Stem Cell Information: Glossary
... Tips Info Center Research Topics Federal Policy Glossary Stem Cell Information General Information Clinical Trials Funding Information Current ... here Home » Glossary Back to top Glossary Adult stem cell Astrocyte Blastocoel Blastocyst Bone marrow stromal cells Bone ...
A glossary of atmospheric science
International Nuclear Information System (INIS)
1996-09-01
This book concentrates on the glossary of atmospheric science, which contains summary, for enactment and deliberation on choosing special glossary on atmospheric science in Korea, examiner for the glossary on atmospheric science, reference, explanatory notes and a lot of glossary on atmospheric science. It also has an appendix on commercial abbreviation, prefix, unit, wavelength and the number o vibrations of electromagnetic waves, ICAO classified catalogue on cloud, list of varietal cloud and list of local wind. It has explanation of the glossary in English, Korea, China and Japan.
Resource Conservation Glossary.
Soil Conservation Society of America, Ankeny, IA.
This glossary is a composite of terms selected from 13 technologies, and is the expanded revision of the original 1952 edition of "The Soil and Water Conservation Glossary." The terms were selected from these areas: agronomy, biology, conservation, ecology, economics, engineering, forestry, geology, hydrology, range, recreation, soils, and…
Radioactive waste management glossary
International Nuclear Information System (INIS)
1988-01-01
The Waste Management Glossary defines over 300 terms in the English language that have special meanings when they are used in the context of radioactive waste management. The Glossary is intended to provide a consistent reference for these terms for specialists in this field. It also will assist non-specialists who read IAEA reports dealing with waste management. This is the second edition of the Glossary. It is intended to update and replace its predecessor, TECDOC-264, that was issued in 1982. (author)
International Nuclear Information System (INIS)
Othman, Ibrahim; Abdul-Rahim, Maha
1989-12-01
This glossary contains the arabic equivalent of all the terms included in the IAEA Safety Series No.76 (which is a selected basic terms used in IAEA publications), thus this glossary contains English, French, Spanish, Russian, and Arabic. It is intended to facilitate the work of arabic speaking scientists involved in the field of radiation protection
Radioactive waste management glossary
International Nuclear Information System (INIS)
1982-04-01
Terminology used in documents published by the IAEA is frequently defined in glossaries in the separate documents so that understanding is enhanced, particularly for terms having unique meanings in the field of radioactive waste management. This has been found to be a good practice but frequently a burdensome one, too. In addition, terms in various documents occasionally were used differently. Thus, a common glossary of terms for radioactive waste management documents is believed to have merit. This glossary has been developed for use in IAEA documentation on radioactive waste management topics. The individual items have been compiled by selecting terms and definitions from thirty sources, listed on the next page, and numerous people. An effort has been made to use the definitions in internationally-accepted glossaries (e.g. ICRP, ICRU, ISO), with minimum modification; similarly, definitions in recently published IAEA documents have been respected. Nevertheless, when modifications were believed appropriate, they have been made. The glossary, stored on magnetic tape, is intended to be used as a standard for terminology for IAEA use; it is hoped that some benefits of common international terminology may result from its use in IAEA documentation
Interpares 3 multilingual glossary
Directory of Open Access Journals (Sweden)
Claudia Lacombe Rocha
2011-01-01
Full Text Available InterPARES Project (International Research on Permanent Authentic Records in Electronic Systems is a multidisciplinary international collaborative endeavor, which involves researchers from many countries. As one of the products of the project's second phase a Terminology Database was presented, containing two main instruments: a glossary and a dictionary. The terms and definitions presented in the glossary are the key to facilitate communication among the investigators as well to support the dissemination of InterPARES theory and methodology. Accordingly, InterPARES 3 investigators are translating the glossary.
A glossary for avian conservation biology
Rolf R. Koford; John B. Dunning; Christine A. Ribic; Deborah M. Finch
1994-01-01
This glossary provides standard definitions for many of the terms used in avian conservation biology. We compiled these definitions to assist communication among researchers, managers, and others involved in the Neotropical Migratory Bird Conservation Program, also known as Partners in Flight. We used existing glossaries and recent literature to prepare this glossary....
... Loss Resources Resources Resources Content Licensing and Co-branding Glossary Advance directive - A general term that describes ... approach to expert medical care, pain management, and emotional and spiritual support expressly tailored to the person's ...
Interdisciplinary glossary — particle accelerators and medicine
International Nuclear Information System (INIS)
Dmitrieva, V V; Dyubkov, V S; Nikitaev, V G; Ulin, S E
2016-01-01
A general concept of a new interdisciplinary glossary, which includes particle accelerator terminology used in medicine, as well as relevant medical concepts, is presented. Its structure and usage rules are described. An example, illustrating the quickly searching technique of relevant information in this Glossary, is considered. A website address, where one can get an access to the Glossary, is specified. Glossary can be refined and supplemented. (paper)
Telecommunications glossary of telecommunications terms
1997-01-01
This glossary contains more than 5,000 technical terms and definitions that were standardized by the federal government for use by international and U.S. government telecommunications specialists. It includes international and national terms drawn from the International Telecommunication Union, the International Organization for Standardization, the TIA, ANSI, and others.
International Nuclear Information System (INIS)
1986-01-01
The glossary is intended to be used as a terminology standard for IAEA documentation on radiation protection. An effort has been made to use definitions contained in internationally accepted publications such as recommendations of the International Commission on Radiological Protection (ICRP), standards of the International Organization for Standardization (ISO) and of the International Electrotechnical Commission (IEC), reports of the International Commission on Radiation Units and Measurements (ICRU), with only slight modifications in order to tailor them more closely to IAEA needs. The glossary is restricted to ionizing radiation
A CRITICAL REVIEW OF THE ENGLISH LANGUAGE TEXTBOOK WITH EMPHASIS ON ENGLISH-SERBIAN GLOSSARY
Иван Књижар
2012-01-01
In this paper we made a critical review of textbook Messages 1 with emphasis on English-Serbian glossary. Since this textbook is intended for pupils of 5th grade, we examined its appropriateness for this age group. In addition, we did lexical and semantic analysis of a glossary that is incorporated in the textbook. Messages 1 is extraordinarily designed textbook. It is alsko uitable for pupils of 5th grade whose first language is not English. In terms of the English-Serbian glossary, there is...
Feature article: adoption of an official ISEA glossary
Energy Technology Data Exchange (ETDEWEB)
Zartarian, Valerie; Bahadori, Tina; McKone, Thomas
2004-09-15
The International Society for Exposure Analysis (ISEA) and its Nomenclature Committee have been involved since the mid-1990s in an intermittent but ongoing effort to develop an official ISEA glossary. Several related activities have stimulated greater interest and discussion nationally and internationally on a common exposure language. Among these activities are a 1997 Journal of Exposure Analysis and Environmental Epidemiology feature article on exposure and dose definitions and a 1999-initiated project of the International Programme on Chemical Safety (IPCS) (WHO/ILO/UNEP) to confront terminology issues hindering harmonization in the area of exposure assessment. Recently the ISEA members voted in support of adopting the IPCS glossary as the official ISEA glossary, and the ISEA Executive Board agreed to accept this recommendation. In this feature article we (1) describe the process through which the ISEA adopted the IPCS glossary as the official ISEA glossary, (2) present the joint IPC S/ISEA glossary of terms and their definitions, and (3) discuss plans for how the glossary can be used by ISEA and updated over time by ISEA and IPCS. The glossary is intended to be a living document that reflects the latest usage and maintains international harmonization of exposure terminology that can be practically applied to improve communication in exposure and related fields.
A glossary of Karst terminology
Monroe, Watson Hiner
1970-01-01
This glossary includes most terms used in describing karst geomorphologic features and processes. The terms are primarily those used in the literature of English-speaking countries, but a few of the more common terms in French, German, and Spanish are included, with references to the corresponding English terms where they are available. The glossary also includes simple definitions of the more common rocks and minerals found in karst terrain, common terms of hydrology, and a number of the descriptive terms used by speleologists. The glossary does not include definitions of most biospeleological terms, geologic structure terms, varieties of carbonate rock that require microscopic techniques for identification, or names describing tools and techniques of cave exploration.
SNODOG Glossary: Part 1, Introduction
Energy Technology Data Exchange (ETDEWEB)
Watson, C.R.
1993-04-15
The SNODOG Glossary is used by the DOE-supported life-span beagle studies to describe medical observations in a standardized format. It is an adaptation of the human medical glossary, SNOMED, which lists 107,165 terms. Each of the five laboratories, Argonne National Laboratory, the Inhalation Toxicology Research Institute, the Pacific Northwest Laboratory, the University of California at Davis, and the University of Utah, has selected an appropriate subset from the published SNOMED glossary and added beagle and research-specific terms. The National Radiobiology Archives is the coordinator of these enhancements, and periodically distributes SNODOG to the respective laboratories. Information donated by Colorado State University and Oak Ridge National Laboratory has been related to SNODOG and is available in a standardized format. This document is designed for the database manager and the scientist who will be managing or coding medical observations. It is also designed for the scientist analyzing coded information. The document includes: an overview of the NRA and the SNODOG glossary, a discussion of hardware requirements, a review of the SNODOG code structure and printed lists of the 4,770 terms which have been used at least once. Instructions for obtaining electronic copies of the glossary and for nominating additional terms are provided. This document describes the origins and structure of the SNODOG codes, explains code usage at each participating institution, and presents a usage frequency tabulation of the terms for neoplasia. A diskette or magnetic tape containing 15,641 SNODOG codes and translations is available on request.
The health terminology project glossaries` structure
Directory of Open Access Journals (Sweden)
Sátia Marini
2014-04-01
Full Text Available Current paper was motivated by a Master´s degree in Translation Studies on one of the glossaries of the Health Terminology Project (PTS of the Ministry of Health (MS inBrazil, by which the products developed by the project were analyzed. The authors would like to forward their experience earned from the development of these instruments and from the evolution of the glossary´s layout and structure. Although within the same institution, each instrument is made suitable to the specific purpose of each area and the terminology project accumulates experience by the constant improvement of previously developed glossaries (adding new terms; providing the equivalent word in other languages for terms already defined and by the establishment of new ones. The evolution of the structure of the glossaries was qualitatively analyzed; remarks on the types of cross references were made; a quantitative survey of their main features was undertaken. Finally, the importance of this type of work should be underscored either within the government, or in the academy or in private companies, for the sharing of intellectual knowledge.
IAEA safeguards glossary. 2001 ed
International Nuclear Information System (INIS)
2002-01-01
IAEA safeguards have evolved since their inception in the late 1960s. In 1980 the IAEA published the first IAEA Safeguards Glossary (IAEA/SG/INF/l) with the aim of facilitating understanding of the specialized safeguards terminology within the international community. In 1987 the IAEA published a revised edition of the Glossary (IAEA/SG/INF/l (Rev.l)) which took into account developments in the safeguards area as well as comments received since the first edition appeared. Since 1987, IAEA safeguards have become more effective and efficient, mainly through the series of strengthening measures approved by the IAEA Board of Governors during 1992-1997, the Board's approval, in 1997, of the Model Protocol Additional to the Agreement(s) between State(s) and the International Atomic Energy Agency for the Application of Safeguards (issued as INFCIRC/540 (Corrected)), and the work, begun in 1999, directed towards the development and implementation of integrated safeguards. The IAEA Safeguards Glossary 2001 Edition reflects these developments. Each of the 13 sections of the Glossary addresses a specific subject related to IAEA safeguards. To facilitate understanding. definitions and, where applicable, explanations have been given for each of the terms listed. The terms defined and explained intentionally have not been arranged in alphabetical order, but their sequence within each section corresponds to the internal relationships of the subject treated. The terms are numbered consecutively within each section and an index referring to these numbers has been provided for ease of reference. The terms used have been translated into the official languages of the IAEA, as well as into German and Japanese. The IAEA Safeguards Glossary 2001 Edition has no legal status and is not intended to serve as a basis for adjudicating on problems of definition such as might arise during the negotiation or in the interpretation of safeguards agreements or additional protocols. The IAEA
IAEA safeguards glossary. 2001 ed
Energy Technology Data Exchange (ETDEWEB)
NONE
2002-06-01
IAEA safeguards have evolved since their inception in the late 1960s. In 1980 the IAEA published the first IAEA Safeguards Glossary (IAEA/SG/INF/l) with the aim of facilitating understanding of the specialized safeguards terminology within the international community. In 1987 the IAEA published a revised edition of the Glossary (IAEA/SG/INF/l (Rev.l)) which took into account developments in the safeguards area as well as comments received since the first edition appeared. Since 1987, IAEA safeguards have become more effective and efficient, mainly through the series of strengthening measures approved by the IAEA Board of Governors during 1992-1997, the Board's approval, in 1997, of the Model Protocol Additional to the Agreement(s) between State(s) and the International Atomic Energy Agency for the Application of Safeguards (issued as INFCIRC/540 (Corrected)), and the work, begun in 1999, directed towards the development and implementation of integrated safeguards. The IAEA Safeguards Glossary 2001 Edition reflects these developments. Each of the 13 sections of the Glossary addresses a specific subject related to IAEA safeguards. To facilitate understanding. definitions and, where applicable, explanations have been given for each of the terms listed. The terms defined and explained intentionally have not been arranged in alphabetical order, but their sequence within each section corresponds to the internal relationships of the subject treated. The terms are numbered consecutively within each section and an index referring to these numbers has been provided for ease of reference. The terms used have been translated into the official languages of the IAEA, as well as into German and Japanese. The IAEA Safeguards Glossary 2001 Edition has no legal status and is not intended to serve as a basis for adjudicating on problems of definition such as might arise during the negotiation or in the interpretation of safeguards agreements or additional protocols. The IAEA
IAEA safeguards glossary. 2001 ed
Energy Technology Data Exchange (ETDEWEB)
NONE
2002-06-01
IAEA safeguards have evolved since their inception in the late 1960s. In 1980 the IAEA published the first IAEA Safeguards Glossary (IAEA/SG/INF/l) with the aim of facilitating understanding of the specialized safeguards terminology within the international community. In 1987 the IAEA published a revised edition of the Glossary (IAEA/SG/INF/l (Rev.l)) which took into account developments in the safeguards area as well as comments received since the first edition appeared. Since 1987, IAEA safeguards have become more effective and efficient, mainly through the series of strengthening measures approved by the IAEA Board of Governors during 1992-1997, the Board's approval, in 1997, of the Model Protocol Additional to the Agreement(s) between State(s) and the International Atomic Energy Agency for the Application of Safeguards (issued as INFCIRC/540 (Corrected)), and the work, begun in 1999, directed towards the development and implementation of integrated safeguards. The IAEA Safeguards Glossary 2001 Edition reflects these developments. Each of the 13 sections of the Glossary addresses a specific subject related to IAEA safeguards. To facilitate understanding. definitions and, where applicable, explanations have been given for each of the terms listed. The terms defined and explained intentionally have not been arranged in alphabetical order, but their sequence within each section corresponds to the internal relationships of the subject treated. The terms are numbered consecutively within each section and an index referring to these numbers has been provided for ease of reference. The terms used have been translated into the official languages of the IAEA, as well as into German and Japanese. The IAEA Safeguards Glossary 2001 Edition has no legal status and is not intended to serve as a basis for adjudicating on problems of definition such as might arise during the negotiation or in the interpretation of safeguards agreements or additional protocols. The IAEA
IAEA safeguards glossary. 2001 ed
International Nuclear Information System (INIS)
2002-01-01
IAEA safeguards have evolved since their inception in the late 1960s. In 1980 the IAEA published the first IAEA Safeguards Glossary (IAEA/SG/INF/l) with the aim of facilitating understanding of the specialized safeguards terminology within the international community. In 1987 the IAEA published a revised edition of the Glossary (IAEA/SG/INF/l (Rev.l)) which took into account developments in the safeguards area as well as comments received since the first edition appeared. Since 1987, IAEA safeguards have become more effective and efficient, mainly through the series of strengthening measures approved by the IAEA Board of Governors during 1992-1997, the Board's approval, in 1997, of the Model Protocol Additional to the Agreement(s) between State(s) and the International Atomic Energy Agency for the Application of Safeguards (issued as INFCIRC/540 (Corrected)), and the work, begun in 1999, directed towards the development and implementation of integrated safeguards. The IAEA Safeguards Glossary 2001 Edition reflects these developments. Each of the 13 sections of the Glossary addresses a specific subject related to IAEA safeguards. To facilitate understanding. definitions and, where applicable, explanations have been given for each of the terms listed. The terms defined and explained intentionally have not been arranged in alphabetical order, but their sequence within each section corresponds to the internal relationships of the subject treated. The terms are numbered consecutively within each section and an index referring to these numbers has been provided for ease of reference. The terms used have been translated into the official languages of the IAEA, as well as into German and Japanese. The IAEA Safeguards Glossary 2001 Edition has no legal status and is not intended to serve as a basis for adjudicating on problems of definition such as might arise during the negotiation or in the interpretation of safeguards agreements or additional protocols. The IAEA
Learning Vocabulary through Paper and Online-Based Glossary
Directory of Open Access Journals (Sweden)
Ratih Novita Sari
2017-08-01
Full Text Available This study examined the effect of teaching glossary and personality traits on vocabulary learning. Two groups of students who had different personality (extroverted and introverted were exposed to two types of glosses: paper and online-based glossary. The two groups underwent two-month treatment. Prior to and after the treatment, each group was given pre and posttest. In calculating the data, two-way ANOVA was used. The results of the study showed that extroverted students learned vocabulary better through paper-based glossary, while introverted students learned vocabulary better through online-based. Further research needs to be conducted to determine whether age influences the use of teaching glossary or not
... of the leg. Endemic: A disease that is native to a particular geographic region. Epidemiology: The study ... parasites/glossary.html) T Telediagnosis: The transmission of digital images captured from a clinical specimen and sent ...
A picture dictionary of electric glossary
International Nuclear Information System (INIS)
1974-01-01
This book has a lot of explanations on electric glossary with picture, which include basic important glossaries like nuclear, current theory, measuring, electro genesis, power transmission, supply of electric power, a rotary machine, application of electromotive force, electronic engineering, automatic control, electronic calculator, T.V and communication, material of electricity, electrochemistry, traffic, electric work, lighting and electric heater, regulations and standard.
A picture dictionary of electric glossary
Energy Technology Data Exchange (ETDEWEB)
NONE
1974-01-15
This book has a lot of explanations on electric glossary with picture, which include basic important glossaries like nuclear, current theory, measuring, electro genesis, power transmission, supply of electric power, a rotary machine, application of electromotive force, electronic engineering, automatic control, electronic calculator, T.V and communication, material of electricity, electrochemistry, traffic, electric work, lighting and electric heater, regulations and standard.
Update on Law-Related Education, 1997
1997-01-01
Presents a glossary of civil law terms originally compiled for journalists by the American Bar Association. Defines many essential civil law concepts and practices including compensatory damages, jurisdiction, motion to dismiss, discovery, and remedy. (MJP)
National Child Abuse and Neglect Data System Glossary
... navigation Search form Search « Back to Search National Child Abuse and Neglect Data System Glossary Published: March 31, ... This document is the glossary for the National Child Abuse and Neglect Data System (NCANDS), including terms from ...
2015-01-01
Sanskrit terms in bold are given according to the IAST (International Alphabet of Sanskrit Transliteration) transcription standard. The main reference used for this glossary is the Oxford Hindi-English Dictionary, edited by R. S. McGregor (Oxford: Oxford University Press, 2007). AgniAgni: the two-headed god of fire and the recipient of daily sacrifice as messenger of the gods. One of his heads signifies immortality, while the other is considered a symbol of life renewal. Ahimsaahiṃsā: “the av...
Capturing Cultural Glossaries: Case-study I *
Directory of Open Access Journals (Sweden)
Matete Madiba
2011-10-01
Full Text Available
Abstract: This article is a presentation of a brief cultural glossary of Northern Sotho cooking terms. The glossary is mainly composed of names for utensils and ingredients, and action words for the processes involved in the preparation of cultural dishes. It also contains names of dishes tied to some idiomatic expressions in a way eliciting cultural experiences that can lead to an under-standing of indigenous knowledge systems. The article seeks to explore ways of capturing cultural glossaries to feed into the national dictionary corpora by using a case-study approach to investigate the processes that led to the generation of this specific school-based project. A number of issues that surfaced in this project, can possibly serve as models for the collection of authentic glossaries that can support dictionary making in African languages.
Keywords: CULTURAL GLOSSARY, INDIGENOUS KNOWLEDGE SYSTEMS, CULTURAL TERMINOLOGY, CORPUS, AUTHENTIC GLOSSARY, CONTEXTUALISATION, MARGIN-ALIZED LANGUAGES, OUTCOMES-BASED EDUCATION, PERFORMANCE INDICATOR, ASSESSMENT CRITERIA, RANGE STATEMENT, TRADITIONAL DISHES, LANGUAGE VAL-ORISATION, SIMULTANEOUS FEEDBACK, COMMUNICATIVE APPROACH, STRUCTURAL APPROACH, METONYMY
Opsomming: Die totstandbrenging van kulturele woordversamelings: Ge-vallestudie I. Hierdie artikel is 'n aanbieding van 'n kort kulturele woordversameling van Noord-Sothokookterme. Die woordversameling bestaan hoofsaaklik uit die name van gereedskap en bestanddele, en handelingswoorde vir die prosesse betrokke by die voorbereiding van kulturele geregte. Dit bevat ook name van geregte wat verbind is met sekere idiomatiese uitdrukkings wat op 'n manier kulturele ervarings oproep wat kan lei tot die verstaan van inheemse kennisstelsels. Die artikel probeer om maniere te ondersoek waarop kulturele woordversamelings in die nasionale woordeboekkorpusse ingevoer kan word deur 'n gevallestudiebenadering te volg om die prosesse te ondersoek wat tot die
Glossary of nuclear power plant ageing
International Nuclear Information System (INIS)
1999-01-01
A glossary is presented of the terminology for understanding and managing the ageing of nuclear power plant systems, structures and components. This glossary has been published by NEA, in cooperation with CEC and IAEA, as a handy reference to facilitate and encourage use of common ageing terminology. The main benefits are improved reporting and interpretation of plant data on SSC degradation and failure, and improved interpretation and compliance with codes, regulations and standards related to nuclear plant ageing. The goal is to provide plant personnel with a common set of terms that have uniform, industry-wide meanings, and to facilitate discussion between experts from different countries. The glossary is in five languages: English, French, German, Spanish and Russian. In each language section terms are listed alphabetically, with sequential members which are repeated in the English section thus allowing cross-reference between al languages. (R.P.)
English/Russian and Russian/English glossary of physical protection terms
International Nuclear Information System (INIS)
Soo Hoo, M.S.
