for the same conversion with better yield and selectivity. A comprehensive study of the reaction parameters has been performed, and the isolation of methacrylic acid was achieved in 50% yield. The decarboxylation procedure is also applicable to citric acid, a more widely available bio-based feedstock, and leads to the production of methacrylic acid in one pot in 41% selectivity. Aconitic acid, the intermediate compound in the pathway from citric acid to itaconic acid was also used successfully as a substrate. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
DEFF Research Database (Denmark)
Song, Yihu; Bu, Jing; Zuo, Min
2017-01-01
transition and segmental dynamics of PMMA in the nanocomposites prepared via solution casting was compared. The remarkable depression (≥10 °C) of glass transition temperature (Tg) induced by the incorporation of SiO2 and CS was both observed at low loadings. Here, different mechanisms were responsible...... for the effect of SiO2 and CS on the segmental acceleration of PMMA matrix. The formation of rigid amorphous fraction (RAF) layer around SiO2 with the thickness of 16.4 nm led to the adjacent molecular packing frustration, while the “lubrication” effect of nonwetting interface between the grafted crosslinked......Core-shell (CS) nanocomposite particles with 53.4 wt% cross-linked poly (methyl methacrylate) (PMMA) shell of 11.6 nm in thickness were fabricated via miniemulsion polymerization of methyl methacrylate in the presence of modified nanosilica. The influence of nanosilica and CS nanoparticles on glass...
CSIR Research Space (South Africa)
Mittal, H
2015-01-01
Full Text Available This study reports the microwave-assisted synthesis of gum-ghatti (Gg)-grafted poly(acrylamide-co-methacrylic acid) (AAm-co-MAA) hydrogels for the development of biodegradable flocculants and adsorbents. The synthesized hydrogels were characterized...
Baumgaertel, A.; Becer, C.R.; Gottschaldt, M.; Schubert, U.S.
2008-01-01
Matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF MS) was chosen for an in-detail analysis of poly(methyl methacrylate) (PMMA) in order to determine the possible fragmentation mechanism with the help of collision-induced dissociation (CID). All experiments were
Continuous ARGET ATPR of methyl methacrylate and butyl acrylate in a stirred tank reactor
Chan, N.; Meuldijk, J.; Cunningham, M.F.; Hutchinson, R.A.
2013-01-01
ARGET ATRP (activator regenerated by electron transfer atom transfer radical polymerization) of butyl acrylate (BA) and methyl methacrylate (MMA) was successfully adapted from a batch process to a continuous stirred tank reactor (CSTR) with 50 ppm copper. A series of batch polymerizations were first
Holder, E.; Meier, M.A.R.; Marin, V.N.; Schubert, U.S.
2003-01-01
The luminescent complex [4-(3-hydroxypropyl)-4-methyl-2,2-bipyridine]-bis(2,2-bipyridine)-ruthenium(II)-bis(hexafluoroantimonate) and its methacrylate derivative were successfully synthesized and fully characterized by two-dimensional 1H and 13C{1H} NMR techniques [correlation spectroscopy (COSY)
Chen, Bo; Pernodet, Nadine; Rafailovich, Miriam H; Bakhtina, Asya; Gross, Richard A
2008-12-02
A series of epoxy-activated polymer films composed of poly(glycidyl methacrylate/butyl methacrylate/hydroxyethyl methacrylate) were prepared. Variation in comonomer composition allowed exploration of relationships between surface wettability and Candida antartica lipase B (CALB) binding to surfaces. By changing solvents and polymer concentrations, suitable conditions were developed for preparation by spin-coating of uniform thin films. Film roughness determined by AFM after incubation in PBS buffer for 2 days was less than 1 nm. The occurrence of single CALB molecules and CALB aggregates at surfaces was determined by AFM imaging and measurements of volume. Absolute numbers of protein monomers and multimers at surfaces were used to determine values of CALB specific activity. Increased film wettability, as the water contact angle of films increased from 420 to 550, resulted in a decreased total number of immobilized CALB molecules. With further increases in the water contact angle of films from 55 degrees to 63 degrees, there was an increased tendency of CALB molecules to form aggregates on surfaces. On all flat surfaces, two height populations, differing by more than 30%, were observed from height distribution curves. They are attributed to changes in protein conformation and/or orientation caused by protein-surface and protein-protein interactions. The fraction of molecules in these populations changed as a function of film water contact angle. The enzyme activity of immobilized films was determined by measuring CALB-catalyzed hydrolysis of p-nitrophenyl butyrate. Total enzyme specific activity decreased by decreasing film hydrophobicity.
International Nuclear Information System (INIS)
Mohamed, S.H.; Arifin, A.; Mohd Ishak, Z.A.; Nizam, A.; Samsudin, A.R.
2004-01-01
The aim of this study was to evaluate the effect of powder-to-liquid ratio on the glass transition temperature (Tg) and the tensile properties of denture base material prepared from poly (methyl methacrylate) (PMMA) and hydroxyapatite (HA) previously treated with 3-trimethoxysilylpropyl methacrylate (γ-MPS). Specimens for, mechanical testing were prepared by adding composites powder (PMMA, BPO and RA) to the monomer (MMA and EGDMA) followed by hand mixing as in dental laboratory description usage. The glass transition temperature was studied by using differential scanning calorimetry (DSQ. It was observed that the tensile properties and the Tg were affected by the powder-to-liquid ratio. The mechanical characterization of the materials were performed by using single edge notch-tension (SEN-T) specimens; the fracture toughness was slightly higher in formulation which contained RA filler compared to commercial denture base material. (Author)