1995-07-01
This glossary was prepared in fulfillment of the Glossary Preparation Task identified in the Program Plan for providing Assistance to the Russian Federation in Nuclear Material Control and Accounting and Physical Protection. The Program Plan is part of the Cooperative Threat Reduction Program as provided for under House Resolution (H.R.) 3807 (Title II, as referenced under Public Law (P.L.) 102-229. The terms in this glossary were derived from physical protection training material prepared at Sandia. The training material, and thus refinements to the glossary, has undergone years of development in presentation to both domestic and international audiences. Also, Russian Colleagues and interpreters have reviewed the translations for accuracy
English/Russian and Russian/English glossary of physical protection terms
Energy Technology Data Exchange (ETDEWEB)
Soo Hoo, M.S. [ed.
1995-07-01
This glossary was prepared in fulfillment of the Glossary Preparation Task identified in the Program Plan for providing Assistance to the Russian Federation in Nuclear Material Control and Accounting and Physical Protection. The Program Plan is part of the Cooperative Threat Reduction Program as provided for under House Resolution (H.R.) 3807 (Title II, as referenced under Public Law (P.L.) 102-229. The terms in this glossary were derived from physical protection training material prepared at Sandia. The training material, and thus refinements to the glossary, has undergone years of development in presentation to both domestic and international audiences. Also, Russian Colleagues and interpreters have reviewed the translations for accuracy.
... more... Coffee and Doughnuts: A Disastrous Combo for Teeth? The sugars in doughnuts have been identified as ... More print this article enlarge text Glossary of Dental Terms Oral Health Defined Amalgam silver/mercury alloy ...
Energy Technology Data Exchange (ETDEWEB)
Schachowskoj, S.; Smith, H.A. Jr.
1995-05-01
The program plans for Former Soviet Union National Nuclear Materials Control and Accounting (MC and A) Systems Enhancements call for the development of an English/Russian Glossary of MC and A terminology. This glossary was envisioned as an outgrowth of the many interactions, training sessions, and other talking and writing exercises that would transpire in the course of carrying out these programs. This report summarizes the status of the production of this glossary, the most recent copy of which is attached to this report. The glossary contains over 950 terms and acronyms associated with nuclear material control and accounting for safeguards and nonproliferation. This document is organized as follows: English/Russian glossary of terms and acronyms; Russian/English glossary of terms and acronyms; English/Russian glossary of acronyms; and Russian/English glossary of acronyms.
Glossary of natural resource; Glossar zum Ressourcenschutz
Energy Technology Data Exchange (ETDEWEB)
Kosmol, Jan; Kanthak, Judit; Herrmann, Friederike; Golde, Michael; Alsleben, Carsten; Penn-Bressel, Gertrude; Schmitz, Stefan; Gromke, Ulrich
2012-01-15
The contribution under consideration presents the most important terms in a logical context, and distinguishes clearly between these technical terms. Thus, this contribution raises the profile of the scientific, political and public debate. The glossary is being developed by an interdisciplinary working group of the Federal Environment Agency (Dessau-Rosslau, Federal Republic of Germany) since 2009. In 2010, the glossary was co-ordinated with parts of the German scientific community.
... Us You are here Home » Glossary for Kids BEHAVIOR MODIFICATION: If you use a "moisture alarm", a small ... you start to pee is one example of BEHAVIOR MODIFICATION. BIOFEEDBACK: A device is attached to your body ...
Capturing Cultural Glossaries: Case-study I * | Madib | Lexikos
African Journals Online (AJOL)
This article is a presentation of a brief cultural glossary of Northern Sotho cooking terms. The glossary is mainly composed of names for utensils and ingredients, and action words for the processes involved in the preparation of cultural dishes. It also contains names of dishes tied to some idiomatic expressions in a way ...
Glossary of scientific and technical terms in atomic energy
International Nuclear Information System (INIS)
1986-01-01
In order to facilitate the task of Arabic speaking scientists in the field of nuclear energy, the Atomic Energy Commission of Syria assigned a committee constituted of leading physicists and chemists at Damascus University, the aim of the commission was to include the Arabic equivalent of the terms cited in English, French, Russian and Spanish in the glossary published by the United Nations, 1958 ''Atomic Energy Glossary of Technical Terms.'' The result of the committee's work was this glossary containing approximately 6000 terms in the field of nuclear energy which are given in Arabic, English, French, Russian and Spanish
International Nuclear Information System (INIS)
Metcalfe, N.; Shanks, T.; Fong, R.; Jones, L.R.
1991-01-01
Using the Prime Focus CCD Camera at the Isaac Newton Telescope we have determined the form of the B and R galaxy number-magnitude count relations in 12 independent fields for 21 m ccd m and 19 m ccd m 5. The average galaxy count relations lie in the middle of the wide range previously encompassed by photographic data. The field-to-field variation of the counts is small enough to define the faint (B m 5) galaxy count to ±10 per cent and this variation is consistent with that expected from galaxy clustering considerations. Our new data confirm that the B, and also the R, galaxy counts show evidence for strong galaxy luminosity evolution, and that the majority of the evolving galaxies are of moderately blue colour. (author)
Cogeneration handbook for the textile industry. [Contains glossary
Energy Technology Data Exchange (ETDEWEB)
Garrett-Price, B.A.; Fassbender, L.L.; Moore, N.L.; Fassbender, A.G.; Eakin, D.E.; Gorges, H.A.
1984-03-01
The decision of whether to cogenerate involves several considerations, including technical, economic, environmental, legal, and regulatory issues. Each of these issues is addressed separately in this handbook. In addition, a chapter is included on preparing a three-phase work statement, which is needed to guide the design of a cogeneration system. In addition, an annotated bibliography and a glossary of terminology are provided. Appendix A provides an energy-use profile of the textile industry. Appendices B through O provide specific information that will be called out in subsequent chapters.
Glossary of Organization Development Terminology.
Krepner-Tregoe and Associates, Inc., Princeton, NJ.
Ranging from Action Sequence to Zero Defects, this Kepner-Tregoe glossary defines 194 terms (including some specifically Kepner-Tregoe) relevant to the fields of management development, organization development, and industrial training. (LY)
17 CFR 275.203(b)(3)-2 - Methods for counting clients in certain private funds.
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Methods for counting clients....203(b)(3)-2 Methods for counting clients in certain private funds. (a) For purposes of section 203(b)(3) of the Act (15 U.S.C. 80b-3(b)(3)), you must count as clients the shareholders, limited partners...
Glossary on agricultural landscapes.
Kruse, A.; Centeri, C.; Renes, J.; Roth, M.; Printsman, A.; Palang, H.; Benito Jorda, M.-D.; Verlarde, M.D.; Kruckenberg, H.
2010-01-01
T he following glossary of terms related to the European agricultural landscape shall serve as a common basis for all parties, working in or on agricultural landscapes. Some of the terms are quite common and sometimes used in our every day language, but they often have different meanings in
WikiHyperGlossary (WHG): an information literacy technology for chemistry documents.
Bauer, Michael A; Berleant, Daniel; Cornell, Andrew P; Belford, Robert E
2015-01-01
The WikiHyperGlossary is an information literacy technology that was created to enhance reading comprehension of documents by connecting them to socially generated multimedia definitions as well as semantically relevant data. The WikiHyperGlossary enhances reading comprehension by using the lexicon of a discipline to generate dynamic links in a document to external resources that can provide implicit information the document did not explicitly provide. Currently, the most common method to acquire additional information when reading a document is to access a search engine and browse the web. This may lead to skimming of multiple documents with the novice actually never returning to the original document of interest. The WikiHyperGlossary automatically brings information to the user within the current document they are reading, enhancing the potential for deeper document understanding. The WikiHyperGlossary allows users to submit a web URL or text to be processed against a chosen lexicon, returning the document with tagged terms. The selection of a tagged term results in the appearance of the WikiHyperGlossary Portlet containing a definition, and depending on the type of word, tabs to additional information and resources. Current types of content include multimedia enhanced definitions, ChemSpider query results, 3D molecular structures, and 2D editable structures connected to ChemSpider queries. Existing glossaries can be bulk uploaded, locked for editing and associated with multiple social generated definitions. The WikiHyperGlossary leverages both social and semantic web technologies to bring relevant information to a document. This can not only aid reading comprehension, but increases the users' ability to obtain additional information within the document. We have demonstrated a molecular editor enabled knowledge framework that can result in a semantic web inductive reasoning process, and integration of the WikiHyperGlossary into other software technologies, like
Flowers, Nancy
1998-01-01
Presents a human rights glossary that includes definitions of basic terms, treaties, charters, and groups/organizations that have been featured in previous articles in this edition of "Update on Law-Related Education"; the human rights terms have been compiled as part of the celebration of the Universal Declaration of Human Rights…
Cogeneration handbook for the food processing industry. [Contains glossary
Energy Technology Data Exchange (ETDEWEB)
Eakin, D.E.; Fassbender, L.L.; Garrett-Price, B.A.; Moore, N.L.; Fasbender, A.G.; Gorges, H.A.
1984-03-01
The decision of whether to cogenerate involves several considerations, including technical, economic, environmental, legal, and regulatory issues. Each of these issues is addressed separately in this handbook. In addition, a chapter is included on preparing a three-phase work statement, which is needed to guide the design of a cogeneration system. In addition, an annotated bibliography and a glossary of terminology are provided. Appendix A provides an energy-use profile of the food processing industry. Appendices B through O provide specific information that will be called out in subsequent chapters.
78 FR 77487 - Renewal of Agency Information Collection for IDEIA Part B and C Child Count
2013-12-23
... Education Improvement Act (IDEIA) Part B and C Child Count authorized by OMB Control Number 1076-0176. This... for special education and related services for Indian children aged 0 to 5 with disabilities on... children aged 0 to 2 covered by IDEIA Part C. In IDEIA Part B--Assistance for Education of All Children...
A glossary of electronics and microelectronics
International Nuclear Information System (INIS)
Sautter, D.; Weinerth, H.
1990-01-01
The glossary presents terms, definitions and full-text explanations of terminology used in the following subject fields: semiconductor technology, integrated analog and digital semiconductor devices and group of devices, discrete devices including power semiconductors, electronic tubes, electronic display or read-out systems (cathode-ray tubes, liquid crystals, luminescence diodes, plasma- and magneto-optical display devices), sensors, opto-electronics (lasers, integrated optical systems, glass fibre technology, opto-electronic switches), design and circuitry, electromechanical devices; and also terminology from the fields of: solid state physics, acoustics, technical reliability, measuring and testing, entertainment electronics, electrical and magnetic materials, electronic image recording and image processing. There are over 2000 terms and corresponding explanations in the glossary, supplemented by numerous functional diagrams, tables, and figures. (orig./HP) [de
International Nuclear Information System (INIS)
Schmidt, J.O.; Palgaard, L.; Gwozdz, R.; Belhage, L.O.
1984-01-01
For the simultaneous determination of Li, B, and F, the application of rapid instrument neutron activation analysis was studied using 1.5s of irradiation and β-particle counting of 8 Li, 12 B, and 20 F. The fast transfer facility, Mach-1, the counting equipment, a 4-channel multiplexer, and a time-base controller are discussed. Further, the technique of simultaneous decay curve analysis of three successive decays is presented and quality control by residual analysis is demonstrated. Finally, analytical results are presented of the NBS-environmental standards Coal-1632a and Coal-1635, and of three BCR-coals intended as references materials
IAEA safety glossary. Terminology used in nuclear safety and radiation protection. 2007 ed
International Nuclear Information System (INIS)
2007-01-01
In developing and establishing standards of safety for protecting people and the environment from harmful effects of ionizing radiation and for the safety of facilities and activities that give rise to radiation risks, clear communication on scientific and technical concepts is essential. The principles, requirements and recommendations that are established and explained in the IAEA's safety standards and elaborated upon in other publications must be clearly expressed. To this end, this Safety Glossary defines and explains technical terms used in IAEA safety standards and other safety related publications, and provides information on their usage. The primary purpose of the Safety Glossary is to harmonize terminology and usage in the IAEA safety standards for protecting people and the environment from harmful effects of ionizing radiation, and in their application. Once definitions of terms have been established, they are, in general, intended to be observed in safety standards and other safety related publications and in the work of the IAEA Department of Nuclear Safety and Security generally. The achievement of consistently high quality in its publications contributes to the authority and credibility of the IAEA, and thus to its influence and effectiveness. High quality in publications and documents is achieved not only by review to ensure that the relevant requirements are met, but also by managing their preparation so as to achieve high quality in their drafting. The Safety Glossary provides guidance primarily for the drafters and reviewers of safety standards, including IAEA technical officers and consultants and bodies for the endorsement of safety standards. The Safety Glossary is also a source of information for users of IAEA safety standards and other safety and security related IAEA publications and for other IAEA staff - notably writers, editors, translators, revisers and interpreters. Users of the Safety Glossary, in particular drafters of national
IAEA safety glossary. Terminology used in nuclear safety and radiation protection. 2007 ed
International Nuclear Information System (INIS)
2007-06-01
In developing and establishing standards of safety for protecting people and the environment from harmful effects of ionizing radiation and for the safety of facilities and activities that give rise to radiation risks, clear communication on scientific and technical concepts is essential. The principles, requirements and recommendations that are established and explained in the IAEA's safety standards and elaborated upon in other publications must be clearly expressed. To this end, this Safety Glossary defines and explains technical terms used in IAEA safety standards and other safety related publications, and provides information on their usage. The primary purpose of the Safety Glossary is to harmonize terminology and usage in the IAEA safety standards for protecting people and the environment from harmful effects of ionizing radiation, and in their application. Once definitions of terms have been established, they are, in general, intended to be observed in safety standards and other safety related publications and in the work of the IAEA Department of Nuclear Safety and Security generally. The achievement of consistently high quality in its publications contributes to the authority and credibility of the IAEA, and thus to its influence and effectiveness. High quality in publications and documents is achieved not only by review to ensure that the relevant requirements are met, but also by managing their preparation so as to achieve high quality in their drafting. The Safety Glossary provides guidance primarily for the drafters and reviewers of safety standards, including IAEA technical officers and consultants and bodies for the endorsement of safety standards. The Safety Glossary is also a source of information for users of IAEA safety standards and other safety and security related IAEA publications and for other IAEA staff - notably writers, editors, translators, revisers and interpreters. Users of the Safety Glossary, in particular drafters of national
IAEA safety glossary. Terminology used in nuclear safety and radiation protection. 2007 ed
International Nuclear Information System (INIS)
2007-01-01
In developing and establishing standards of safety for protecting people and the environment from harmful effects of ionizing radiation and for the safety of facilities and activities that give rise to radiation risks, clear communication on scientific and technical concepts is essential. The principles, requirements and recommendations that are established and explained in the IAA's safety standards and elaborated upon in other publications must be clearly expressed. To this end, this Safety Glossary defines and explains technical terms used in IAEA safety standards and other safety related publications, and provides information on their usage. The primary purpose of the Safety Glossary is to harmonize terminology and usage in the IAEA safety standards for protecting people and the environment from harmful effects of ionizing radiation, and in their application. Once definitions of terms have been established, they are, in general, intended to be observed in safety standards and other safety related publications and in the work of the IAEA Department of Nuclear Safety and Security generally. The achievement of consistently high quality in its publications contributes to the authority and credibility of the IAEA, and thus to its influence and effectiveness. High quality in publications and documents is achieved not only by review to ensure that the relevant requirements are met, but also by managing their preparation so as to achieve high quality in their drafting. The Safety Glossary provides guidance primarily for the drafters and reviewers of safety standards, including IAEA technical officers and consultants and bodies for the endorsement of safety standards. The Safety Glossary is also a source of information for users of IAEA safety standards and other safety and security related IAEA publications and for other IAEA staff - notably writers, editors, translators, revisers and interpreters. Users of the Safety Glossary, in particular drafters of national
Glossary of CERCLA, RCRA and TSCA related terms and acronyms
International Nuclear Information System (INIS)
1993-10-01
This glossary contains CERCLA, RCRA and TSCA related terms that are most often encountered in the US Department of Energy (DOE) Environmental Restoration and Emergency Preparedness activities. Detailed definitions are included for key terms. The CERCLA definitions included in this glossary are taken from the Comprehensive Environmental Response, Compensation and Liability Act (CERCLA), as amended and related federal rulemakings. The RCRA definitions included in this glossary are taken from the Resource Conservation and Recovery Act (RCRA) and related federal rulemakings. The TSCA definitions included in this glossary are taken from the Toxic Substances and Control Act (TSCA) and related federal rulemakings. Definitions related to TSCA are limited to those sections in the statute and regulations concerning PCBs and asbestos.Other sources for definitions include additional federal rulemakings, assorted guidance documents prepared by the US Environmental Protection Agency (EPA), guidance and informational documents prepared by the US Department of Energy (DOE), and DOE Orders. The source of each term is noted beside the term. Terms presented in this document reflect revised and new definitions published before July 1, 1993
Glossary of CERCLA-related terms and acronyms
International Nuclear Information System (INIS)
1991-10-01
This glossary contains CERCLA-related terms that are most often encountered in the US Department of Energy (DOE) Environmental Restoration and Emergency Preparedness activities. Detailed definitions are included for key terms. The definitions included in this glossary are taken from the Comprehensive Environmental Response, Compensation and Liability Act (CERCLA), as amended, related federal rulemakings (e.g., 40 CFR 300, National Oil and Hazardous Substances Pollution Contingency Plan), assorted guidance documents prepared by the US Environmental Protection Agency (EPA), and DOE Order 5400.4. The source of each term is noted after the term. Terms presented in this document reflect revised and new definitions published before June 1, 1991. 20 refs
Glossary on peaceful nuclear explosions terms
International Nuclear Information System (INIS)
1980-01-01
The report presents a glossary of terms in the area of peaceful nuclear explosions. The terms are in English, French, Russian and Spanish with cross-references for the corresponding terms of the other languages
International Nuclear Information System (INIS)
1980-01-01
An unambiguous definition and rationalization of many of the terms for the purpose of IAEA safeguards are given, with a view to improving the common understanding of such terms within the international community. The glossary focuses only on safeguards meanings in general, and IAEA meanings in particular, of the terms discussed. Terms belong to the following problems: nuclear and non-nuclear material, nuclear equipment, design of the safeguards approach, nuclear material accountancy, physical standards, sampling, measurements, statistical concepts and others
Energy & Conservation Glossary. Third Edition.
Amend, John; And Others
Defined in this glossary are nearly 800 terms related to energy and conservation. Space provided at the end of each alphabetic section allows users to add new words and definitions. This publication is part of a set of resources prepared for teachers by "Energy and Man's Environment." (Author/WB)
[A glossary for health care promoting universities (an HPU glossary)].
Bravo-Valenzuela, Paulina; Cabieses, Báltica; Zuzulich, María S; Muñoz, Mónica; Ojeda, Minerva
2013-01-01
The health promotion in the university context emerges as an important initiative to facilitate the development of healthy lifestyle behaviors in this environment where students, faculty and university staff spend and share a significant part of their lives. The movement of Health Promoting Universities (HPU) has over 20 years of experience, but still lacks a common language that allows effective communication between those who are interested in its planning and implementation. The purpose of this paper is to develop the most relevant concepts in the context of the international movement of UPS. This document is organized into five anchor dimensions: [1]The university and health promotion, [2] The University and its social responsibility, [3] The University, inequality and inequity, [4] The University and evidence in health promotion, and [5] Strategies to develop a HPU. It is hoped that this glossary for HPU encourages the development of a common language between those who promote this initiative and come from different disciplines, and at the same time serve as a guide for practice.
International Nuclear Information System (INIS)
1980-01-01
This glossary (of about 400 terms) has been compiled to help people outside the atomic energy industry to understand what those inside it are saying. It is not intended to be a definitive dictionary of scientific or technical terms, nor does it aim to cover terms that are in general use in science and technology. A list of some initials and acronyms is appended. (author)
The European Society for Medical Oncology (ESMO) Precision Medicine Glossary.
Yates, L R; Seoane, J; Le Tourneau, C; Siu, L L; Marais, R; Michiels, S; Soria, J C; Campbell, P; Normanno, N; Scarpa, A; Reis-Filho, J S; Rodon, J; Swanton, C; Andre, F
2018-01-01
Precision medicine is rapidly evolving within the field of oncology and has brought many new concepts and terminologies that are often poorly defined when first introduced, which may subsequently lead to miscommunication within the oncology community. The European Society for Medical Oncology (ESMO) recognises these challenges and is committed to support the adoption of precision medicine in oncology. To add clarity to the language used by oncologists and basic scientists within the context of precision medicine, the ESMO Translational Research and Personalised Medicine Working Group has developed a standardised glossary of relevant terms. Relevant terms for inclusion in the glossary were identified via an ESMO member survey conducted in Autumn 2016, and by the ESMO Translational Research and Personalised Medicine Working Group members. Each term was defined by experts in the field, discussed and, if necessary, modified by the Working Group before reaching consensus approval. A literature search was carried out to determine which of the terms, 'precision medicine' and 'personalised medicine', is most appropriate to describe this field. A total of 43 terms are included in the glossary, grouped into five main themes-(i) mechanisms of decision, (ii) characteristics of molecular alterations, (iii) tumour characteristics, (iv) clinical trials and statistics and (v) new research tools. The glossary classes 'precision medicine' or 'personalised medicine' as technically interchangeable but the term 'precision medicine' is favoured as it more accurately reflects the highly precise nature of new technologies that permit base pair resolution dissection of cancer genomes and is less likely to be misinterpreted. The ESMO Precision Medicine Glossary provides a resource to facilitate consistent communication in this field by clarifying and raising awareness of the language employed in cancer research and oncology practice. The glossary will be a dynamic entity, undergoing
Cogeneration handbook for the pulp and paper industry. [Contains glossary
Energy Technology Data Exchange (ETDEWEB)
Griffin, E.A.; Moore, N.L.; Fassbender, L.L.; Garrett-Price, B.A.; Fassbender, A.G.; Eakin, D.E.; Gorges, H.A.
1984-03-01
The decision of whether to cogenerate involves several considerations, including technical, economic, environmental, legal, and regulatory issues. Each of these issues is addressed separately in this handbook. In addition, a chapter is included on preparing a three-phase work statement, which is needed to guide the design of a cogeneration system. In addition, an annotated bibliography and a glossary of terminology are provided. Appendix A provides an energy-use profile of the pulp and paper industry. Appendices B and O provide specific information that will be called out in subsequent chapters.
Glossary for econometrics and epidemiology.
Gunasekara, F Imlach; Carter, K; Blakely, T
2008-10-01
Epidemiologists and econometricians are often interested in similar topics-socioeconomic position and health outcomes-but the different languages that epidemiologists and economists use to interpret and discuss their results can create a barrier to mutual communication. This glossary defines key terms used in econometrics and epidemiology to assist in bridging this gap.
International Nuclear Information System (INIS)
1982-04-01
This glossary, containing almost 400 terms, has been compiled to help people outside the atomic energy industry to understand what those inside it are saying. It is not intended to be a definitive dictionary of scientific or technical terms, nor does it aim to cover terms that are in general use in science and technology. A list of about 100 initials and acronyms will be found at the end. (author)
A guide and glossary on post-positivist theory building for population health.
Carpiano, R M; Daley, Dorothy M
2006-07-01
This guide and glossary focuses on the role of theory and conceptual models within population health research. Upon discussing the critical need for theory in conducting interdisciplinary research, it provides strategies for crafting theories that can be empirically tested and a glossary of theory building terms that are useful for guiding research. In addition to general concepts, the glossary includes some terminology commonly found in the social sciences, whose well established traditions and practices of formal theory building may be particularly informative for epidemiologists and other population health researchers who have minimal formal social science training, but study social factors in their research.
First Glossary of Modern Physics and Ionising Radiation Protection in Croatian
International Nuclear Information System (INIS)
Nodilo, M.; Petkovic, T.
2011-01-01
Motivation and encouragement for the Glossary were given as the research theme for the joint seminar between the Faculty of Electrical Engineering and Computing and Rudjer Boskovic Institute, within a postgraduate course subject ''Detectors and electronic instrumentation for particle physics''. A basic motivation is due to a lack of specialized literature in Croatian language in the field of protection of ionising radiation as well as the incompleteness of Croatian terminology in the same field. That is a general problem all over the World because the most glossaries are usually connected either with nuclear power plants or with an application of ionising radiation in medicine. On the other hand, a necessity for the specialized literature for radiation protection which follows a development of modern particle physics and its detection technique is rapidly growing up. A work and development on the Glossary were faced with serious difficulties, since various translations of foreign words and acronyms have already been used by various authors in Croatian literature. Different interpretations of the same term or concept, from diverse sources, had to be very often reconciled. However, the biggest challenge was finding proper Croatian words for the foreign terms, concepts, properties, and quantities which have not yet been commonly used so far in Croatian papers or/and Croatian legislative acts. According to our knowledge this seems to be the first comprehensive Glossary, describing the field of ionising radiation protection and bringing of 300 related entries (terms and guidelines). That is, certainly, the first characteristic Thesaurus in Croatian which includes background of modern physics and chemistry, particle phenomenology and its measurement, all dedicated to the radiological protection of workers, environment and people of the World. A Glossary brings a wide spectrum of terms of broad area of chemistry, radiation protection, nuclear and particle physics. A
Warden, Pete
2011-01-01
To help you navigate the large number of new data tools available, this guide describes 60 of the most recent innovations, from NoSQL databases and MapReduce approaches to machine learning and visualization tools. Descriptions are based on first-hand experience with these tools in a production environment. This handy glossary also includes a chapter of key terms that help define many of these tool categories: NoSQL Databases-Document-oriented databases using a key/value interface rather than SQLMapReduce-Tools that support distributed computing on large datasetsStorage-Technologies for stori
The International Glossary on Infertility and Fertility Care, 2017.
Zegers-Hochschild, Fernando; Adamson, G David; Dyer, Silke; Racowsky, Catherine; de Mouzon, Jacques; Sokol, Rebecca; Rienzi, Laura; Sunde, Arne; Schmidt, Lone; Cooke, Ian D; Simpson, Joe Leigh; van der Poel, Sheryl
2017-09-01
Can a consensus and evidence-driven set of terms and definitions be generated to be used globally in order to ensure consistency when reporting on infertility issues and fertility care interventions, as well as to harmonize communication among the medical and scientific communities, policy-makers, and lay public including individuals and couples experiencing fertility problems? A set of 283 consensus-based and evidence-driven terminologies used in infertility and fertility care has been generated through an inclusive consensus-based process with multiple stakeholders. In 2006 the International Committee for Monitoring Assisted Reproductive Technologies (ICMART) published a first glossary of 53 terms and definitions. In 2009 ICMART together with WHO published a revised version expanded to 87 terms, which defined infertility as a disease of the reproductive system, and increased standardization of fertility treatment terminology. Since 2009, limitations were identified in several areas and enhancements were suggested for the glossary, especially concerning male factor, demography, epidemiology and public health issues. Twenty-five professionals, from all parts of the world and representing their expertise in a variety of sub-specialties, were organized into five working groups: clinical definitions; outcome measurements; embryology laboratory; clinical and laboratory andrology; and epidemiology and public health. Assessment for revisions, as well as expansion on topics not covered by the previous glossary, were undertaken. A larger group of independent experts and representatives from collaborating organizations further discussed and assisted in refining all terms and definitions. Members of the working groups and glossary co-ordinators interacted through electronic mail and face-to-face in international/regional conferences. Two formal meetings were held in Geneva, Switzerland, with a final consensus meeting including independent experts as well as observers and
The International Glossary on Infertility and Fertility Care, 2017.
Zegers-Hochschild, Fernando; Adamson, G David; Dyer, Silke; Racowsky, Catherine; de Mouzon, Jacques; Sokol, Rebecca; Rienzi, Laura; Sunde, Arne; Schmidt, Lone; Cooke, Ian D; Simpson, Joe Leigh; van der Poel, Sheryl
2017-09-01
Can a consensus and evidence-driven set of terms and definitions be generated to be used globally in order to ensure consistency when reporting on infertility issues and fertility care interventions, as well as to harmonize communication among the medical and scientific communities, policy-makers, and lay public including individuals and couples experiencing fertility problems? A set of 283 consensus-based and evidence-driven terminologies used in infertility and fertility care has been generated through an inclusive consensus-based process with multiple stakeholders. In 2006 the International Committee for Monitoring Assisted Reproductive Technologies (ICMART) published a first glossary of 53 terms and definitions. In 2009 ICMART together with WHO published a revised version expanded to 87 terms, which defined infertility as a disease of the reproductive system, and increased standardization of fertility treatment terminology. Since 2009, limitations were identified in several areas and enhancements were suggested for the glossary, especially concerning male factor, demography, epidemiology and public health issues. Twenty-five professionals, from all parts of the world and representing their expertise in a variety of sub-specialties, were organized into five working groups: clinical definitions; outcome measurements; embryology laboratory; clinical and laboratory andrology; and epidemiology and public health. Assessment for revisions, as well as expansion on topics not covered by the previous glossary, were undertaken. A larger group of independent experts and representatives from collaborating organizations further discussed and assisted in refining all terms and definitions. Members of the working groups and glossary co-ordinators interacted through electronic mail and face-to-face in international/regional conferences. Two formal meetings were held in Geneva, Switzerland, with a final consensus meeting including independent experts as well as observers and
ALA glossary of library and information science
Levine-Clark, Michael
2013-01-01
This fourth edition of ALA Glossary of Library and Information Science presents a thorough yet concise guide to the specific words that describe the materials, processes and systems relevant to the field of librarianship.
BCS Glossary of Computing and ICT
Panel, BCS Education and Training Expert; Burkhardt, Diana; Cumming, Aline; Hunter, Alan; Hurvid, Frank; Jaworski, John; Ng, Thomas; Scheer, Marianne; Southall, John; Vella, Alfred
2008-01-01
A glossary of computing designed to support those taking computer courses or courses where computers are used, including GCSE, A-Level, ECDL and 14-19 Diplomas in Functional Skills, in schools and Further Education colleges. It helps the reader build up knowledge and understanding of computing.
Glossary of CERCLA, RCRA and TSCA related terms and acronyms. Environmental Guidance
Energy Technology Data Exchange (ETDEWEB)
1993-10-01
This glossary contains CERCLA, RCRA and TSCA related terms that are most often encountered in the US Department of Energy (DOE) Environmental Restoration and Emergency Preparedness activities. Detailed definitions are included for key terms. The CERCLA definitions included in this glossary are taken from the Comprehensive Environmental Response, Compensation and Liability Act (CERCLA), as amended and related federal rulemakings. The RCRA definitions included in this glossary are taken from the Resource Conservation and Recovery Act (RCRA) and related federal rulemakings. The TSCA definitions included in this glossary are taken from the Toxic Substances and Control Act (TSCA) and related federal rulemakings. Definitions related to TSCA are limited to those sections in the statute and regulations concerning PCBs and asbestos.Other sources for definitions include additional federal rulemakings, assorted guidance documents prepared by the US Environmental Protection Agency (EPA), guidance and informational documents prepared by the US Department of Energy (DOE), and DOE Orders. The source of each term is noted beside the term. Terms presented in this document reflect revised and new definitions published before July 1, 1993.
Glossary developed for the participants in the BIOMOVS 2 study
International Nuclear Information System (INIS)
1993-08-01
Terminology used in documents published within the BIOMOVS II study is defined in individual Technical and Progress reports and is the responsibility of the corresponding authors. However, as in other areas of scientific endeavour, there can be a tendency for terms to be used differently. This follows from the range of scientific disciplines involved. Therefore, this glossary of terms is offered to BIOMOVS II participants with a view to obtaining consistent usage and avoiding possible confusion. The definitions given have been provided and reviewed by BIOMOVS II participants. A list of other potentially relevant glossaries is also provided. It is acknowledged that some modifications to the definitions may be desirable when used for a specific task or document. Also additional terms may need to be added as time goes by. This document is itself an update of the glossary which was produced for use in BIOMOVS I . Thus, it is considered as a working document
Glossary developed for the participants in the BIOMOVS 2 study
Energy Technology Data Exchange (ETDEWEB)
NONE
1993-08-01
Terminology used in documents published within the BIOMOVS II study is defined in individual Technical and Progress reports and is the responsibility of the corresponding authors. However, as in other areas of scientific endeavour, there can be a tendency for terms to be used differently. This follows from the range of scientific disciplines involved. Therefore, this glossary of terms is offered to BIOMOVS II participants with a view to obtaining consistent usage and avoiding possible confusion. The definitions given have been provided and reviewed by BIOMOVS II participants. A list of other potentially relevant glossaries is also provided. It is acknowledged that some modifications to the definitions may be desirable when used for a specific task or document. Also additional terms may need to be added as time goes by. This document is itself an update of the glossary which was produced for use in BIOMOVS I . Thus, it is considered as a working document.
International Nuclear Information System (INIS)
1990-01-01
TNC 90 focuses on nuclear energy technology. Some more basic or less central terms which were included in the previous glossary, TNC 55, have not been included in this version. About 1200 definitions in swedish included together with translations to english, german and french. The terms have been listed in alphabetical order. To make it easier to look up a certain term or terms that stand for related concepts the terms have been systematically arranged in a special index. (L.E.)
Radiation protection glossary. Selected basic terms used in IAEA publications
Energy Technology Data Exchange (ETDEWEB)
1986-01-01
The glossary is intended to be used as a terminology standard for IAEA documentation on radiation protection. An effort has been made to use definitions contained in internationally accepted publications such as recommendations of the International Commission on Radiological Protection (ICRP), standards of the International Organization for Standardization (ISO) and of the International Electrotechnical Commission (IEC), reports of the International Commission on Radiation Units and Measurements (ICRU), with only slight modifications in order to tailor them more closely to IAEA needs. The glossary is restricted to ionizing radiation.
GLOSSARY TO READINGS IN HINDI LITERATURE.
Wisconsin Univ., Madison. Indian Language and Area Center.
INCLUDED IN THIS GLOSSARY ARE THE IMPORTANT VOCABULARY ITEMS WHICH APPEAR IN THE VOLUME OF READINGS. THESE ITEMS ARE ARRANGED BY SELECTION AND ARE IN SERIAL ORDER. THE LISTING INCLUDES THE DEVANAGARI FORM, AN ABBREVIATION OF THE FORM CLASS, AND A SHORT ENGLISH GLOSS. WHEN A NUMBER OF TRANSLATIONS ARE POSSIBLE, THE FIRST ONE GIVEN IS APPROPRIATE TO…
Group B Streptococcus and Pregnancy
... B Strep and Pregnancy • What is group B streptococcus (GBS)? • What does it mean to be colonized ... planned cesarean birth? •Glossary What is group B streptococcus (GBS)? Group B streptococcus is one of the ...
Star counts in M15 on U, B and V plates
Energy Technology Data Exchange (ETDEWEB)
Calvani, M [Padua Univ. (Italy). Ist. di Astronomia; Nobili, L [Padua Univ. (Italy). Ist. di Fisica; Turolla, R [Scuola Internazionale Superiore di Studi Avanzati, Trieste (Italy)
1980-11-01
We present new counts of stars in M15, using plates in B, V and U. We are able to explore relatively close to the central parts of the cluster (0.1 pc) and we derive the best fitting parameters for the star distribution.
17 CFR 404.5 - Securities counts by registered government securities brokers and dealers.
2010-04-01
... registered government securities brokers and dealers. 404.5 Section 404.5 Commodity and Securities Exchanges... AND PRESERVATION OF RECORDS § 404.5 Securities counts by registered government securities brokers and dealers. (a) Securities counts. Every registered government securities broker or dealer shall comply with...
MOSS-5: A Fast Method of Approximating Counts of 5-Node Graphlets in Large Graphs
Wang, Pinghui
2017-09-26
Counting 3-, 4-, and 5-node graphlets in graphs is important for graph mining applications such as discovering abnormal/evolution patterns in social and biology networks. In addition, it is recently widely used for computing similarities between graphs and graph classification applications such as protein function prediction and malware detection. However, it is challenging to compute these metrics for a large graph or a large set of graphs due to the combinatorial nature of the problem. Despite recent efforts in counting triangles (a 3-node graphlet) and 4-node graphlets, little attention has been paid to characterizing 5-node graphlets. In this paper, we develop a computationally efficient sampling method to estimate 5-node graphlet counts. We not only provide fast sampling methods and unbiased estimators of graphlet counts, but also derive simple yet exact formulas for the variances of the estimators which is of great value in practice-the variances can be used to bound the estimates\\' errors and determine the smallest necessary sampling budget for a desired accuracy. We conduct experiments on a variety of real-world datasets, and the results show that our method is several orders of magnitude faster than the state-of-the-art methods with the same accuracy.
Cherry, Ralph, Comp.
Designed to acquaint social workers and other professionals in the mental health field with the basic terms necessary for professional discussions, paper presentations, and international correspondence, the English/Spanish-Spanish/English glossary lists 130 selected mental health terms. The glossary includes two sections: English to Spanish and…
Computer surety: computer system inspection guidance. [Contains glossary
Energy Technology Data Exchange (ETDEWEB)
1981-07-01
This document discusses computer surety in NRC-licensed nuclear facilities from the perspective of physical protection inspectors. It gives background information and a glossary of computer terms, along with threats and computer vulnerabilities, methods used to harden computer elements, and computer audit controls.
Chung, Inyoung; Hah, Young-Sool; Ju, SunMi; Kim, Ji-Hye; Yoo, Woong-Sun; Cho, Hee-Young; Yoo, Ji-Myong; Seo, Seong-Wook; Choi, Wan-Sung; Kim, Seong-Jae
2017-07-01
Nuclear factor-kappa B (NF-κB) has been proposed as a therapeutic target for the treatment of cataracts. The authors investigated the relationship between nuclear factor of activated T cells 5 (NFAT5) and NF-κB in ultraviolet B (UVB)-irradiated human lens epithelial (HLE) cells. Human lens epithelial B-3 (HLE-B3) cells were exposed to UVB light at a dose of 10 mJ/cm 2 and then incubated for 24 h. Cell viability was assessed by using the Cell Counting Kit-8 (CCK-8) assay. Gene expression level of NFAT5 was determined using real-time quantitative polymerase chain reaction (qPCR). Protein expression levels of NFAT5, NF-κB p65, and α-smooth muscle actin (α-SMA) and the association of NFAT5 with the NF-κB p65 subunit were measured by Western blot analysis and a co-immunoprecipitation assay, respectively. The cellular distribution of NFAT5 and NF-κB p65 was examined by triple immunofluorescence staining. At 24 h after UVB exposure, cell viability significantly decreased in a dose-dependent manner, and UVB light (15 and 20 mJ/cm 2 ) significantly increased the ROS generation. UVB irradiation increased NFAT5 mRNA and protein levels and increased phosphorylation of NF-κB in HLE-B3 cells. α-SMA protein levels were increased in the irradiated cells. In addition, NFAT5 and NF-κB translocated from the cytoplasm to the nucleus, and binding between the p65 subunit and NFAT5 was increased. Exposure to UVB radiation induces nuclear translocation and stimulates binding between NFAT5 and NF-κB proteins in HLE-B3 cells. These interactions may form part of the biochemical mechanism of cataractogenesis in UVB-irradiated HLECs.
International Nuclear Information System (INIS)
Swindon, T.; Kennedy, K.N.; Elliott, G.
1983-06-01
A glossary of terms associated with radiological health is presented. It includes basic physics terms, quantities and units, radiological physics terms and radiation protection terms. The National Health and Medical Research Council has recommended that the glossary be used by organizations producing official documents and by appropriate regulatory authorities
ENGLISH / PIDGIN-ENGLISH (WES-KOS), PRELIMINARY GLOSSARY.
SCHNEIDER, GILBERT D.
THIS PRELIMINARY GLOSSARY OF ENGLISH / PIDGIN-ENGLISH (WES-KOS) HAS BEEN USED IN PEACE CORPS TRAINING PROGRAMS. WES-KOS (IN USE SINCE THE 18TH CENTURY) IS USED THROUGHOUT WEST AFRICA, HOWEVER THE GLOSSES IN THIS TEXT ARE THE COMMON CULTURAL-LINGUISTIC EQUIVALENTS USED IN WEST CAMEROON AND EASTERN NIGERIA. A BRIEF STATEMENT IS GIVEN IN THE…
Stakeholder Confidence and Radioactive Waste management - An annotated glossary of key terms
International Nuclear Information System (INIS)
Martell, Meritxell; Pescatore, Claudio; Mays, Claire
2013-01-01
The OECD Nuclear Energy Agency (NEA) Forum on Stakeholder Confidence (FSC) Annotated Glossary is a review of concepts central to societal decision making about radioactive waste management. It records the evolution in understanding that has taken place in the group as the FSC has worked with these concepts over time. This should be a useful resource not only for new FSC participants but also for others: this annotated glossary forms a good reference handbook for future texts regarding societal aspects of radioactive waste management and its governance. Each glossary entry is structured, to the extent possible, as follows: - The term and its variants, if any, in FSC literature are identified. - The common FSC understanding of the concept and any guidance are captured, based upon a review of all FSC documents to date. - Any evolution of the concept observed over the decade of FSC work is analysed. - The FSC interpretation of the symbolic dimension is explored. - The current status of outlook in the FSC, and intended activities according to the current Programme of Work (2010 and beyond) are assessed. Overall, although different persons and groups may assign different meanings to words, and although terminology will continue to evolve, this glossary is the FSC's 'state-of-the-art' guide to key terms in use. As such, it should prove to be a handy reference for all those interested in the governance of radioactive waste management
International Nuclear Information System (INIS)
2014-01-01
The RK and M glossary defines important concepts and terms that are commonly used. It is under continuous development by the project team and represents a peer-reviewed set of terms. It should be pointed out that some terms may be defined differently from other glossaries in science and technology. The RK and M glossary, however, fits the purpose of achieving a better understanding and more efficient communication of RK and M issues. The aim of the RK and M glossary is to compile a dedicated, internally consistent, and unambiguous set of definitions. Each definition should not be seen in isolation, but as complementary to the definition of other terms in the glossary
Glossary of terms used in ecotoxicology (IUPAC Recommendations 2009)
DEFF Research Database (Denmark)
Nordberg, Monika; Templeton, Douglas M.; Andersen, Ole
2009-01-01
The objective of the "Glossary of terms used in ecotoxicology" is to give clear definitions for those who contribute to studies relevant to ecotoxicology but are not themselves ecotoxicologists. This objective applies especially to chemists who need to understand the ecotoxicological literature w...
Peace Corps, Washington, DC. Information Collection and Exchange Div.
This glossary was developed to aid English-speaking health workers in Guatemala in translating health and nutrition terms from English to Spanish. Because Guatemala is renowned for its extensive vocabulary of "modismos", or slang, a column has been added to facilitate adaptation of the glossary to regional variations. The terms in the…
Maple syrup analysis for 137Cs, K, and B, using a low-background counting system and PGAA
International Nuclear Information System (INIS)
Anderson, D.L.; Cunningham, W.C.
1994-01-01
Fifteen maple syrups were analyzed for 137 Cs and K (via 40 K) by using a low-background γ-ray counting system, and for B and K by using neutron capture prompt γ-ray activation analysis (PGAA). For low-background γ-ray counting, 3 ο limits of detection (24-hour counts) were 0.03 Bq 137 Cs/kg and 10 mg K/kg for 3.5-L portions and 0.08 Bq 137 Cs/kg and 20 mg K/kg for 1.0-L portions. K concentrations determined by the two methods (using 2-g portions for PGAA) were in excellent agreement. The products were obtained in 1991, with one produced in Maryland, three in New York, four in Pennsylvania, two in New Hampshire, and five in Canada. The average activity concentration for Canadian syrups (2.8 Bq 137 Cs/kg) was nearly a factor 20 greater than the average (0.15 Bq 137 Cs/kg) for the other syrups, but all 137 Cs activity concentrations were at least 100 times lower than those for which controls would be recommended according to Federal Radiation Council guidance. The data exhibited distinct groupings related to the sources of the products when the ratios 137 Cs activity to K content (Bq Cs /mg K ) were plotted vs. B concentrations. (author). 15 refs., 3 figs., 1 tab
A glossary of terms for fast reactors
International Nuclear Information System (INIS)
Wheeler, R.C.
1979-04-01
The glossary aims to provide definitions of technical terms likely to be used in a fast reactor enquiry and to encourage the use of the same set of consistent terms in any documents intended for such an inquiry. In some cases definitions are formulated in the limited context of LMFBRS rather than applying to all types of reactors. A brief guide is presented to the different reactor types. (author)
Looking at Earth from space. Glossary of terms
1994-01-01
This glossary is one of a series of NASA publications designed to familiarize educators with global change issues and Mission to Planet Earth. The series enables teachers to enhance classroom studies with hands-on activities, including satellite images. Concepts and terms related to the global environment and the impact of human activities on the planet are presented.
The Compilation of Multilingual Concept Literacy Glossaries at the ...
African Journals Online (AJOL)
account for the multilingual concept literacy glossaries being compiled under the auspices of .... a theory, i.e. the set of premises, arguments and conclusions required for explaining ... fully address cognitive and communicative needs, especially of laypersons. ..... tion at UCT, and in indigenous languages as auxiliary media.
IDC Re-Engineering Phase 2 Glossary Version 1.3
Energy Technology Data Exchange (ETDEWEB)
Young, Christopher J. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Harris, James M. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)
2017-01-01
This document contains the glossary of terms used for the IDC Re-Engineering Phase 2 project. This version was created for Iteration E3. The IDC applies automatic processing methods in order to produce, archive, and distribute standard IDC products on behalf of all States Parties.
COGITA network has constructed a glossary of diagnostic reasoning terms.
Barais, Marie; Hauswaldt, Johannes; Dinant, Geert-Jan; van de Wiel, Margje; Stolper, C F Erik; Van Royen, Paul
2017-12-01
The role of gut feelings in diagnostic reasoning is recognized by most GPs throughout Europe, and probably throughout the world. Studies on this topic have emerged from different countries but there is the risk that authors will use different terms for similar concepts. The European Expert Group on Cognitive and Interactive Processes in Diagnosis and Management in General Practice, COGITA for short, was founded in 2008 to conduct cross-border research in the area of non-analytical diagnostic reasoning. Academic GPs, PhD students, psychologists, linguists and students meet once a year to share their experiences, exchange results and initiate new studies on the topic. A milestone in their research is this publication of a short glossary of diagnostic reasoning terms relating to the gut feelings research topic. It was constructed by the COGITA group members following a literature review, which aimed to define salient terms used in their publications. They described the terms, cross-reviewed the wording and reached consensus within the group. Two sections were created: (1) a diagnostic reasoning section that describes concepts such as analytical and non-analytical reasoning, clinical mind lines, and intuition, and (2) a research methods section describing concepts such as linguistic validity and saturation. The glossary, including relevant literature, has been published on the website http://www.gutfeelingsingeneralpractice.eu . In the future, the glossary will be modified if necessary and completed by members of the COGITA group. [Box: see text].
The Compilation of Multilingual Concept Literacy Glossaries at the ...
African Journals Online (AJOL)
In order to support concept literacy, especially for students for whom English is not the native language, a number of universities in South Africa are compiling multilingual glossaries through which the use of languages other than English may be employed as auxiliary media. Terminologies in languages other than English ...
Glossary of technical terms for the medical technology professionals.
Directory of Open Access Journals (Sweden)
Rafael Felipe García Rodríguez
2014-03-01
Full Text Available The current work is a glossary of technical terms in English language for Medical Health Professionals, has been prepared due to the lack of technical lexicon the students have during and after their university studies, that is, the students have a deficit of technical words which limits their professional competence and accountability. This shortage limits them and makes it a great laboring challenge if they have to work overseas in English-speaking countries. The glossary comprises the main and necessary words which are needed for this type of professional in their field of action. These graduates have a solid knowledge and comprehension of biological, biochemical and biophysical fundamentals in their mother tongue but they do not have the necessary elements in the target language to operate properly. It is a need that they can work appropriately in the spheres of prevention, promotion and health recovery to support a diagnosis, a treatment and a management not only in their mother tongue but in English for their future work.
MOSS-5: A Fast Method of Approximating Counts of 5-Node Graphlets in Large Graphs
Wang, Pinghui; Zhao, Junzhou; Zhang, Xiangliang; Li, Zhenguo; Cheng, Jiefeng; Lui, John C.S.; Towsley, Don; Tao, Jing; Guan, Xiaohong
2017-01-01
Counting 3-, 4-, and 5-node graphlets in graphs is important for graph mining applications such as discovering abnormal/evolution patterns in social and biology networks. In addition, it is recently widely used for computing similarities between
Electric Power Monthly, August 1990. [Glossary included
Energy Technology Data Exchange (ETDEWEB)
1990-11-29
The Electric Power Monthly (EPM) presents monthly summaries of electric utility statistics at the national, Census division, and State level. The purpose of this publication is to provide energy decisionmakers with accurate and timely information that may be used in forming various perspectives on electric issues that lie ahead. Data includes generation by energy source (coal, oil, gas, hydroelectric, and nuclear); generation by region; consumption of fossil fuels for power generation; sales of electric power, cost data; and unusual occurrences. A glossary is included.
Twenty years of social capital and health research: a glossary.
Moore, S; Kawachi, I
2017-05-01
Research on social capital in public health is approaching its 20th anniversary. Over this period, there have been rich and productive debates on the definition, measurement and importance of social capital for public health research and practice. As a result, the concepts and measures characterising social capital and health research have also evolved, often drawing from research in the social, political and behavioural sciences. The multidisciplinary adaptation of social capital-related concepts to study health has made it challenging for researchers to reach consensus on a common theoretical approach. This glossary thus aims to provide a general overview without recommending any particular approach. Based on our knowledge and research on social capital and health, we have selected key concepts and terms that have gained prominence over the last decade and complement an earlier glossary on social capital and health. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/.
Directory of Open Access Journals (Sweden)
Douglas C. Tozer
2017-12-01
Full Text Available The Standardized North American Marsh Bird Monitoring Protocol recommends point counts consisting of a 5-min passive observation period, meant to be free of broadcast bias, followed by call broadcasts to entice elusive species to reveal their presence. Prior to this protocol, some monitoring programs used point counts with broadcasts during the first 5 min of 10-min counts, and have since used 15-min counts with an initial 5-min passive period (P1 followed by 5 min of broadcasts (B and a second 5-min passive period (P2 to ensure consistency across years and programs. Influence of timing of broadcasts within point counts and point count duration, however, have rarely been assessed. Using data from 23,973 broadcast-assisted 15-min point counts conducted throughout the Great Lakes-St. Lawrence region between 2008 and 2016 by Bird Studies Canada's Marsh Monitoring Program and Central Michigan University's Great Lakes Coastal Wetland Monitoring Program, we estimated detection probabilities of individuals for 14 marsh breeding bird species during P1B compared to BP2, P1 compared to P2, and P1B compared to P1BP2. For six broadcast species and American Bittern (Botaurus lentiginosus, we found no significant difference in detection during P1B compared to BP2, and no significant difference in four of the same seven species during P1 compared to P2. We observed small but significant differences in detection for 7 of 14 species during P1B compared to P1BP2. We conclude that differences in timing of broadcasts causes no bias based on counts from entire 10-minute surveys, although P1B should be favored over BP2 because the same amount of effort in P1B avoids broadcast bias in all broadcast species, and 10-min surveys are superior to 15-min surveys because modest gains in detection of some species does not warrant the additional effort. We recommend point counts consisting of 5 min of passive observation followed by broadcasts, consistent with the standardized
Specific terms glossary for subjects taught in Physical Culture first year career
Directory of Open Access Journals (Sweden)
Ana Isel Rodríguez Cruz
2016-08-01
Full Text Available Contents comprehension is an important element in the learning process; present didactic ways demand from teaching styles that favor communicative competence in the students. Taking into account the relevance of this topic in the teaching learning process it was decided to develop the present work, which has the objective to offer the students a tool that allow them an efficient comprehension of the contents they receive in the Physical Culture first year career subjects. To fulfil the goal a glossary with specific terms of basketball, chess, swimming, athletics, basic gymnastics, and morphology was designed starting from the results of the initial diagnosis, the scientific observation, as well as the detail revision of the normative documents that rule Communicative Spanish subject. The glossary use favor the students´ texts comprehension development from the mentioned subject.
Solar Energy Education. Reader, Part II. Sun story. [Includes glossary
Energy Technology Data Exchange (ETDEWEB)
1981-05-01
Magazine articles which focus on the subject of solar energy are presented. The booklet prepared is the second of a four part series of the Solar Energy Reader. Excerpts from the magazines include the history of solar energy, mythology and tales, and selected poetry on the sun. A glossary of energy related terms is included. (BCS)
A glossary of terms in measuring and automation engineering
International Nuclear Information System (INIS)
Schruefer, E.
1992-01-01
This German-language glossary has been compiled by cooperative work of more than sixty authors. It contains 1800 terms and their definitions relating to measuring engineering, sensor science and engineering, testing engineering, display and read-out techniques, physical quantities, control systems, fundamentals of control engineering, engineered reliability, process control engineering, robot technology, artificial intelligence and expert systems, simulation and modelling, navigation, electronic and electromechanical components, and microtechnology. (RHM) [de
An Analytic Glossary to Social Inquiry Using Institutional and Political Activist Ethnography
Directory of Open Access Journals (Sweden)
Laura Bisaillon PhD
2012-12-01
Full Text Available This analytic glossary, composed of 52 terms, is a practical reference and working tool for persons preparing to conduct theoretically informed qualitative social science research drawing from institutional and political activist ethnography. Researchers using these approaches examine social problems and move beyond interpretation by explicating how these problems are organized and what social and ruling relations coordinate them. Political activist ethnography emerges from, and extends, institutional ethnography by producing knowledge explicitly for activism and social movement organizing ends. The assemblage of vocabulary and ideas in this word list are new, and build on existing methodological resources. This glossary offers an extensive, analytic, and challenging inventory of language that brings together terms from these ethnographic approaches with shared ancestry. This compilation is designed to serve as an accessible “one-stop-shop” resource for persons using or contemplating using institutional and political activist ethnography in their research and/or activist projects.
The ionization quench factor in liquid-scintillation counting standardizations
Grau-Malonda, A
1999-01-01
We present a new detailed analysis of the ionization quench function Q(E) used in calculating the counting efficiency in liquid-scintillation counting (LSC), which shows that Q(0)=1, and permits one to derive Q(E) as a function of the electron energy and the parameter kB. The coefficients are tabulated by applying a new empirical formula of Q(E) for kB values in the range between 0.001 and 0.20 gMeV sup - sup 1 cm sup - sup 2. We demonstrate the convenience of applying sup 3 H and sup 5 sup 4 Mn for beta-ray and electron capture standardizations, respectively.
A comprehensive glossary of autophagy-related molecules and processes (2nd edition)
DEFF Research Database (Denmark)
Klionsky, Daniel J; Baehrecke, Eric H; Brumell, John H
2011-01-01
for readers--even those who work in the field--to keep up with the ever-expanding terminology associated with the various autophagy-related processes. Accordingly, we have developed a comprehensive glossary of autophagy-related terms that is meant to provide a quick reference for researchers who need a brief...
Optimizing the calculation of point source count-centroid in pixel size measurement
International Nuclear Information System (INIS)
Zhou Luyi; Kuang Anren; Su Xianyu
2004-01-01
Pixel size is an important parameter of gamma camera and SPECT. A number of methods are used for its accurate measurement. In the original count-centroid method, where the image of a point source (PS) is acquired and its count-centroid calculated to represent PS position in the image, background counts are inevitable. Thus the measured count-centroid (X m ) is an approximation of the true count-centroid (X p ) of the PS, i.e. X m =X p + (X b -X p )/(1+R p /R b ), where Rp is the net counting rate of the PS, X b the background count-centroid and Rb the background counting. To get accurate measurement, R p must be very big, which is unpractical, resulting in the variation of measured pixel size. R p -independent calculation of PS count-centroid is desired. Methods: The proposed method attempted to eliminate the effect of the term (X b -X p )/(1 + R p /R b ) by bringing X b closer to X p and by reducing R b . In the acquired PS image, a circular ROI was generated to enclose the PS, the pixel with the maximum count being the center of the ROI. To choose the diameter (D) of the ROI, a Gaussian count distribution was assumed for the PS, accordingly, K=1-(0.5) D/R percent of the total PS counts was in the ROI, R being the full width at half maximum of the PS count distribution. D was set to be 6*R to enclose most (K=98.4%) of the PS counts. The count-centroid of the ROI was calculated to represent X p . The proposed method was tested in measuring the pixel size of a well-tuned SPECT, whose pixel size was estimated to be 3.02 mm according to its mechanical and electronic setting (128 x 128 matrix, 387 mm UFOV, ZOOM=1). For comparison, the original method, which was use in the former versions of some commercial SPECT software, was also tested. 12 PSs were prepared and their image acquired and stored. The net counting rate of the PSs increased from 10 cps to 1183 cps. Results: Using the proposed method, the measured pixel size (in mm) varied only between 3.00 and 3.01 (mean
Sacco, James C; Trepanier, Lauren A
2010-01-01
NADH cytochrome b5 reductase (b5R) and cytochrome b5 (b5) catalyze the reduction of sulfamethoxazole hydroxylamine (SMX-HA), which can contribute to sulfonamide hypersensitivity, to the parent drug sulfamethoxazole. Variability in hydroxylamine reduction could thus play a role in adverse drug reactions. The aim of this study was to characterize variability in SMX-HA reduction in 111 human livers, and investigate its association with single nucleotide polymorphisms (SNPs) in b5 and b5R cDNA. Liver microsomes were assayed for SMX-HA reduction activity, and b5 and b5R expression was semiquantified by immunoblotting. The coding regions of the b5 (CYB5A) and b5R (CYB5R3) genes were resequenced. Hepatic SMX-HA reduction displayed a 19-fold range of individual variability (0.06-1.11 nmol/min/mg protein), and a 17-fold range in efficiency (Vmax/Km) among outliers. SMX-HA reduction was positively correlated with b5 and b5R protein content (Phydroxylamine reduction activities, these low-frequency cSNPs seem to only minimally impact overall observed phenotypic variability. Work is underway to characterize polymorphisms in other regions of these genes to further account for individual variability in hydroxylamine reduction.
International Nuclear Information System (INIS)
Pluzanska, A.; Robak, T.; Kuchowicz, W.; Bartuzel, T.; Studencki, E.; Zadrozna, O.; Mazurowa, A.
1977-01-01
In 20 women with cervical carcinoma the T and B lymphocyte counts were determined in peripheral blood. The determinations were carried out before starting treatment and immediately after radium therapy in a mean dose of 6573 mgh and then after full therapeutic dose of cobalt-60 radiation of 4000 R. For identification of T lymphocytes the rosette E test was used and lymphocytes B were identified by means of the EAC rosette test. Presence of immunoglobulins on lymphocytes B was determined as well. In women with cervical carcinoma the total lymphocyte count in 1 mm 3 of blood, the proportions and absolute counts of T and B lymphocytes were not different from those in healthy women. Immediately after radium therapy the lymphocyte count in peripheral blood fell which was due mainly to a fall of the total count and in the proportion of B lymphocytes. The proportion of lymphocytes T was unchanged and their quantitative fall was statistically not significant. After application of the total therapeutic dose of cobalt-60 radiation a further fall of lymphocyte count was observed, due to a fall of the absolute count of T and B lymphocytes. Their proportions were unchanged. (author)
International Nuclear Information System (INIS)
Shi Buqing
2006-01-01
Objective: To study the changes of serum TNF-α levels, B-cell count and T-cell subsets distribution in peripheral blood in patients with rheumatoid arthritis. Methods: Serum TNF-α levels (with RIA), B cell as well as T cell subsets distribution type (with monoclonal antibody technique) were examined in 37 patients with rheumatoid arthritis and 30 controls. Results Serum TNF-α levels and B lymphocytes count were significantly higher in the patients than those in controls (P 3 , CD 4 and CD 4 /CD 8 were obviously lower (P<0.01). Conclusion: Rheumatoid arthritis is an autoimmune disease with abnormal immunoregulation. (authors)
International Nuclear Information System (INIS)
Davidson, Susan E.; Burns, Meriel P.; Routledge, Jacqueline A.; Swindell, Ric; Bentzen, Soeren M.; West, Catharine M.L.
2003-01-01
Background and purpose: To assess the correlation between the LENT (late effects on normal tissue) SOMA (subjective objective management analytic) system and the Franco-Italian glossary scores of late morbidity in cervical cancer patients treated with radiation, and to compare the ability of the scoring systems to detect differences between radiation treatment groups. Materials and methods: The study was retrospective. Patients, invited to take part in the study, had radiotherapy for cervical cancer and had a minimum of 3 years follow-up with no evidence of recurrence. One hundred patients agreed to take part. LENT subjective data were obtained using a patient questionnaire approach in order to complete the scales as published. The LENT objective, management and Franco-Italian glossary scores were obtained by a physician. Correlations between scores and differences between treatment groups were examined using non-parametric tests. Results: The average LENT SOMA scores had a greater resolution than the maximum scores, and using the maximum score alone underestimated treatment morbidity. The Franco-Italian glossary scores correlated strongly with the LENT objective scores (ρ=0.61, P<0.0005), and less strongly with the LENT subjective scores (ρ=0.45, P<0.0005). Significant differences in morbidity between the radiation treatment groups were measured using both the LENT SOMA system and the Franco-Italian glossary. Conclusions: The maximum and average LENT scores should be reported for each subsite. The LENT objective scores correlated well with the scores obtained using the established Franco-Italian glossary, but the LENT system provided additional information on subjective treatment effects. Both systems were able to measure significant differences in morbidity between radiation treatment groups. In conclusion, the LENT SOMA system is a valid and comprehensive approach for scoring the late normal tissue effects of radiotherapy
Savard, Patricia; Lamarche, Benoît; Paradis, Marie-Eve; Thiboutot, Hélène; Laurin, Émilie; Roy, Denis
2011-09-01
This randomized, placebo-controlled, double blind, parallel dose-response study investigated the impact of 4-week commercial yoghurt consumption supplemented with Bifidobacterium animalis subsp. lactis (BB-12) and Lactobacillus acidophilus (LA-5) on fecal bacterial counts of healthy adults. Fifty-eight volunteers were randomly assigned to three different groups: 1. placebo (no probiotic, no starter and no green tea extract); 2. Yoptimal (10(9)cfu/100g of BB-12 and LA-5 and 40mg of green tea extract) and 3. Yoptimal-10 (10(10)cfu/100g of BB-12, 10(9)cfu/100g of LA-5 and 40mg of green tea extract). These yoghurt products also contained Lactobacillus delbrueckii subsp. bulgaricus (10(7)cfu/100g) and Streptococcus thermophilus (10(10)cfu/100g). The quantitative PCR (qPCR) results showed that there were significant increases (P=0.02) in bifidobacteria counts with the Yoptimal treatment as compared to baseline. The fecal numbers of B. animalis subsp. lactis and LA-5 significantly increased in the two probiotic treatments compared to the placebo treatment. Viable counts of fecal lactobacilli were significantly higher (P=0.05) and those of enterococci were significantly lower (P=0.04) after the intervention when compared to placebo. No significant difference was observed between treatments in volunteers' weight, waist girth, blood pressure, fasting plasma triglyceride and HDL-C concentrations, as well as cholesterol/HDL-cholesterol ratio. However, a significant increase in plasma cholesterol levels was observed in the placebo group (P=0.0018) but the levels remained stable in the two probiotic yoghurt groups. These results show that probiotic strains supplemented in the form of yoghurt remain active during gut transit and are associated with an increase in beneficial bacteria and a reduction in potentially pathogenic bacteria. This trial was registered at clinicaltrials.gov as NCT00730626. Copyright © 2011 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Back, H.O.; Hagner, C.; Vogelaar, R.B.
2003-01-01
If heavy neutrinos with mass m νH ≥2m e are emitted in the decays of 8 B in the Sun, then decays ν H →ν L +e + +e - should be observed. The results of background measurements with the BOREXINO Counting Test Facility have been used to obtain bounds on the number of these decays. As a result, new limits on the coupling |U eH | 2 of a massive neutrino in the range of 1.1 to 12 MeV have been derived (|U eH | 2 ≤10 -3 -10 -5 ). The obtained limits on the mixing parameter are stronger than those obtained in the previous experiments using nuclear reactors and accelerators
Particle Count Limits Recommendation for Aviation Fuel
2015-10-05
Particle Counter Methodology • Particle counts are taken utilizing calibration methodologies and standardized cleanliness code ratings – ISO 11171 – ISO...Limits Receipt Vehicle Fuel Tank Fuel Injector Aviation Fuel DEF (AUST) 5695B 18/16/13 Parker 18/16/13 14/10/7 Pamas / Parker / Particle Solutions 19/17...12 U.S. DOD 19/17/14/13* Diesel Fuel World Wide Fuel Charter 5th 18/16/13 DEF (AUST) 5695B 18/16/13 Caterpillar 18/16/13 Detroit Diesel 18/16/13 MTU
Capturing Cultural Glossaries: Case-study II
Directory of Open Access Journals (Sweden)
Matete Madiba
2011-10-01
Full Text Available
ABSTRACT: This case-study attempts to present a brief glossary of Northern Sotho medical terms. It is a follow-up of a similar case-study (Madiba, Mphahlele and Kganyago 2003, which was an attempt to capture and present Northern Sotho cooking terms. Case-study I consists of the names for utensils, ingredients and the processes involved in the preparation of cultural dishes. With both these case-studies, the intention has been to use the opportunities availing themselves for the pres-ervation and valorisation of Northern Sotho, including the extension of its corpora to support national dictionary-making processes. The case-study methodology has been very useful for the purposes of this project and the context within which it was undertaken. It aims to provide a model for the collection and presentation of authentic Northern Sotho terminology which otherwise would hardly have been accessible.
Keywords: CULTURAL GLOSSARY, INDIGENOUS KNOWLEDGE SYSTEMS, CORPUS, OUTCOMES-BASED EDUCATION, ASSESSMENT CRITERIA, TRADITIONAL MEDICAL TERMS, COMMUNICATIVE APPROACH, STRUCTURAL APPROACH, METONYMY, HANDS-ON ACTIVITIES, TASK-BASED LEARNING
*****
OPSOMMING: Die totstandbrenging van kulturele woordversamelings: Ge-vallestudie II. Hierdie gevallestudie probeer om 'n beperkte woordelys van Noord-Sotho- mediese terme aan te bied. Dit is 'n voortsetting van 'n soortgelyke gevallestudie (Madiba, Mpha-hlele en Kganyago 2003 wat 'n poging was om Noord-Sothokookterme te versamel en aan te bied. Gevallestudie I bestaan uit die name van gereedskap, bestanddele, en die prosesse betrokke by die voorbereiding van kulturele geregte. Met altwee hierdie gevallestudies was die bedoeling om die geleenthede te gebruik wat hulleself aanbied vir die bewaring en bestendiging van Noord-Sotho, insluitende die uitbreiding van sy korpora om die nasionale woordeboeksamestellingsprosesse te ondersteun. Die gevallestudiemetodologie was baie nuttig vir die doeleindes van
Determination of the thoron daughter working level by a one gross alpha-count
International Nuclear Information System (INIS)
Bigu, J.; Lau, W.K.
1983-02-01
A study has been done on the determination of the thoron daughter Working Level, WL(Tn), by a one gross α-count. The relationship between the gross α-count rate per unit of volume of air sampled and WL(Tn), denoted the F-factor, has been investigated as a function of sampling time, elapsed time from the end of the sampling period, i.e., waiting time, and the thoron daughter disequilibrium ratio [ThC]/[ThB]. It has been found that F depends on both the waiting time and [ThC]/[ThB]. If α-count measurements are made at least 300 min after the end of sampling, F changes by less than 10 percent over the full range of theoretical values of [ThC]/[ThB], i.e., from 0 to 1. The F-factor is independent of [ThC]/[ThB] at approximately 215 min after the end of sampling. This feature can be used to determine WL(Tn) with higher accuracy and at least 1.5 hr earlier than is commonly done using other one gross α-count methods reported in the literature
DEFF Research Database (Denmark)
Jørgensen, Niels; Liu, Fan; Andersson, Anna-Maria
2010-01-01
To describe associations between serum inhibin-b and sperm counts, adjusted for effect of time of blood sampling, in larger cohorts than have been previously reported.......To describe associations between serum inhibin-b and sperm counts, adjusted for effect of time of blood sampling, in larger cohorts than have been previously reported....
Oneka, Goldameir; Vahid Shahidi, Faraz; Muntaner, Carles; Bayoumi, Ahmed M; Mahabir, Deb Finn; Freiler, Alix; O'Campo, Patricia; Shankardass, Ketan
2017-08-01
Health in All Policies (HiAP) is a strategy that seeks to integrate health considerations into the development, implementation and evaluation of policies across various non-health sectors of the government. Over the past 15 years, there has been an increase in the uptake of HiAP by local, regional and national governments. Despite the growing popularity of this approach, most existing literature on HiAP implementation remains descriptive rather than explanatory in its orientation. Moreover, prior research has focused on the more technical aspects of the implementation process. Thus, studies that aim to 'build capacity to promote, implement and evaluate HiAP' abound. Conversely, there is little emphasis on the political aspects of HiAP implementation. Neglecting the role of politics in shaping the use of HiAP is problematic, since health and the strategies by which it is promoted are partially political.This glossary addresses the politics gap in the existing literature by drawing on theoretical concepts from political, policy, and public health sciences to articulate a framework for studying how political mechanisms influence HiAP implementation. To this end, the glossary forms part of an on-going multiple explanatory case study of HiAP implementation, HARMONICS (HiAP Analysis using Realist Methods on International Case Studies, harmonics-hiap.ca), and is meant to expand on a previously published glossary addressing the topic of HiAP implementation more broadly. Collectively, these glossaries offer a conceptual toolkit for understanding how politics explains implementation outcomes of HiAP. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2017. All rights reserved. No commercial use is permitted unless otherwise expressly granted.
MODIS/Aqua Raw Radiances in Counts 5-Min L1A Swath V006
National Aeronautics and Space Administration — The MODIS/Aqua Raw Radiances in Counts 5-Min L1A Swath (MYD01) product contains reformatted and packaged raw instrument data. MODIS instrument data, in packetized...
Glossary of terms for information technology and pearls of wisdom for implementation and use.
Haas, Janet P
2015-06-01
This glossary of terms is a primer on the vocabulary information technology professionals use and with which infection preventionists should be familiar. The author's comments are in italics. Copyright © 2015 Association for Professionals in Infection Control and Epidemiology, Inc. Published by Elsevier Inc. All rights reserved.
Chadwick, Clifton; Rojas, Alicia Mabel
This glossary offers definitions of almost 600 terms normally associated with the field of educational technology in brief and easy-to-understand form, all in Spanish (a Portugese version exists). The terms are organized into six major areas: learning, communications, instructional design, evaluation, media production, and systems theory. (Author)
Glossary of terms used in the disposal of high-level wastes: Salt Repository Project
International Nuclear Information System (INIS)
1987-02-01
This glossary provides definitions of words and phrases specific to, or used in a special way in, documents of the US Department of Energy's Civilian Radioactive Waste Management Program. In many cases, two or more definitions of a word or phrase are given. Sources are provided for all definitions. 33 refs
2D dark-count-rate modeling of PureB single-photon avalanche diodes in a TCAD environment
Knežević, Tihomir; Nanver, Lis K.; Suligoj, Tomislav
2018-02-01
PureB silicon photodiodes have nm-shallow p+n junctions with which photons/electrons with penetration-depths of a few nanometer can be detected. PureB Single-Photon Avalanche Diodes (SPADs) were fabricated and analysed by 2D numerical modeling as an extension to TCAD software. The very shallow p+ -anode has high perimeter curvature that enhances the electric field. In SPADs, noise is quantified by the dark count rate (DCR) that is a measure for the number of false counts triggered by unwanted processes in the non-illuminated device. Just like for desired events, the probability a dark count increases with increasing electric field and the perimeter conditions are critical. In this work, the DCR was studied by two 2D methods of analysis: the "quasi-2D" (Q-2D) method where vertical 1D cross-sections were assumed for calculating the electron/hole avalanche-probabilities, and the "ionization-integral 2D" (II-2D) method where crosssections were placed where the maximum ionization-integrals were calculated. The Q-2D method gave satisfactory results in structures where the peripheral regions had a small contribution to the DCR, such as in devices with conventional deepjunction guard rings (GRs). Otherwise, the II-2D method proved to be much more precise. The results show that the DCR simulation methods are useful for optimizing the compromise between fill-factor and p-/n-doping profile design in SPAD devices. For the experimentally investigated PureB SPADs, excellent agreement of the measured and simulated DCR was achieved. This shows that although an implicit GR is attractively compact, the very shallow pn-junction gives a risk of having such a low breakdown voltage at the perimeter that the DCR of the device may be negatively impacted.
The demand of car rentals: a microeconometric approach with count models and survey data
Czech Academy of Sciences Publication Activity Database
Menezes, A. G.; Uzagalieva, Ainura
2013-01-01
Roč. 5, č. 1 (2013), s. 25-41 ISSN 1973-3909 Institutional support: RVO:67985998 Keywords : count data models * tourism * tax rates Subject RIV: AH - Economics http://www.rofea.org/index.php?journal=journal&page=article&op=view&path%5B%5D=106
Hardersen, Randolf; Enebakk, Terje; Christiansen, Dorte; Bergseth, Grethe; Brekke, Ole-Lars; Mollnes, Tom Eirik; Lappegård, Knut Tore; Hovland, Anders
2018-04-01
The aim of the study was to investigate the role of complement factor 5 (C5) in reactions elicited by plasma separation using blood from a C5-deficient (C5D) individual, comparing it to C5-deficient blood reconstituted with C5 (C5DR) and blood from healthy donors. Blood was circulated through an ex vivo plasma separation model. Leukocyte CD11b expression and leukocyte-platelet conjugates were measured by flow cytometry during a 30-min period. Other markers were assessed during a 240-min period. Granulocyte and monocyte CD11b expression did not increase in C5D blood during plasma separation. In C5DR samples granulocytes CD11b expression, measured by mean fluorescence intensity (MFI), increased from 10481 ± 6022 (SD) to 62703 ± 4936, and monocytes CD11b expression changed from 13837 ± 7047 to 40063 ± 713. Granulocyte-platelet conjugates showed a 2.5-fold increase in the C5DR sample compared to the C5D sample. Monocyte-platelet conjugates increased independently of C5. In the C5D samples, platelet count decreased from 210 × 10 9 /L (201-219) (median and range) to 51 × 10 9 /L (50-51), and C3bc increased from 14 CAU/mL (21-7) to 198 CAU/mL (127-269), whereas TCC formation was blocked during plasma separation. In conclusion, up-regulation of granulocyte and monocyte CD11b during plasma separation was C5-dependent. The results also indicate C5 dependency in granulocyte-platelet conjugates formation. © 2018 APMIS. Published by John Wiley & Sons Ltd.
International Nuclear Information System (INIS)
Zhao Wenjuan
2006-01-01
Objective: To explore the changes of serum TNF-α levels, peripheral B cell count and T subsets distribution pattern in patients with pregnancy induced hypertension syndrome. Methods: Serum TNF-α levels (with RIA), peripheral B cell count as well as T subsets (with monoclonal technique) were examined in 34 patients with pregnancy induced hypertension syndrome and 35 controls. Results: The serum TNF-α levels and B lymphocytes count were significantly higher than those in controls (P 3 , CD 4 , CD4/CD8 ratio were significantly lower than those in controls (P<0.01). Conclusion: Pregnancy induced hY- pertension syndrome is a kind of autoimmune diseases with abnormal immunoregulation. (authors)
PROPOSAL FOR A BILINGUAL GLOSSARY - PORTUGUESE/SPANISH - FOR MEDICAL CARE TO IMMIGRANT
Marta Ingrith Molina Cabrera
2016-01-01
The pain is a multidimensional and subjective experience, so we reflect on the importance of communicating it in a medical consultation, in multicultural immigration contexts. Therefore, it becomes necessary the development of language tools that enable narrate the subjective experience of pain and evaluate it.Considering this demand, we propose a glossary with the Portuguese-Spanish pair for the purpose of offering a tool that helps doctors, immigrants and refugees when they need to communic...
Qatar Exoplanet Survey : Qatar-3b, Qatar-4b, and Qatar-5b
Alsubai, Khalid; Mislis, Dimitris; Tsvetanov, Zlatan I.; Latham, David W.; Bieryla, Allyson; Buchhave, Lars A.; Esquerdo, Gilbert A.; Bramich, D. M.; Pyrzas, Stylianos; Vilchez, Nicolas P. E.; Mancini, Luigi; Southworth, John; Evans, Daniel F.; Henning, Thomas; Ciceri, Simona
2017-04-01
We report the discovery of Qatar-3b, Qatar-4b, and Qatar-5b, three new transiting planets identified by the Qatar Exoplanet Survey. The three planets belong to the hot Jupiter family, with orbital periods of {P}{{Q}3{{b}}} = 2.50792 days, {P}{{Q}4{{b}}} = 1.80539 days, and {P}{{Q}5{{b}}} = 2.87923 days. Follow-up spectroscopic observations reveal the masses of the planets to be {M}{{Q}3{{b}}} = 4.31 ± 0.47 {M}{{J}}, {M}{{Q}4{{b}}} = 6.10 ± 0.54 {M}{{J}}, and {M}{{Q}5{{b}}} = 4.32 ± 0.18 {M}{{J}}, while model fits to the transit light curves yield radii of {R}{{Q}3{{b}}} = 1.096 ± 0.14 {R}{{J}}, {R}{{Q}4{{b}}} = 1.135 ± 0.11 {R}{{J}}, and {R}{{Q}5{{b}}} = 1.107 ± 0.064 {R}{{J}}. The host stars are low-mass main sequence stars with masses and radii M Q3 = 1.145 ± 0.064 M ⊙, M Q4 = 0.896 ± 0.048 M ⊙, M Q5 = 1.128 ± 0.056 M ⊙ and R Q3 = 1.272 ± 0.14 R ⊙, R Q4 = 0.849 ± 0.063 R ⊙, and R Q5 = 1.076 ± 0.051 R ⊙ for Qatar-3, 4, and 5 respectively. The V magnitudes of the three host stars are V Q3 = 12.88, V Q4 = 13.60, and V Q5 = 12.82. All three new planets can be classified as heavy hot Jupiters (M > 4 M J).
Solar Energy Education. Home economics: teacher's guide. Field test edition. [Includes glossary
Energy Technology Data Exchange (ETDEWEB)
1981-06-01
An instructional aid is provided for home economics teachers who wish to integrate the subject of solar energy into their classroom activities. This teacher's guide was produced along with the student activities book for home economics by the US Department of Energy Solar Energy Education. A glossary of solar energy terms is included. (BCS)
International Nuclear Information System (INIS)
1976-05-01
Volume V of the five-volume report consists of appendices, which provide supplementary information, with emphasis on characteristics of geologic formations that might be used for final storage or disposal. Appendix titles are: selected glossary; conversion factors; geologic isolation, including, (a) site selection factors for repositories of wastes in geologic media, (b) rock types--geologic occurrence, (c) glossary of geohydrologic terms, and (d) 217 references; the ocean floor; and, government regulations pertaining to the management of radioactive materials
Energy Technology Data Exchange (ETDEWEB)
1976-05-01
Volume V of the five-volume report consists of appendices, which provide supplementary information, with emphasis on characteristics of geologic formations that might be used for final storage or disposal. Appendix titles are: selected glossary; conversion factors; geologic isolation, including, (a) site selection factors for repositories of wastes in geologic media, (b) rock types--geologic occurrence, (c) glossary of geohydrologic terms, and (d) 217 references; the ocean floor; and, government regulations pertaining to the management of radioactive materials. (JGB)
Cache-Oblivious Planar Orthogonal Range Searching and Counting
DEFF Research Database (Denmark)
Arge, Lars; Brodal, Gerth Stølting; Fagerberg, Rolf
2005-01-01
present the first cache-oblivious data structure for planar orthogonal range counting, and improve on previous results for cache-oblivious planar orthogonal range searching. Our range counting structure uses O(Nlog2 N) space and answers queries using O(logB N) memory transfers, where B is the block...... size of any memory level in a multilevel memory hierarchy. Using bit manipulation techniques, the space can be further reduced to O(N). The structure can also be modified to support more general semigroup range sum queries in O(logB N) memory transfers, using O(Nlog2 N) space for three-sided queries...... and O(Nlog22 N/log2log2 N) space for four-sided queries. Based on the O(Nlog N) space range counting structure, we develop a data structure that uses O(Nlog2 N) space and answers three-sided range queries in O(logB N+T/B) memory transfers, where T is the number of reported points. Based...
Buskulic, D.; de Bonis, I.; Decamp, D.; Ghez, P.; Goy, C.; Lees, J.-P.; Lucotte, A.; Minard, M.-N.; Nief, J.-Y.; Odier, P.; Pietrzyk, B.; Casado, M. P.; Chmeissani, M.; Crespo, J. M.; Delfino, M.; Efthymiopoulos, I.; Fernandez, E.; Fernandez-Bosman, M.; Garrido, Ll.; Juste, A.; Martinez, M.; Orteu, S.; Padilla, C.; Park, I. C.; Pascual, A.; Perlas, J. A.; Riu, I.; Sanchez, F.; Teubert, F.; Colaleo, A.; Creanza, D.; de Palma, M.; Gelao, G.; Girone, M.; Iaselli, G.; Maggi, G.; Maggi, M.; Marinelli, N.; Nuzzo, S.; Ranieri, A.; Raso, G.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Tricomi, A.; Zito, G.; Huang, X.; Lin, J.; Ouyang, Q.; Wang, T.; Xie, Y.; Xu, R.; Xue, S.; Zhang, J.; Zhang, L.; Zhao, W.; Alemany, R.; Bazarko, A. O.; Bonvicini, G.; Bright-Thomas, P.; Cattaneo, M.; Cerutti, F.; Comas, P.; Coyle, P.; Drevermann, H.; Forty, R. W.; Frank, M.; Hagelberg, R.; Harvey, J.; Janot, P.; Jost, B.; Kneringer, E.; Knobloch, J.; Lehraus, I.; Lutters, G.; Martin, E. B.; Mato, P.; Minten, A.; Miquel, R.; Mir, Ll. M.; Moneta, L.; Oest, T.; Pacheco, A.; Pusztaszeri, J.-F.; Ranjard, F.; Rensing, P.; Rizzo, G.; Rolandi, L.; Schlatter, D.; Schmelling, M.; Schmitt, M.; Schneider, O.; Tejessy, W.; Tomalin, I. R.; Venturi, A.; Wachsmuth, H.; Wagner, A.; Ajaltouni, Z.; Barrès, A.; Boyer, C.; Falvard, A.; Gay, P.; Guicheney, C.; Henrard, P.; Jousset, J.; Michel, B.; Monteil, S.; Montret, J.-C.; Pallin, D.; Perret, P.; Podlyski, F.; Proriol, J.; Rosnet, P.; Rossignol, J.-M.; Fearnley, T.; Hansen, J. B.; Hansen, J. D.; Hansen, J. R.; Hansen, P. H.; Nilsson, B. S.; Rensch, B.; Wäänänen, A.; Kyriakis, A.; Markou, C.; Simopoulou, E.; Siotis, I.; Vayaki, A.; Zachariadou, K.; Blondel, A.; Bonneaud, G.; Brient, J. C.; Bourdon, P.; Rougé, A.; Rumpf, M.; Valassi, A.; Verderi, M.; Videau, H.; Candlin, D. J.; Parsons, M. I.; Focardi, E.; Parrini, G.; Corden, M.; Georgiopoulos, C.; Jaffe, D. E.; Antonelli, A.; Bencivenni, G.; Bologna, G.; Bossi, F.; Campana, P.; Capon, G.; Casper, D.; Chiarella, V.; Felici, G.; Laurelli, P.; Mannocchi, G.; Murtas, F.; Murtas, G. P.; Passalacqua, L.; Pepe-Altarelli, M.; Curtis, L.; Dorris, S. J.; Halley, A. W.; Knowles, I. G.; Lynch, J. G.; O'Shea, V.; Raine, C.; Reeves, P.; Scarr, J. M.; Smith, K.; Teixeira-Dias, P.; Thompson, A. S.; Thomson, F.; Thorn, S.; Turnbull, R. M.; Becker, U.; Geweniger, C.; Graefe, G.; Hanke, P.; Hansper, G.; Hepp, V.; Kluge, E. E.; Putzer, A.; Schmidt, M.; Sommer, J.; Stenzel, H.; Tittel, K.; Werner, S.; Wunsch, M.; Abbaneo, D.; Beuselinck, R.; Binnie, D. M.; Cameron, W.; Dornan, P. J.; Moutoussi, A.; Nash, J.; Sedgbeer, J. K.; Stacey, A. M.; Williams, M. D.; Dissertori, G.; Girtler, P.; Kuhn, D.; Rudolph, G.; Betteridge, A. P.; Bowdery, C. K.; Colrain, P.; Crawford, G.; Finch, A. J.; Foster, F.; Hughes, G.; Sloan, T.; Williams, M. I.; Galla, A.; Giehl, I.; Greene, A. M.; Hoffmann, C.; Jakobs, K.; Kleinknecht, K.; Quast, G.; Renk, B.; Rohne, E.; Sander, H.-G.; van Gemmeren, P.; Zeitnitz, C.; Aubert, J. J.; Bencheikh, A. M.; Benchouk, C.; Bonissent, A.; Bujosa, G.; Calvet, D.; Carr, J.; Diaconu, C.; Etienne, F.; Konstantinidis, N.; Payre, P.; Rousseau, D.; Talby, M.; Sadouki, A.; Thulasidas, M.; Trabelsi, K.; Aleppo, M.; Ragusa, F.; Bauer, C.; Berlich, R.; Blum, W.; Büscher, V.; Dietl, H.; Dydak, F.; Ganis, G.; Gotzhein, C.; Kroha, H.; Lütjens, G.; Lutz, G.; Männer, W.; Moser, H.-G.; Richter, R.; Rosado-Schlosser, A.; Schael, S.; Settles, R.; Seywerd, H.; Denis, R. St.; Stenzel, H.; Wiedenmann, W.; Wolf, G.; Boucrot, J.; Callot, O.; Choi, Y.; Cordier, A.; Davier, M.; Duflot, L.; Grivaz, J.-F.; Heusse, Ph.; Höcker, A.; Jacholkowska, A.; Jacquet, M.; Kim, D. W.; Le Diberder, F.; Lefrançois, J.; Lutz, A.-M.; Nikolic, I.; Park, H. J.; Schune, M.-H.; Simion, S.; Veillet, J.-J.; Videau, I.; Zerwas, D.; Azzurri, P.; Bagliesi, G.; Batignani, G.; Bettarini, S.; Bozzi, C.; Calderini, G.; Carpinelli, M.; Ciocci, M. A.; Ciulli, V.; Dell'Orso, R.; Fantechi, R.; Ferrante, I.; Foà, L.; Forti, F.; Giassi, A.; Giorgi, M. A.; Gregorio, A.; Ligabue, F.; Lusiani, A.; Marrocchesi, P. S.; Messineo, A.; Palla, F.; Sanguinetti, G.; Sciabà, A.; Spagnolo, P.; Steinberger, J.; Tenchini, R.; Tonelli, G.; Vannini, C.; Verdini, P. G.; Blair, G. A.; Bryant, L. M.; Chambers, J. T.; Gao, Y.; Green, M. G.; Medcalf, T.; Perrodo, P.; Strong, J. A.; von Wimmersperg-Toeller, J. H.; Botterill, D. R.; Clifft, R. W.; Edgecock, T. R.; Haywood, S.; Maley, P.; Norton, P. R.; Thompson, J. C.; Wright, A. E.; Bloch-Devaux, B.; Colas, P.; Emery, S.; Kozanecki, W.; Lançon, E.; Lemaire, M. C.; Locci, E.; Perez, P.; Rander, J.; Renardy, J.-F.; Roussarie, A.; Schuller, J.-P.; Schwindling, J.; Trabelsi, A.; Vallage, B.; Black, S. N.; Dann, J. H.; Johnson, R. P.; Kim, H. Y.; Litke, A. M.; McNeil, M. A.; Taylor, G.; Booth, C. N.; Boswell, R.; Brew, C. A. J.; Cartwright, S.; Combley, F.; Koksal, A.; Letho, M.; Newton, W. M.; Reeve, J.; Thompson, L. F.; Böhrer, A.; Brandt, S.; Cowan, G.; Grupen, C.; Minguet-Rodriguez, J.; Rivera, F.; Saraiva, P.; Smolik, L.; Stephan, F.; Apollonio, M.; Bosisio, L.; Della Marina, R.; Giannini, G.; Gobbo, B.; Musolino, G.; Rothberg, J.; Wasserbaech, S.; Armstrong, S. R.; Elmer, P.; Feng, Z.; Ferguson, D. P. S.; Gao, Y. S.; González, S.; Grahl, J.; Greening, T. C.; Hayes, O. J.; Hu, H.; McNamara, P. A.; Nachtman, J. M.; Orejudos, W.; Pan, Y. B.; Saadi, Y.; Scott, I. J.; Walsh, A. M.; Walsh, J.; Wu, Sau Lan; Wu, X.; Yamartino, J. M.; Zheng, M.; Zobernig, G.; Aleph Collaboration
1996-02-01
The inclusive production of charmed particles in Z → b overlineb decays has been measured from the yield of D0, D+, Ds+ and Λc+ decays in a sample of q overlineq events with high b purity collected with the ALEPH detector from 1992 to 1995. From these measurements, adding the charmonia production rate and an estimate of the charmed strange baryon contribution, the average number of charm quarks per b decay is determined to be nc = 1.230 ± 0.036 ± 0.038 ± 0.053, where the uncertainties are due to statistics, systematic effects and branching ratios, respectively.
Determination of radium in water by α-counting
International Nuclear Information System (INIS)
Zhu Tianxia
1986-01-01
An analytical method is developed for the determination of Ra in water by means of alpha-counting after Ra has been coprecipitated first with PbSO 4 and then with BaSO 4 in EDTA-NH 4 OH with a recovery of ∼99%. Lower limit of the determination is 2.7 x 10 -4 Bq/l by the use of instruments having low Ra-background ≤ 1.3 x 10 -5 Bq. The determination takes 5 hours in the case of having known the ratio 226 Ra/ 224 Ra (B value). If the B value is unknown, another determination is necessary after the sample is allowed to decay for at least 40 hours to give the amounts of 226 Ra and 224 Ra
The International Glossary on Infertility and Fertility Care, 2017
DEFF Research Database (Denmark)
Zegers-Hochschild, Fernando; Adamson, G. David; Dyer, Silke
2017-01-01
STUDY QUESTION: Can a consensus and evidence-driven set of terms and definitions be generated to be used globally in order to ensure consistency when reporting on infertility issues and fertility care interventions, as well as to harmonize communication among the medical and scientific communities......, policy-makers, and lay public including individuals and couples experiencing fertility problems? SUMMARY ANSWER: A set of 283 consensus-based and evidence-driven terminologies used in infertility and fertility care has been generated through an inclusive consensus-based process with multiple stakeholders...... of the reproductive system, and increased standardization of fertility treatment terminology. Since 2009, limitations were identified in several areas and enhancements were suggested for the glossary, especially concerning male factor, demography, epidemiology and public health issues. STUDY DESIGN, SIZE, DURATION...
2010-07-01
... maintained by the Department, including but not limited to the individual's education, financial transactions... 34 Education 1 2010-07-01 2010-07-01 false Definitions. 5b.1 Section 5b.1 Education Office of the Secretary, Department of Education PRIVACY ACT REGULATIONS § 5b.1 Definitions. As used in this part: (a...
Is It Counting, or Is It Adding?
Eisenhardt, Sara; Fisher, Molly H.; Thomas, Jonathan; Schack, Edna O.; Tassell, Janet; Yoder, Margaret
2014-01-01
The Common Core State Standards for Mathematics (CCSSI 2010) expect second grade students to "fluently add and subtract within 20 using mental strategies" (2.OA.B.2). Most children begin with number word sequences and counting approximations and then develop greater skill with counting. But do all teachers really understand how this…
Decay rate ratios of Υ(5S)→B anti B reactions
International Nuclear Information System (INIS)
Hwang, Dae Sung; Son, Hyungsuk
2010-01-01
We calculate the decay rate ratios for OZI allowed decays of Υ(5S) to two B mesons by using the decay amplitudes which incorporate the wave function of the Υ(5S) state. We obtain the result that the branching ratio of the Υ(5S) decay to B s * anti B s * is much larger than the branching ratio to B s anti B s * or anti B s B s * , in good agreement with the recent experimental results of CLEO and BELLE. This agreement with the experimental results is made possible since the nodes of the Υ(5S) radial wave function induce the nodes of the decay amplitude. We find that the results for the Υ(5S) decays to B u (*) anti B u (*) or B d (*) anti B d (*) pairs are sensitive to the parameter values used for the potential between heavy quarks. (orig.)
Liquid scintillation counting of chlorophyll
International Nuclear Information System (INIS)
Fric, F.; Horickova, B.; Haspel-Horvatovic, E.
1975-01-01
A precise and reproducible method of liquid scintillation counting was worked out for measuring the radioactivity of 14 C-labelled chlorophyll a and chlorophyll b solutions without previous bleaching. The spurious count rate caused by luminescence of the scintillant-chlorophyll system is eliminated by using a suitable scintillant and by measuring the radioactivity at 4 to 8 0 C after an appropriate time of dark adaptation. Bleaching of the chlorophyll solutions is necessary only for measuring of very low radioactivity. (author)
Recent trends in counts of migrant hawks from northeastern North America
Titus, K.; Fuller, M.R.
1990-01-01
Using simple regression, pooled-sites route-regression, and nonparametric rank-trend analyses, we evaluated trends in counts of hawks migrating past 6 eastern hawk lookouts from 1972 to 1987. The indexing variable was the total count for a season. Bald eagle (Haliaeetus leucocephalus), peregrine falcon (Falco peregrinus), merlin (F. columbarius), osprey (Pandion haliaetus), and Cooper's hawk (Accipiter cooperii) counts increased using route-regression and nonparametric methods (P 0.10). We found no consistent trends (P > 0.10) in counts of sharp-shinned hawks (A. striatus), northern goshawks (A. gentilis) red-shouldered hawks (Buteo lineatus), red-tailed hawks (B. jamaicensis), rough-legged hawsk (B. lagopus), and American kestrels (F. sparverius). Broad-winged hawk (B. platypterus) counts declined (P < 0.05) based on the route-regression method. Empirical comparisons of our results with those for well-studied species such as the peregrine falcon, bald eagle, and osprey indicated agreement with nesting surveys. We suggest that counts of migrant hawks are a useful and economical method for detecting long-term trends in species across regions, particularly for species that otherwise cannot be easily surveyed.
Automated uranium analysis by delayed-neutron counting
International Nuclear Information System (INIS)
Kunzendorf, H.; Loevborg, L.; Christiansen, E.M.
1980-10-01
Automated uranium analysis by fission-induced delayed-neutron counting is described. A short description is given of the instrumentation including transfer system, process control, irradiation and counting sites, and computer operations. Characteristic parameters of the facility (sample preparations, background, and standards) are discussed. A sensitivity of 817 +- 22 counts per 10 -6 g U is found using irradiation, delay, and counting times of 20 s, 5 s, and 10 s, respectively. Presicion is generally less than 1% for normal geological samples. Critical level and detection limits for 7.5 g samples are 8 and 16 ppb, respectively. The importance of some physical and elemental interferences are outlined. Dead-time corrections of measured count rates are necessary and a polynomical expression is used for count rates up to 10 5 . The presence of rare earth elements is regarded as the most important elemental interference. A typical application is given and other areas of application are described. (auther)
Brito, A; Chiquette, J; Stabler, S P; Allen, R H; Girard, C L
2015-01-01
Cobalamin (CBL), the biologically active form of vitamin B12, and its analogs, are produced by bacteria only if cobalt supply is adequate. The analogs differ generally by the nucleotide moiety of the molecule. In CBL, 5,6-dimethylbenzimidazole (5,6-DMB) is the base in the nucleotide moiety. The present study aimed to determine if a supplement of 5,6-DMB could increase utilization of dietary cobalt for synthesis of CBL and change ruminal fermentation, nutrient digestibility, omasal flow of nutrients and ruminal protozoa counts. Eight ruminally cannulated multiparous Holstein cows (mean±standard deviation=238±21 days in milk and 736±47 kg of BW) were used in a crossover design. Cows were randomly assigned to a daily supplement of a gelatin capsule containing 1.5 g of 5,6-DMB via the rumen cannula or no supplement. Each period lasted 29 days and consisted of 21 days for treatment adaptation and 8 days for data and samples collection. Five corrinoids, CBL and four cobamides were detected in the total mixed ration and the omasal digesta from both treatments. The dietary supplement of 5,6-DMB increased (P=0.02) apparent ruminal synthesis of CBL from 14.6 to 19.6 (s.e.m. 0.8) mg/day but had no effect (P>0.1) on apparent ruminal synthesis of the four analogs. The supplement of 5,6-DMB had no effect (P>0.1) on milk production and composition, or on protozoal count, ruminal pH and concentrations of volatile fatty acids and ammonia nitrogen in rumen content. The supplement had also no effect (P>0.1) on intake, omasal flow and apparent ruminal digestibility of dry matter, organic matter, NDF, ADF and nitrogenous fractions. Plasma concentration of CBL was not affected by treatments (P=0.98). Providing a preformed part of the CBL molecule, that is, 5,6-DMB, increased by 34% the apparent ruminal synthesis of CBL by ruminal bacteria but had no effect on ruminal fermentation or protozoa count and it was not sufficient to increase plasma concentrations of the vitamin. Even though
Buskulic, Damir; Décamp, D; Ghez, P; Goy, C; Lees, J P; Lucotte, A; Minard, M N; Nief, J Y; Odier, P; Pietrzyk, B; Casado, M P; Chmeissani, M; Crespo, J M; Delfino, M C; Efthymiopoulos, I; Fernández, E; Fernández-Bosman, M; Carrido, L; Juste, A; Martínez, M; Orteu, S; Padilla, C; Park, I C; Pascual, A; Perlas, J A; Riu, I; Sánchez, F; Teubert, F; Colaleo, A; Creanza, D; De Palma, M; Gelao, G; Girone, M; Iaselli, Giuseppe; Maggi, G; Maggi, M; Marinelli, N; Nuzzo, S; Ranieri, A; Raso, G; Ruggieri, F; Selvaggi, G; Silvestris, L; Tempesta, P; Tricomi, A; Zito, G; Huang, X; Lin, J; Ouyang, Q; Wang, T; Xie, Y; Xu, R; Xue, S; Zhang, J; Zhang, L; Zhao, W; Alemany, R; Bazarko, A O; Bonvicini, G; Bright-Thomas, P G; Cattaneo, M; Cerutti, F; Comas, P; Coyle, P; Drevermann, H; Forty, Roger W; Frank, M; Hagelberg, R; Harvey, J; Janot, P; Jost, B; Kneringer, E; Knobloch, J; Lehraus, Ivan; Lutters, G; Martin, E B; Mato, P; Minten, Adolf G; Miquel, R; Mir, L M; Moneta, L; Oest, T; Pacheco, A; Pusztaszeri, J F; Ranjard, F; Rensing, P E; Rizzo, G; Rolandi, Luigi; Schlatter, W D; Schmelling, M; Schmitt, M; Schneider, O; Tejessy, W; Tomalin, I R; Venturi, A; Wachsmuth, H W; Wagner, A; Ajaltouni, Ziad J; Barrès, A; Boyer, C; Falvard, A; Gay, P; Guicheney, C; Henrard, P; Jousset, J; Michel, B; Monteil, S; Montret, J C; Pallin, D; Perret, P; Podlyski, F; Proriol, J; Rosnet, P; Rossignol, J M; Fearnley, Tom; Hansen, J B; Hansen, J D; Hansen, J R; Hansen, P H; Nilsson, B S; Rensch, B; Wäänänen, A; Kyriakis, A; Markou, C; Simopoulou, Errietta; Siotis, I; Vayaki, Anna; Zachariadou, K; Blondel, A; Bonneaud, G R; Brient, J C; Bourdon, P; Rougé, A; Rumpf, M; Valassi, Andrea; Verderi, M; Videau, H L; Candlin, D J; Parsons, M I; Focardi, E; Parrini, G; Corden, M; Georgiopoulos, C H; Jaffe, D E; Antonelli, A; Bencivenni, G; Bologna, G; Bossi, F; Campana, P; Capon, G; Casper, David William; Chiarella, V; Felici, G; Laurelli, P; Mannocchi, G; Murtas, F; Murtas, G P; Passalacqua, L; Pepé-Altarelli, M; Curtis, L; Dorris, S J; Halley, A W; Knowles, I G; Lynch, J G; O'Shea, V; Raine, C; Reeves, P; Scarr, J M; Smith, K; Teixeira-Dias, P; Thompson, A S; Thomson, F; Thorn, S; Turnbull, R M; Becker, U; Geweniger, C; Graefe, G; Hanke, P; Hansper, G; Hepp, V; Kluge, E E; Putzer, A; Schmidt, M; Sommer, J; Tittel, K; Werner, S; Wunsch, M; Abbaneo, D; Beuselinck, R; Binnie, David M; Cameron, W; Dornan, Peter J; Moutoussi, A; Nash, J; Sedgbeer, J K; Stacey, A M; Williams, M D; Dissertori, G; Girtler, P; Kuhn, D; Rudolph, G; Betteridge, A P; Bowdery, C K; Colrain, P; Crawford, G; Finch, A J; Foster, F; Hughes, G; Sloan, Terence; Williams, M I; Galla, A; Giehl, I; Greene, A M; Hoffmann, C; Jakobs, K; Kleinknecht, K; Quast, G; Renk, B; Rohne, E; Sander, H G; Van Gemmeren, P; Zeitnitz, C; Aubert, Jean-Jacques; Bencheikh, A M; Benchouk, C; Bonissent, A; Bujosa, G; Calvet, D; Carr, J; Diaconu, C A; Etienne, F; Konstantinidis, N P; Payre, P; Rousseau, D; Talby, M; Sadouki, A; Thulasidas, M; Trabelsi, K; Aleppo, M; Ragusa, F; Bauer, C; Berlich, R; Blum, Walter; Büscher, V; Dietl, H; Dydak, Friedrich; Ganis, G; Gotzhein, C; Kroha, H; Lütjens, G; Lutz, Gerhard; Männer, W; Moser, H G; Richter, R H; Rosado-Schlosser, A; Schael, S; Settles, Ronald; Seywerd, H C J; Saint-Denis, R; Stenzel, H; Wiedenmann, W; Wolf, G; Boucrot, J; Callot, O; Choi, Y; Cordier, A; Davier, M; Duflot, L; Grivaz, J F; Heusse, P; Höcker, A; Jacholkowska, A; Jacquet, M; Kim, D W; Le Diberder, F R; Lefrançois, J; Lutz, A M; Nikolic, I A; Park, H J; Schune, M H; Simion, S; Veillet, J J; Videau, I; Zerwas, D; Azzurri, P; Bagliesi, G; Batignani, G; Bettarini, S; Bozzi, C; Calderini, G; Carpinelli, M; Ciocci, M A; Ciulli, V; Dell'Orso, R; Fantechi, R; Ferrante, I; Foà, L; Forti, F; Giassi, A; Giorgi, M A; Gregorio, A; Ligabue, F; Lusiani, A; Marrocchesi, P S; Messineo, A; Palla, Fabrizio; Sanguinetti, G; Sciabà, A; Spagnolo, P; Steinberger, Jack; Tenchini, Roberto; Tonelli, G; Vannini, C; Verdini, P G; Blair, G A; Bryant, L M; Chambers, J T; Gao, Y; Green, M G; Medcalf, T; Perrodo, P; Strong, J A; Von Wimmersperg-Töller, J H; Botterill, David R; Clifft, R W; Edgecock, T R; Haywood, S; Maley, P; Norton, P R; Thompson, J C; Wright, A E; Bloch-Devaux, B; Colas, P; Emery, S; Kozanecki, Witold; Lançon, E; Lemaire, M C; Locci, E; Pérez, P; Rander, J; Renardy, J F; Roussarie, A; Schuller, J P; Schwindling, J; Trabelsi, A; Vallage, B; Black, S N; Dann, J H; Johnson, R P; Kim, H Y; Litke, A M; McNeil, M A; Taylor, G; Booth, C N; Boswell, R; Brew, C A J; Cartwright, S L; Combley, F; Köksal, A; Lehto, M H; Newton, W M; Reeve, J; Thompson, L F; Böhrer, A; Brandt, S; Cowan, G D; Grupen, Claus; Minguet-Rodríguez, J A; Rivera, F; Saraiva, P; Smolik, L; Stephan, F; Apollonio, M; Bosisio, L; Della Marina, R; Giannini, G; Gobbo, B; Musolino, G; Rothberg, J E; Wasserbaech, S R; Armstrong, S R; Elmer, P; Feng, Z; Ferguson, D P S; Gao, Y S; González, S; Grahl, J; Greening, T C; Hayes, O J; Hu, H; McNamara, P A; Nachtman, J M; Orejudos, W; Pan, Y B; Saadi, Y; Scott, I J; Walsh, A M; Walsh, J; Wu, X; Yamartino, J M; Zheng, M; Zobernig, G
1996-01-01
The inclusive production of charmed particles in Z -> bb decays has been measured from the yield of D^0, D^+, D^+_s and Lambda_{c}^+ decays in a sample of qq events with high b purity collected with the ALEPH detector from 1992 to 1995. From these measurements, adding the charmonia production rate and an estimate of the charmed strange baryon contribution, the average number of charm quarks per b decay is determined to be n_c = 1.230 \\pm 0.036 \\pm 0.038 \\pm 0.053 where the uncertainties are due to statistics, systematic effects and branching ratios, respectively.
Zhao, Li-li; Li, Wei; Ping, Fan; Ma, Liang-kun; Nie, Min
2016-06-10
Objective To explore the associations of white blood cell (WBC) count,alanine aminotransferase (ALT),and aspartate aminotransferase(AST) in the first trimester of pregnancy with gestational diabetes mellitus (GDM). Methods Totally 725 GDM women and 935 women who remained euglycemic throughout pregnancy were enrolled in this study. Pre-pregnancy weight/height were recorded. WBC,ALT,and AST levels were detected between 8 and 12 weeks of pregnancy.At 24 to 28 weeks of pregnancy,the glucose and insulin levels were measured. The WBC,ALT,and AST levels were compared between two groups,and the associations of WBC,ALT,and AST levels with the blood glucose and insulin levels were retrospectively analyzed. Meanwhile,the potential associations of those factors with the occurrence of GDM were analzyed. Results WBC count [9.41(8.15,10.84)?10(9)/L vs. 9.04 (7.64,10.37)?10(9)/L,P=1.0?10(-5)] and ALT levels [18.00(12.00,30.00)U/L vs. 16.00 (11.00,26.00)U/L,P=0.004] in the first trimester of pregnancy were significantly increased in GDM subjects than in normal glucose tolerance(NGT)subjects;however,the AST level showed no significant difference between these two groups [41.00 (26.00,43.00)U/L vs. 41.00 (23.00,43.00)U/L,P=0.588]. Logistic regression analysis illustrated that elevated WBC count was an independent risk factor for GDM after adjustment for age,pre-pregnancy body mass index,blood pressure,and family history of diabetes(OR=1.119,P=0.001). The ROC curve revealed that threshold of WBC count was 7.965?10(9)/L(AUC=0.566,P=1?10(-5)),which had a sensitivity of 79.4% and a specificity of 31.3%. Multivariate linear regression analysis showed that homeostasis model assessment of insulin resistance was positively correlated with WBC count(B=0.051,P=0.022,R(2)=0.083);1-hour blood glucose after oral 50 grams of sugar (B=0.044,P=0.001,R(2)=0.044) and fasting plasma true insulin(B=0.214,P=0.032,R(2)=0.066) were positively correlated with WBC count;1-hour true insulin after 100 grams
Total bacterial count and somatic cell count in refrigerated raw milk stored in communal tanks
Directory of Open Access Journals (Sweden)
Edmar da Costa Alves
2014-09-01
Full Text Available The current industry demand for dairy products with extended shelf life has resulted in new challenges for milk quality maintenance. The processing of milk with high bacterial counts compromises the quality and performance of industrial products. The study aimed to evaluate the total bacteria counts (TBC and somatic cell count (SCC in 768 samples of refrigerated raw milk, from 32 communal tanks. Samples were collected in the first quarter of 2010, 2011, 2012 and 2013 and analyzed by the Laboratory of Milk Quality - LQL. Results showed that 62.5%, 37.5%, 15.6% and 27.1% of the means for TBC in 2010, 2011, 2012 and 2013, respectively, were above the values established by legislation. However, we observed a significant reduction in the levels of total bacterial count (TBC in the studied periods. For somatic cell count, 100% of the means indicated values below 600.000 cells/mL, complying with the actual Brazilian legislation. The values found for the somatic cell count suggests the adoption of effective measures for the sanitary control of the herd. However, the results must be considered with caution as it highlights the need for quality improvements of the raw material until it achieves reliable results effectively.
Grivas, Theodoros B; de Mauroy, Jean Claude; Négrini, Stefano; Kotwicki, Tomasz; Zaina, Fabio; Wynne, James H; Stokes, Ian A; Knott, Patrick; Pizzetti, Paolo; Rigo, Manuel; Villagrasa, Monica; Weiss, Hans Rudolf; Maruyama, Toru
2010-11-02
This report is the SOSORT Consensus Paper on Terminology for use in the treatment of conservative spinal deformities. Figures are provided and relevant literature is cited where appropriate. The Delphi method was used to reach a preliminary consensus before the meeting, where the terms that still needed further clarification were discussed. A final agreement was found for all the terms, which now constitute the base of this glossary. New terms will be added after being discussed and accepted. When only one set of terms is used for communication in a place or among a group of people, then everyone can clearly and efficiently communicate. This principle applies for any professional group. Until now, no common set of terms was available in the field of the conservative treatment of scoliosis and spinal deformities. This glossary gives a common base language to draw from to discuss data, findings and treatment.
Analysis list: Stat5b [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Stat5b Blood,Breast + mm9 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Sta...t5b.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Stat5b.5.tsv http://dbarchive.biosciencedbc....jp/kyushu-u/mm9/target/Stat5b.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Stat5b.Blood.tsv,http://dbarchive.bioscience...dbc.jp/kyushu-u/mm9/colo/Stat5b.Breast.tsv http://dbarchive.bioscience...dbc.jp/kyushu-u/mm9/colo/Blood.gml,http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Breast.gml ...
Deng, Bin; Parthasarathy, Sudharsan; Wang, WenFang; Gibney, Brian R; Battaile, Kevin P; Lovell, Scott; Benson, David R; Zhu, Hao
2010-09-24
NADH cytochrome b(5) oxidoreductase (Ncb5or) is found in animals and contains three domains similar to cytochrome b(5) (b(5)), CHORD-SGT1 (CS), and cytochrome b(5) reductase (b(5)R). Ncb5or has an important function, as suggested by the diabetes and lipoatrophy phenotypes in Ncb5or null mice. To elucidate the structural and functional properties of human Ncb5or, we generated its individual b(5) and b(5)R domains (Ncb5or-b(5) and Ncb5or-b(5)R, respectively) and compared them with human microsomal b(5) (Cyb5A) and b(5)R (Cyb5R3). A 1.25 Å x-ray crystal structure of Ncb5or-b(5) reveals nearly orthogonal planes of the imidazolyl rings of heme-ligating residues His(89) and His(112), consistent with a highly anisotropic low spin EPR spectrum. Ncb5or is the first member of the cytochrome b(5) family shown to have such a heme environment. Like other b(5) family members, Ncb5or-b(5) has two helix-loop-helix motifs surrounding heme. However, Ncb5or-b(5) differs from Cyb5A with respect to location of the second heme ligand (His(112)) and of polypeptide conformation in its vicinity. Electron transfer from Ncb5or-b(5)R to Ncb5or-b(5) is much less efficient than from Cyb5R3 to Cyb5A, possibly as a consequence of weaker electrostatic interactions. The CS linkage probably obviates the need for strong interactions between b(5) and b(5)R domains in Ncb5or. Studies with a construct combining the Ncb5or CS and b(5)R domains suggest that the CS domain facilitates docking of the b(5) and b(5)R domains. Trp(114) is an invariant surface residue in all known Ncb5or orthologs but appears not to contribute to electron transfer from the b(5)R domain to the b(5) domain.
International Nuclear Information System (INIS)
Sellers, M.T.; Corcoran, E.C.; Kelly, D.G.
2011-01-01
A delayed neutron counting (DNC) system for the analysis of special nuclear materials (SNM) has been constructed and calibrated at the Royal Military College of Canada. The polyethylene vials used to transport SNM samples have been found to contribute a time-dependent count rate, B(t), far above the system background. B(t) has been found to be independent of polyethylene mass and shows a dependence on irradiation position in the SLOWPOKE-2 reactor and irradiation time. A comparison of B(t) and the theoretical delayed neutron production from the fission of small amounts of 235 U has indicated that trace amounts of uranium may be present in the DNC system tubing. (author)
45 CFR 5b.11 - Exempt systems.
2010-10-01
... 45 Public Welfare 1 2010-10-01 2010-10-01 false Exempt systems. 5b.11 Section 5b.11 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION PRIVACY ACT REGULATIONS § 5b.11 Exempt systems. (a) General policy. The Act permits certain types of specific systems of records to be exempt from...
Directory of Open Access Journals (Sweden)
Pizzetti Paolo
2010-11-01
Full Text Available Abstract Background This report is the SOSORT Consensus Paper on Terminology for use in the treatment of conservative spinal deformities. Figures are provided and relevant literature is cited where appropriate. Methods The Delphi method was used to reach a preliminary consensus before the meeting, where the terms that still needed further clarification were discussed. Results A final agreement was found for all the terms, which now constitute the base of this glossary. New terms will be added after being discussed and accepted. Discussion When only one set of terms is used for communication in a place or among a group of people, then everyone can clearly and efficiently communicate. This principle applies for any professional group. Until now, no common set of terms was available in the field of the conservative treatment of scoliosis and spinal deformities. This glossary gives a common base language to draw from to discuss data, findings and treatment.
Directory of Open Access Journals (Sweden)
Dion Nkomo
2012-01-01
Full Text Available
This article proposes a lexicographical approach to the compilation of multilingual concept literacy glossaries which may play a very important role in supporting students at institutions of higher education. In order to support concept literacy, especially for students for whom English is not the native language, a number of universities in South Africa are compiling multilingual glossaries through which the use of languages other than English may be employed as auxiliary media. Terminologies in languages other than English are developed by translating English terms or coining new terms in these languages to exploit the native language competence of most students. The glossary project at the University of Cape Town (UCT which was conceived under the auspices of the Multilingualism Education Project (MEP is discussed. It is shown that the UCT glossaries are compiled using methods consistent with those employed in modern lexicography or proffered in lexicographical theory. The lexicographical function theory is specifically used to account for the glossaries and their production. It is suggested that modern lexicography can provide useful guidance for the production of glossaries, given that the earliest glossaries constitute the humble beginnings of lexicography.
Hierdie artikel stel 'n leksikografiese benadering tot die samestelling van meertaligekonsep-geletterheidswoordelyste voor wat 'n baie belangrike rol kan speel by die ondersteuning van studente by instellings vir hoër onderwys. Om konsepgeletterdheid te ondersteun, veral vir studente vir wie Engels nie die moedertaal is nie, stel 'n aantal universiteite in Suid-Afrika meertalige woordelyste saam waardeur die gebruik van ander tale as Engels as hulpmedia aangewend kan word. Terminologieë in ander tale as Engels word ontwikkel deur Engelse terme te vertaal of nuwe terme in hierdie tale te skep om die moedertaalvaardigheid van die meeste
Kim, Jung Sun; Gang, Ga Won; Lee, Se Ryun; Sung, Hwa Jung; Park, Young; Kim, Dae Sik; Choi, Chul Won; Kim, Byung Soo
2015-10-01
Developing a parameter to predict bone marrow invasion by non-Hodgkin's lymphoma is an important unmet medical need for treatment decisions. This study aimed to confirm the validity of the hypothesis that bone marrow plasma vascular endothelial growth factor level might be correlated with the risk of bone marrow involvement and the prognosis of patients with diffuse large B-cell non-Hodgkin's lymphoma. Forty-nine diffuse large B-cell lymphoma patients treated with rituximab, cyclophosphamide, daunorubicin, vincristine and prednisolone regimen were enrolled. Vascular endothelial growth factor level was measured with enzyme-linked immunosorbent assay. The validity of bone marrow plasma vascular endothelial growth factor level and bone marrow vascular endothelial growth factor level per platelet count for predicting treatment response and survival after initial rituximab, cyclophosphamide, daunorubicin, vincristine and prednisolone combined chemotherapy was assessed. Bone marrow plasma vascular endothelial growth factor level per platelet count was significantly associated with old age (≥ 65 years), poor performance score (≥ 2), high International prognosis index (≥ 3) and bone marrow invasion. The patients with high bone marrow plasma vascular endothelial growth factor level per platelet count (≥ 3.01) showed a significantly lower complete response rate than the others. On Kaplan-Meier survival curves, the patients with high bone marrow plasma vascular endothelial growth factor levels (≥ 655 pg/ml) or high bone marrow plasma vascular endothelial growth factor level per platelet count (≥ 3.01) demonstrated a significantly shorter overall survival and progression-free survival than the others. In the patients without bone marrow involvement, bone marrow plasma vascular endothelial growth factor level per platelet count had a significant relationship with overall survival and progression-free survival. Multivariate analysis revealed that the patients without
Fuller, Daniel; Buote, Richard; Stanley, Kevin
2017-11-01
The volume and velocity of data are growing rapidly and big data analytics are being applied to these data in many fields. Population and public health researchers may be unfamiliar with the terminology and statistical methods used in big data. This creates a barrier to the application of big data analytics. The purpose of this glossary is to define terms used in big data and big data analytics and to contextualise these terms. We define the five Vs of big data and provide definitions and distinctions for data mining, machine learning and deep learning, among other terms. We provide key distinctions between big data and statistical analysis methods applied to big data. We contextualise the glossary by providing examples where big data analysis methods have been applied to population and public health research problems and provide brief guidance on how to learn big data analysis methods. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2017. All rights reserved. No commercial use is permitted unless otherwise expressly granted.
Muc5b is required for airway defence
Roy, Michelle G.; Livraghi-Butrico, Alessandra; Fletcher, Ashley A.; McElwee, Melissa M.; Evans, Scott E.; Boerner, Ryan M.; Alexander, Samantha N.; Bellinghausen, Lindsey K.; Song, Alfred S.; Petrova, Youlia M.; Tuvim, Michael J.; Adachi, Roberto; Romo, Irlanda; Bordt, Andrea S.; Bowden, M. Gabriela; Sisson, Joseph H.; Woodruff, Prescott G.; Thornton, David J.; Rousseau, Karine; de La Garza, Maria M.; Moghaddam, Seyed J.; Karmouty-Quintana, Harry; Blackburn, Michael R.; Drouin, Scott M.; Davis, C. William; Terrell, Kristy A.; Grubb, Barbara R.; O'Neal, Wanda K.; Flores, Sonia C.; Cota-Gomez, Adela; Lozupone, Catherine A.; Donnelly, Jody M.; Watson, Alan M.; Hennessy, Corinne E.; Keith, Rebecca C.; Yang, Ivana V.; Barthel, Lea; Henson, Peter M.; Janssen, William J.; Schwartz, David A.; Boucher, Richard C.; Dickey, Burton F.; Evans, Christopher M.
2014-01-01
Respiratory surfaces are exposed to billions of particulates and pathogens daily. A protective mucus barrier traps and eliminates them through mucociliary clearance (MCC). However, excessive mucus contributes to transient respiratory infections and to the pathogenesis of numerous respiratory diseases. MUC5AC and MUC5B are evolutionarily conserved genes that encode structurally related mucin glycoproteins, the principal macromolecules in airway mucus. Genetic variants are linked to diverse lung diseases, but specific roles for MUC5AC and MUC5B in MCC, and the lasting effects of their inhibition, are unknown. Here we show that mouse Muc5b (but not Muc5ac) is required for MCC, for controlling infections in the airways and middle ear, and for maintaining immune homeostasis in mouse lungs, whereas Muc5ac is dispensable. Muc5b deficiency caused materials to accumulate in upper and lower airways. This defect led to chronic infection by multiple bacterial species, including Staphylococcus aureus, and to inflammation that failed to resolve normally. Apoptotic macrophages accumulated, phagocytosis was impaired, and interleukin-23 (IL-23) production was reduced in Muc5b-/- mice. By contrast, in mice that transgenically overexpress Muc5b, macrophage functions improved. Existing dogma defines mucous phenotypes in asthma and chronic obstructive pulmonary disease (COPD) as driven by increased MUC5AC, with MUC5B levels either unaffected or increased in expectorated sputum. However, in many patients, MUC5B production at airway surfaces decreases by as much as 90%. By distinguishing a specific role for Muc5b in MCC, and by determining its impact on bacterial infections and inflammation in mice, our results provide a refined framework for designing targeted therapies to control mucin secretion and restore MCC.
International Nuclear Information System (INIS)
Xie Chuntao
2007-01-01
Objective: To study the changes of serum IL-2, SIL-2R, TNF-α levels B lymphocytes count and T lyonphocyte subsets distribation type after treatment in patients with vitiligo. Methods: Serum IL-2, TNF-α (with RIA), SIL-2R (with ELISA) levels, B lymphocytes count and T subsets (with monoclonal antibody technique) were examined in 40 patients with vitiligo both before and after treatment as well as in 35 controls. Results: Before treatment, serum SIL-2R, TNF-α levels and B lymphocytes count were significantly higher than those in controls (P<0.01), while the serum IL-2, CD3, CD4 levels CD4/CD8 ratio were significantly lower(P<0.01). After treatment for 6 months, the data were greatly corrected but remanied significantly different from those in controls (P<0.05). Conclusion: Vitiligo is a kind of auto-immune diseases with abnormal immuno-regulation. (authors)
International Nuclear Information System (INIS)
Moraes, D.; Kaplon, J.; Nygard, E.
2008-01-01
This ASIC is a counting mode front-end electronic optimized for the readout of CdZnTe/CdTe and silicon sensors, for possible use in applications where the flux of ionizing radiation is high. The chip is implemented in 0.25 μm CMOS technology. The circuit comprises 128 channels equipped with a transimpedance amplifier followed by a gain shaper stage with 21 ns peaking time, two discriminators and two 18-bit counters. The channel architecture is optimized for the detector characteristics in order to achieve the best energy resolution at counting rates of up to 5 M counts/second. The amplifier shows a linear sensitivity of 118 mV/fC and an equivalent noise charge of about 711 e - , for a detector capacitance of 5 pF. Complete evaluation of the circuit is presented using electronic pulses and pixel detectors
20 CFR 418.3405 - What types of resources do we count?
2010-04-01
... of resources that are ordinarily liquid are stocks, bonds, mutual fund shares, promissory notes... workdays, we will not count it as a resource. (b) We count the equity value of real property as a resource...
Full Text Available ... Queue __count__/__total__ It’s YouTube. Uninterrupted. Loading... Want music and videos with zero ads? Get YouTube Red. ... 396 views 3:10 Wash 'Em - Hand Hygiene Music Video - Duration: 5:46. Thomas Jefferson University & Jefferson ...
Full Text Available ... Queue __count__/__total__ It’s YouTube. Uninterrupted. Loading... Want music and videos with zero ads? Get YouTube Red. ... 094 views 1:19 Wash 'Em - Hand Hygiene Music Video - Duration: 5:46. Jefferson Health 411,974 ...
Full Text Available ... Queue __count__/__total__ It’s YouTube. Uninterrupted. Loading... Want music and videos with zero ads? Get YouTube Red. ... 741 views 3:10 Wash 'Em - Hand Hygiene Music Video - Duration: 5:46. Jefferson Health 410,052 ...
Full Text Available ... Queue __count__/__total__ It’s YouTube. Uninterrupted. Loading... Want music and videos with zero ads? Get YouTube Red. ... 786 views 1:36 Wash 'Em - Hand Hygiene Music Video - Duration: 5:46. Jefferson Health 413,702 ...
Full Text Available ... Queue __count__/__total__ It’s YouTube. Uninterrupted. Loading... Want music and videos with zero ads? Get YouTube Red. ... 824 views 1:36 Wash 'Em - Hand Hygiene Music Video - Duration: 5:46. Jefferson Health 409,492 ...
Full Text Available ... Queue __count__/__total__ It’s YouTube. Uninterrupted. Loading... Want music and videos with zero ads? Get YouTube Red. ... 414 views 3:10 Wash 'Em - Hand Hygiene Music Video - Duration: 5:46. Thomas Jefferson University & Jefferson ...
Full Text Available ... Queue __count__/__total__ It’s YouTube. Uninterrupted. Loading... Want music and videos with zero ads? Get YouTube Red. ... 869 views 1:36 Wash 'Em - Hand Hygiene Music Video - Duration: 5:46. Jefferson Health 410,052 ...
Full Text Available ... Queue __count__/__total__ It’s YouTube. Uninterrupted. Loading... Want music and videos with zero ads? Get YouTube Red. ... 585 views 3:10 Wash 'Em - Hand Hygiene Music Video - Duration: 5:46. Jefferson Health 413,097 ...
Full Text Available ... Queue __count__/__total__ It’s YouTube. Uninterrupted. Loading... Want music and videos with zero ads? Get YouTube Red. ... 319 views 3:10 Wash 'Em - Hand Hygiene Music Video - Duration: 5:46. Jefferson Health 410,052 ...
Full Text Available ... Queue __count__/__total__ It’s YouTube. Uninterrupted. Loading... Want music and videos with zero ads? Get YouTube Red. ... 285 views 1:36 Wash 'Em - Hand Hygiene Music Video - Duration: 5:46. Jefferson Health 410,052 ...
Full Text Available ... Queue __count__/__total__ It’s YouTube. Uninterrupted. Loading... Want music and videos with zero ads? Get YouTube Red. ... 029 views 3:10 Wash 'Em - Hand Hygiene Music Video - Duration: 5:46. Jefferson Health 411,974 ...
Full Text Available ... Queue __count__/__total__ It’s YouTube. Uninterrupted. Loading... Want music and videos with zero ads? Get YouTube Red. ... 384 views 1:19 Wash 'Em - Hand Hygiene Music Video - Duration: 5:46. Thomas Jefferson University & Jefferson ...
Full Text Available ... Queue __count__/__total__ It’s YouTube. Uninterrupted. Loading... Want music and videos with zero ads? Get YouTube Red. ... 460 views 3:10 Wash 'Em - Hand Hygiene Music Video - Duration: 5:46. Thomas Jefferson University & Jefferson ...
Full Text Available ... Queue __count__/__total__ It’s YouTube. Uninterrupted. Loading... Want music and videos with zero ads? Get YouTube Red. ... 033 views 1:36 Wash 'Em - Hand Hygiene Music Video - Duration: 5:46. Jefferson Health 410,052 ...
Full Text Available ... Queue __count__/__total__ It’s YouTube. Uninterrupted. Loading... Want music and videos with zero ads? Get YouTube Red. ... 043 views 1:36 Wash 'Em - Hand Hygiene Music Video - Duration: 5:46. Jefferson Health 411,292 ...
Directory of Open Access Journals (Sweden)
YANG Zhiyun
2016-03-01
Full Text Available ObjectiveTo investigate the tumor features and the correlation between lymphocyte count and biochemical parameters in patients with hepatitis B virus-associated primary liver cancer (PLC with yin deficiency. MethodsA total of 148 PLC patients who were treated in Beijing Ditan Hospital, Capital Medical University, from July 2013 to February 2015 were enrolled and divided into yin-deficiency PLC group (52 patients and non-yin-deficiency PLC group (96 patients. The patients′ general information and laboratory markers were collected, including oncological parameters (alpha-fetoprotein, carcinoembryonic antigen (CEA, and carbohydrate antigen 199 (CA19-9, virological parameter (HBsAg, gross type (nodular type, massive type, bulky type, and diffuse type, radiological features (main portal vein diameter, portal vein tumor thrombus, and extrahepatic metastasis, biochemical parameters (Model for End-Stage Liver Disease (MELD score, white blood cell, red blood cell, platelet (PLT, alanine aminotransferase, aspartate aminotransferase, total bilirubin (TBil, gamma-glutamyl transpeptidase, alkaline phosphatase, albumin, cholinesterase, prothrombin time (PT, and prothrombin time activity (PTA, and lymphocyte count. The t-test was applied for comparison of normally distributed continuous data between groups, and the Pearson correlation analysis was applied for correlation analysis. The Mann-Whitney U test was applied for comparison of non-normally distributed continuous data between groups, and the Spearman correlation analysis was applied for correlation analysis. The chi-square test was applied for comparison of categorical data between groups. ResultsHBsAg showed a significant difference between the two groups (χ2=5.658, P=0.017. Compared with the non-yin-deficiency PLC group, the yin-deficiency PLC group had significantly increased CEA and CA19-9 (U=-2.200 and -2.194, both P<0.05, significantly increased MELD score, TBil, and PT (t=2.2, U=-2.0, U=-2
Peak shifts due to B(*)-B(*) rescattering in Υ(5S) dipion transitions
International Nuclear Information System (INIS)
Meng Ce; Chao Kuangta
2008-01-01
We study the energy distributions of dipion transitions Υ(5S) to Υ(1S,2S,3S)π + π - in the final-state rescattering model. Since the Υ(5S) is well above the open bottom thresholds, the dipion transitions are expected to mainly proceed through the real processes Υ(5S)→B ( * ) B ( * ) and B ( * ) B ( * ) →Υ(1S,2S,3S)π + π - . We find that the energy distributions of Υ(1S,2S,3S)π + π - markedly differ from that of Υ(5S)→B ( * ) B ( * ) . In particular, the resonance peak will be pushed up by about 7-20 MeV for these dipion transitions relative to the main hadronic decay modes. These predictions can be used to test the final-state rescattering mechanism in hadronic transitions for heavy quarkonia above the open flavor thresholds.
34 CFR 5b.10 - Parents and guardians.
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false Parents and guardians. 5b.10 Section 5b.10 Education Office of the Secretary, Department of Education PRIVACY ACT REGULATIONS § 5b.10 Parents and guardians. For the purpose of this part, a parent or guardian of any minor or the legal guardian or any...
Pixel-Cluster Counting Luminosity Measurement in ATLAS
McCormack, William Patrick; The ATLAS collaboration
2016-01-01
A precision measurement of the delivered luminosity is a key component of the ATLAS physics program at the Large Hadron Collider (LHC). A fundamental ingredient of the strategy to control the systematic uncertainties affecting the absolute luminosity has been to compare the measurements of several luminometers, most of which use more than one counting technique. The level of consistency across the various methods provides valuable cross-checks as well as an estimate of the detector-related systematic uncertainties. This poster describes the development of a luminosity algorithm based on pixel-cluster counting in the recently installed ATLAS inner b-layer (IBL), using data recorded during the 2015 pp run at the LHC. The noise and background contamination of the luminosity-associated cluster count is minimized by a multi-component fit to the measured cluster-size distribution in the forward pixel modules of the IBL. The linearity, long-term stability and statistical precision of the cluster-counting method are ...
Pixel-Cluster Counting Luminosity Measurement In ATLAS
AUTHOR|(SzGeCERN)782710; The ATLAS collaboration
2017-01-01
A precision measurement of the delivered luminosity is a key component of the ATLAS physics program at the Large Hadron Collider (LHC). A fundamental ingredient of the strategy to control the systematic uncertainties affecting the absolute luminosity has been to compare the measure- ments of several luminometers, most of which use more than one counting technique. The level of consistency across the various methods provides valuable cross-checks as well as an estimate of the detector-related systematic uncertainties. This poster describes the development of a luminosity algorithm based on pixel-cluster counting in the recently installed ATLAS inner b-layer (IBL), using data recorded during the 2015 pp run at the LHC. The noise and background contamination of the luminosity-associated cluster count is minimized by a multi-component fit to the measured cluster-size distribution in the forward pixel modules of the IBL. The linearity, long-term stability and statistical precision of the cluster- counting method a...
Borgwardt, Derek S.; Martin, Aaron D.; van Hemert, Jonathan R.; Yang, Jianyi; Fischer, Carol L.; Recker, Erica N.; Nair, Prashant R.; Vidva, Robinson; Chandrashekaraiah, Shwetha; Progulske-Fox, Ann; Drake, David; Cavanaugh, Joseph E.; Vali, Shireen; Zhang, Yang; Brogden, Kim A.
2014-01-01
Histatins are human salivary gland peptides with anti-microbial and anti-inflammatory activities. In this study, we hypothesized that histatin 5 binds to Porphyromonas gingivalis hemagglutinin B (HagB) and attenuates HagB-induced chemokine responses in human myeloid dendritic cells. Histatin 5 bound to immobilized HagB in a surface plasmon resonance (SPR) spectroscopy-based biosensor system. SPR spectroscopy kinetic and equilibrium analyses, protein microarray studies, and I-TASSER structural modeling studies all demonstrated two histatin 5 binding sites on HagB. One site had a stronger affinity with a KD1 of 1.9 μM and one site had a weaker affinity with a KD2 of 60.0 μM. Binding has biological implications and predictive modeling studies and exposure of dendritic cells both demonstrated that 20.0 μM histatin 5 attenuated (p < 0.05) 0.02 μM HagB-induced CCL3/MIP-1α, CCL4/MIP-1β, and TNFα responses. Thus histatin 5 is capable of attenuating chemokine responses, which may help control oral inflammation.
Kim, Catherine; Slaughter, James C; Wang, Erica T; Appiah, Duke; Schreiner, Pamela; Leader, Benjamin; Calderon-Margalit, Ronit; Sternfeld, Barbara; Siscovick, David; Wellons, Melissa
2017-08-01
To evaluate the ability of concentration of anti-Müllerian hormone (AMH), antral follicle count (AFC), and concentration of follicle stimulating hormone (FSH) to predict the onset of menopause. The Coronary Artery Risk Development in Young Adults Study (CARDIA) Women's Study was an ancillary study to CARDIA, a population-based study of adults aged 18-30 years followed for 3 decades. For this report, participants were women (n=426) who had attended the CARDIA year 15-16 (2000-2001) examination, had at least one ovary, were not pregnant, and underwent serum AMH and FSH measurement and transvaginal ultrasonography in 2002-2003. The probability of menopause in 5 years based upon AMH, FSH, and AFC. The mean age of the women at the time of AMH, FSH, and AFC assessment was 43 years. The cumulative incidence of menopause at 25 years (or follow-up) was 27% (n=426), and the incidence within 5 years was 13% (n=55). Among women aged 45-49 years, undetectable AMH concentrations were associated with a greater than 60% probability of menopause within 5 years, whereas approximately 1/3 of women with no or just one antral follicle experienced menopause within 5 years. Both low and high concentrations of FSH were associated with greater odds of menopause than intermediate concentrations. Models with multiple markers did not improve the prediction of menopause over that afforded by models with single markers. The ability to predict onset of menopause was improved with any of the three menopausal markers in addition to age. AMH concentrations were more closely associated with menopause than AFC or FSH. Copyright © 2017 Elsevier B.V. All rights reserved.
Theoretical study of the ionization of B2H5
International Nuclear Information System (INIS)
Curtiss, L.A.; Pople, J.A.
1989-01-01
Ab initio molecular orbital calculations at the G1 level of theory have been carried out on neutral B 2 H 5 radical, doubly bridged B 2 H + 5 cation, and the first triplet excited state of B 2 H + 5 . Singly bridged B 2 H 5 is 4.0 kcal/mol (without zero-point energies) more stable than doubly bridged B 2 H 5 . Based on this work and previous theoretical work on triply bridged B 2 H + 5 , ionization potentials (vertical and adiabatic) are determined for B 2 H 5 . The adiabatic ionization potentials of the two B 2 H 5 structures are 6.94 eV (singly bridged) and 7.53 eV (doubly bridged). A very large difference is found between the vertical and adiabatic ionization potentials (3.37 eV) of the singly bridged B 2 H 5 structure. The first triplet state of B 2 H + 5 is found to be 4.55 eV higher in energy than the lowest energy B 2 H + 5 cation (triply bridged). The results of this theoretical study support the interpretation of Ruscic, Schwarz, and Berkowitz of their recent photoionization measurements on B 2 H 5
Cortez-Lugo, Marlene; Escamilla-Núñez, Consuelo; Barraza-Villarreal, Albino; Texcalac-Sangrador, José Luis; Chow, Judith; Watson, John; Hernández-Cadena, Leticia; Romieu, Isabelle
2013-04-01
To study the relationship between light absorption measurements of PM2.5 at various distances from heavy traffic roads and diesel vehicle counts in Mexico City. PM2.5 samples were obtained from June 2003-June 2005 in three MCMA regions. Light absorption (b abs) in a subset of PM2.5 samples was determined. We evaluated the effect of distance and diesel vehicle counts to heavy traffic roads on PM2.5 b abs using generalized estimating equation models. Median PM2.5 b abs measurements significantly decrease as distance from heavy traffic roads increases (proads. Our model predicts that PM2.5 b abs measurements would increase by 20% (CI95% 3-38) as the hourly heavy diesel vehicle count increases by 150 per hour. PM2.5 b abs measurements are significantly associated with distance from motorways and traffic density and therefore can be used to assess human exposure to traffic-related emissions.
Kaushik, Mamta; Reddy, Pallavi; Sharma, Roshni; Udameshi, Pooja; Mehra, Neha; Marwaha, Aditya
2016-01-01
Oil pulling is an age-old practice that has gained modern popularity in promoting oral and systemic health. The scientific verification for this practice is insufficient. Thus, this study evaluated the effect of coconut oil pulling on the count of Streptococcus mutans in saliva and to compare its efficacy with that of Chlorhexidine mouthwash: in vivo. The null hypothesis was that coconut oil pulling has no effect on the bacterial count in saliva. A randomized controlled study was planned and 60 subjects were selected. The subjects were divided into three groups, Group A: Oil pulling, Group B: Chlorhexidine, and Group C: Distilled water. Group A subjects rinsed mouth with 10 ml of coconut oil for 10 minutes. Group B subjects rinsed mouth with 5 ml Chlorhexidine mouthwash for 1 minute and Group C with 5 ml distilled water for 1 minute in the morning before brushing. Saliva samples were collected and cultured on 1st day and after 2 weeks from all subjects. Colonies were counted to compare the efficacy of coconut oil and Chlorhexidine with distilled water. Statistically significant reduction in S. mutans count was seen in both the coconut oil pulling and Chlorhexidine group. Oil pulling can be explored as a safe and effective alternative to Chlorhexidine. Edible oil-pulling therapy is natural, safe and has no side effects. Hence, it can be considered as a preventive therapy at home to maintain oral hygiene.
B =5 Skyrmion as a two-cluster system
Gudnason, Sven Bjarke; Halcrow, Chris
2018-06-01
The classical B =5 Skyrmion can be approximated by a two-cluster system in which a B =1 Skyrmion is attached to a core B =4 Skyrmion. We quantize this system, allowing the B =1 to freely orbit the core. The configuration space is 11 dimensional but simplifies significantly after factoring out the overall spin and isospin degrees of freedom. We exactly solve the free quantum problem and then include an interaction potential between the Skyrmions numerically. The resulting energy spectrum is compared to the corresponding nuclei—the helium-5/lithium-5 isodoublet. We find approximate parity doubling not seen in the experimental data. In addition, we fail to obtain the correct ground-state spin. The framework laid out for this two-cluster system can readily be modified for other clusters and in particular for other B =4 n +1 nuclei, of which B =5 is the simplest example.
Malaysian B5 Implementation and Its Quality
International Nuclear Information System (INIS)
Liang, Y.C.; Loh, S.K.; Soon, L.W.; May, C.Y.
2016-01-01
A quality survey of 80 samples of diesel fuels (B5) from 80 retail stations throughout Peninsular Malaysia was performed. The bio diesel contents in these B5 samples were in the range of 4.61 vol. % to 5.33 vol. %. The water contents of the samples were < 200 mg kg -1 , meeting the stringent water requirements recommended by the car manufacturers. In addition, all the samples exhibited superior lubricity as indicated by a much shorter wear scar diameter compared to neat diesel. More importantly, 98 % of the samples passed the oxidation stability test (PetroOXY) with an induction period of > 65 min. Overall, the B5 diesel fuel sold was in full compliance with the Malaysian diesel fuel standard specification. (author)
Bronte-Tinkew, Jacinta; Horowitz, Allison; Redd, Zakia; Moore, Kristin A.; Valladares, Sherylls
2007-01-01
This glossary of common research and evaluation terms can serve as a quick reference guide for out-of school time practitioners as they face the challenges posed in this new era of program accountability. Subsequent briefs will provide more detailed information on particular types of research and evaluation designs. A list of additional resources…
Moraes, D; Nygård, E
2008-01-01
This ASIC is a counting mode front-end electronic optimized for the readout of CdZnTe/CdTe and silicon sensors, for possible use in applications where the flux of ionizing radiation is high. The chip is implemented in 0.25 μm CMOS technology. The circuit comprises 128 channels equipped with a transimpedance amplifier followed by a gain shaper stage with 21 ns peaking time, two discriminators and two 18-bit counters. The channel architecture is optimized for the detector characteristics in order to achieve the best energy resolution at counting rates of up to 5 M counts/second. The amplifier shows a linear sensitivity of 118 mV/fC and an equivalent noise charge of about 711 e−, for a detector capacitance of 5 pF. Complete evaluation of the circuit is presented using electronic pulses and pixel detectors.
Compton suppression gamma-counting: The effect of count rate
Millard, H.T.
1984-01-01
Past research has shown that anti-coincidence shielded Ge(Li) spectrometers enhanced the signal-to-background ratios for gamma-photopeaks, which are situated on high Compton backgrounds. Ordinarily, an anti- or non-coincidence spectrum (A) and a coincidence spectrum (C) are collected simultaneously with these systems. To be useful in neutron activation analysis (NAA), the fractions of the photopeak counts routed to the two spectra must be constant from sample to sample to variations must be corrected quantitatively. Most Compton suppression counting has been done at low count rate, but in NAA applications, count rates may be much higher. To operate over the wider dynamic range, the effect of count rate on the ratio of the photopeak counts in the two spectra (A/C) was studied. It was found that as the count rate increases, A/C decreases for gammas not coincident with other gammas from the same decay. For gammas coincident with other gammas, A/C increases to a maximum and then decreases. These results suggest that calibration curves are required to correct photopeak areas so quantitative data can be obtained at higher count rates. ?? 1984.
DEFF Research Database (Denmark)
Oulhote, Youssef; Shamim, Z; Kielsen, Katrine
2017-01-01
), and total mercury (Hg) were measured in maternal (n = 56) and children's blood at 18 months (n = 42) and 5 years (n = 54). We constructed latent functions for exposures at three different ages using factor analyses and applied structural equation models adjusted for covariates. Results Prenatal mercury....... In contrast, the 5-year PFASs concentrations were associated with higher basophil counts (B = 46% SD, 95% CI: 13, 79). Significantly reduced subpopulations of lymphocytes such as B cells, CD4-positive T helper cells and CD4 positive recent thymic emigrants may suggest cellular immunity effects...... and dysregulation of T-cell mediated immunity. Conclusion Developmental exposure to environmental immunotoxicants appears to have different impacts on WBC counts in childhood....
Directory of Open Access Journals (Sweden)
Phillip P. Allen
2014-05-01
Full Text Available Techniques that analyze biological remains from sediment sequences for environmental reconstructions are well established and widely used. Yet, identifying, counting, and recording biological evidence such as pollen grains remain a highly skilled, demanding, and time-consuming task. Standard procedure requires the classification and recording of between 300 and 500 pollen grains from each representative sample. Recording the data from a pollen count requires significant effort and focused resources from the palynologist. However, when an adaptation to the recording procedure is utilized, efficiency and time economy improve. We describe EcoCount, which represents a development in environmental data recording procedure. EcoCount is a voice activated fully customizable digital count sheet that allows the investigator to continuously interact with a field of view during the data recording. Continuous viewing allows the palynologist the opportunity to remain engaged with the essential task, identification, for longer, making pollen counting more efficient and economical. EcoCount is a versatile software package that can be used to record a variety of environmental evidence and can be installed onto different computer platforms, making the adoption by users and laboratories simple and inexpensive. The user-friendly format of EcoCount allows any novice to be competent and functional in a very short time.
International Nuclear Information System (INIS)
Junod, E.
1966-03-01
Part A and B: Since a radio-nuclide of short half-life is characterized essentially by the decrease in its activity even while it is being measured, the report begins by recalling the basic relationships linking the half-life the counting time, the counting rate and the number of particles recorded. The second part is devoted to the problem of corrections for counting losses due to the idle period of multichannel analyzers. Exact correction formulae have been drawn up for the case where the short half-life radionuclide is pure or contains only a long half-life radio-nuclide. By comparison, charts have been drawn up showing the approximations given by the so-called 'active time' counting and by the counting involving the real time associated with a measurement of the overall idle period, this latter method proving to be more valid than the former. A method is given for reducing the case of a complex mixture to that of a two-component mixture. Part C: The problems connected with the qualitative and quantitative analysis of the decay curves of a mixture of radioactive sources of which one at least has a short half-life are presented. A mathematical description is given of six basic processes for which some elements of Fortran programs are proposed. Two supplementary programs are drawn up for giving an overall treatment of problems of dosage in activation analysis: one on the basis of a simultaneous irradiation of the sample and of one or several known samples, the other with separate irradiation of the unknown and known samples, a dosimeter (activation, or external) being used for normalizing the irradiation flux conditions. (author) [fr
Delta count-rate monitoring system
International Nuclear Information System (INIS)
Van Etten, D.; Olsen, W.A.
1985-01-01
A need for a more effective way to rapidly search for gamma-ray contamination over large areas led to the design and construction of a very sensitive gamma detection system. The delta count-rate monitoring system was installed in a four-wheel-drive van instrumented for environmental surveillance and accident response. The system consists of four main sections: (1) two scintillation detectors, (2) high-voltage power supply amplifier and single-channel analyzer, (3) delta count-rate monitor, and (4) count-rate meter and recorder. The van's 6.5-kW generator powers the standard nuclear instrument modular design system. The two detectors are mounted in the rear corners of the van and can be run singly or jointly. A solid-state bar-graph count-rate meter mounted on the dashboard can be read easily by both the driver and passenger. A solid-state strip chart recorder shows trends and provides a permanent record of the data. An audible alarm is sounded at the delta monitor and at the dashboard count-rate meter if a detected radiation level exceeds the set background level by a predetermined amount
Rostami, Kamran; Marsh, Michael N; Johnson, Matt W; Mohaghegh, Hamid; Heal, Calvin; Holmes, Geoffrey; Ensari, Arzu; Aldulaimi, David; Bancel, Brigitte; Bassotti, Gabrio; Bateman, Adrian; Becheanu, Gabriel; Bozzola, Anna; Carroccio, Antonio; Catassi, Carlo; Ciacci, Carolina; Ciobanu, Alexandra; Danciu, Mihai; Derakhshan, Mohammad H; Elli, Luca; Ferrero, Stefano; Fiorentino, Michelangelo; Fiorino, Marilena; Ganji, Azita; Ghaffarzadehgan, Kamran; Going, James J; Ishaq, Sauid; Mandolesi, Alessandra; Mathews, Sherly; Maxim, Roxana; Mulder, Chris J; Neefjes-Borst, Andra; Robert, Marie; Russo, Ilaria; Rostami-Nejad, Mohammad; Sidoni, Angelo; Sotoudeh, Masoud; Villanacci, Vincenzo; Volta, Umberto; Zali, Mohammad R; Srivastava, Amitabh
2017-12-01
Counting intraepithelial lymphocytes (IEL) is central to the histological diagnosis of coeliac disease (CD), but no definitive 'normal' IEL range has ever been published. In this multicentre study, receiver operating characteristic (ROC) curve analysis was used to determine the optimal cut-off between normal and CD (Marsh III lesion) duodenal mucosa, based on IEL counts on >400 mucosal biopsy specimens. The study was designed at the International Meeting on Digestive Pathology, Bucharest 2015. Investigators from 19 centres, eight countries of three continents, recruited 198 patients with Marsh III histology and 203 controls and used one agreed protocol to count IEL/100 enterocytes in well-oriented duodenal biopsies. Demographic and serological data were also collected. The mean ages of CD and control groups were 45.5 (neonate to 82) and 38.3 (2-88) years. Mean IEL count was 54±18/100 enterocytes in CD and 13±8 in normal controls (p=0.0001). ROC analysis indicated an optimal cut-off point of 25 IEL/100 enterocytes, with 99% sensitivity, 92% specificity and 99.5% area under the curve. Other cut-offs between 20 and 40 IEL were less discriminatory. Additionally, there was a sufficiently high number of biopsies to explore IEL counts across the subclassification of the Marsh III lesion. Our ROC curve analyses demonstrate that for Marsh III lesions, a cut-off of 25 IEL/100 enterocytes optimises discrimination between normal control and CD biopsies. No differences in IEL counts were found between Marsh III a, b and c lesions. There was an indication of a continuously graded dose-response by IEL to environmental (gluten) antigenic influence. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2017. All rights reserved. No commercial use is permitted unless otherwise expressly granted.
... by kidney disease) RBC destruction ( hemolysis ) due to transfusion, blood vessel injury, or other cause Leukemia Malnutrition Bone ... slight risk any time the skin is broken) Alternative Names Erythrocyte count; Red blood cell count; Anemia - RBC count Images Blood test ...
Limit of sensitivity of low-background counting equipment
International Nuclear Information System (INIS)
Homann, S.G.
1991-01-01
The Hazards Control Department's Radiological Measurements Laboratory (RML) analyzes many types of sample media in support of the Laboratory's health and safety program. The Department has determined that the equation for the minimum limit of sensitivity, MDC(α,β) = 2.71 + 3.29 (r b t s ) 1/2 is also adequate for RML counting systems with very-low-background levels. This paper reviews the normal distribution case and address the special case of determining the limit of sensitivity of a counting system when the background count rate is well known and small. In the latter case, we must use an exact test procedure based on the binomial distribution. However, the error in using the normal distribution for calculating a detection system's limit of sensitivity is not significant even as the total observed number of counts approaches or equals zero. 2 refs., 4 figs
18 CFR 3b.5 - Legal guardians.
2010-04-01
... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Legal guardians. 3b.5... INFORMATION General § 3b.5 Legal guardians. For the purposes of this part, the parent of any minor, or the legal guardian of any individual who has been declared to be incompetent due to physical or mental...
Kollipara, Sireesha; Tatireddy, Shivakishore; Pathirathne, Thusitha; Rathnayake, Lasantha K; Northrup, Scott H
2016-08-25
Brownian dynamics (BD) simulations provide here a theoretical atomic-level treatment of the reduction of human ferric cytochrome b5 (cyt b5) by NADH-cytochrome b5 reductaste (cyt b5r) and several of its mutants. BD is used to calculate the second-order rate constant of electron transfer (ET) between the proteins for direct correlation with experiments. Interestingly, the inclusion of electrostatic forces dramatically increases the reaction rate of the native proteins despite the overall negative charge of both proteins. The role played by electrostatic charge distribution in stabilizing the ET complexes and the role of mutations of several amino acid residues in stabilizing or destabilizing the complexes are analyzed. The complex with the shortest ET reaction distance (d = 6.58 Å) from rigid body BD is further subjected to 1 ns of molecular dynamics (MD) in a periodic box of TIP3P water to produce a more stable complex allowed by flexibility and with a shorter average reaction distance d = 6.02 Å. We predict a docking model in which the following ion-ion interactions are dominant (cyt b5r/cyt b5): Lys162-Heme O1D/Lys163-Asp64/Arg91-Heme O1A/Lys125-Asp70.
The Relationship between Inner Product and Counting Cycles
DEFF Research Database (Denmark)
Sun, Xiaoming; Wang, Chengu; Yu, Wei
2012-01-01
lower bounds in the streaming model for the Connectivity, Bipartiteness and Girth problems [7]. The inner product variant we used has a quantum lower bound of Ω(nlogp(m)), where p(m) is the smallest prime factor of m. It implies that our lower bounds for Cycle-Counting and related problems still hold......Cycle-Counting is the following communication complexity problem: Alice and Bob each holds a permutation of size n with the promise there will be either a cycles or b cycles in their product. They want to distinguish between these two cases by communicating a few bits. We show that the quantum....../nondeterministic communication complexity is roughly Ω˜((n−b)/(b−a)) when a≡b(mod2) . It is proved by reduction from a variant of the inner product problem over ℤ m . It constructs a bridge for various problems, including In-Same-Cycle [10], One-Cycle [14], and Bipartiteness on constant degree graph [9]. We also give space...
Yu, Shaorong; Qin, Xiaobing; Chen, Tingting; Zhou, Leilei; Xu, Xiaoyue; Feng, Jifeng
2017-09-01
Systemic therapy with cytotoxic agents remains one of the main treatment methods for non-small-cell lung cancer (NSCLC). Cisplatin is a commonly used chemotherapeutic agent, that, when combined with other drugs, is an effective treatment for NSCLC. However, effective cancer therapy is hindered by a patient's resistance to cisplatin. Unfortunately, the potential mechanism underlying such resistance remains unclear. In this study, we explored the mechanism of microRNA-106b-5p (miR-106b-5p), which is involved in the resistance to cisplatin in the A549 cell line of NSCLC. Quantitative real-time PCR was used to test the expression of miR-106-5p in the A549 and the A549/DDP cell line of NSCLC. The cell counting kit-8 assay was used to detect cell viability. Flow cytometry was used to measure cell cycle and cell apoptosis. Luciferase reporter assays and western blot were performed to confirm whether polycystic kidney disease-2 (PKD2) is a direct target gene of miR-106b-5p. Immunohistochemistry was performed to examine the distribution of PKD2 expression in patients who are sensitive and resistant to cisplatin. The experiments indicated that the expression of miR-106b-5p was significantly decreased in A549/DDP compared with that in A549. MiR-106b-5p affected the tolerance of cells to cisplatin by negatively regulating PKD2. Upregulation of miR-106b-5p or downregulation of PKD2 expression can cause A549/DDP cells to become considerably more sensitive to cisplatin. The results showed that miR-106b-5p enhanced the sensitivity of A549/DDP cells to cisplatin by targeting the expression of PKD2. These findings suggest that the use of miR-106b-5p may be a promising clinical strategy in the treatment of NSCLC.
Counting on fine motor skills: links between preschool finger dexterity and numerical skills.
Fischer, Ursula; Suggate, Sebastian P; Schmirl, Judith; Stoeger, Heidrun
2017-10-26
Finger counting is widely considered an important step in children's early mathematical development. Presumably, children's ability to move their fingers during early counting experiences to aid number representation depends in part on their early fine motor skills (FMS). Specifically, FMS should link to children's procedural counting skills through consistent repetition of finger-counting procedures. Accordingly, we hypothesized that (a) FMS are linked to early counting skills, and (b) greater FMS relate to conceptual counting knowledge (e.g., cardinality, abstraction, order irrelevance) via procedural counting skills (i.e., one-one correspondence and correctness of verbal counting). Preschool children (N = 177) were administered measures of procedural counting skills, conceptual counting knowledge, FMS, and general cognitive skills along with parent questionnaires on home mathematics and fine motor environment. FMS correlated with procedural counting skills and conceptual counting knowledge after controlling for cognitive skills, chronological age, home mathematics and FMS environments. Moreover, the relationship between FMS and conceptual counting knowledge was mediated by procedural counting skills. Findings suggest that FMS play a role in early counting and therewith conceptual counting knowledge. © 2017 John Wiley & Sons Ltd.
Wnt5b-associated exosomes promote cancer cell migration and proliferation.
Harada, Takeshi; Yamamoto, Hideki; Kishida, Shosei; Kishida, Michiko; Awada, Chihiro; Takao, Toshifumi; Kikuchi, Akira
2017-01-01
Wnt5b is a member of the same family of proteins as Wnt5a, the overexpression of which is associated with cancer aggressiveness. Wnt5b is also suggested to be involved in cancer progression, however, details remain unclarified. We analyzed the biochemical properties of purified Wnt5b and the mode of secretion of Wnt5b by cancer cells. Wnt5b was glycosylated at three asparagine residues and lipidated at one serine residue, and these post-translational modifications of Wnt5b were essential for secretion. Purified Wnt5b showed Dvl2 phosphorylation and Rac activation abilities to a similar extent as Wnt5a. In cultured-cell conditioned medium, Wnt5b was detected in supernatant or precipitation fractions that were separated by centrifugation at 100 000 g. In PANC-1 pancreatic cancer cells, 55% of secreted endogenous Wnt5b was associated with exosomes. Exosomes from wild-type PANC-1 cells, but not those from Wnt5b-knockout PANC-1 cells, activated Wnt5b signaling in CHO cells and stimulated migration and proliferation of A549 lung adenocarcinoma cells, suggesting that endogenous, Wnt5b-associated exosomes are active. The exosomes were taken up by CHO cells and immunoelectron microscopy revealed that Wnt5b is indeed associated with exosomes. In Caco-2 colon cancer cells, most Wnt5b was recovered in precipitation fractions when Wnt5b was ectopically expressed (Caco-2/Wnt5b cells). Knockdown of TSG101, an exosome marker, decreased the secretion of Wnt5b-associated exosomes from Caco-2/Wnt5b cells and inhibited Wnt5b-dependent cell proliferation. Exosomes secreted from Caco-2/Wnt5b cells stimulated migration and proliferation of A549 cells. These results suggest that Wnt5b-associated exosomes promote cancer cell migration and proliferation in a paracrine manner. © 2016 The Authors. Cancer Science published by John Wiley & Sons Australia, Ltd on behalf of Japanese Cancer Association.
Energy Technology Data Exchange (ETDEWEB)
Dekeyser, W.; Baelmans, M; Voskoboynikov, S.; Rozhansky, V.; Reiter, D.; Wiesen, S.; Kotov, V.; Boerner, P.
2011-01-15
ITER-IO currently (and since about 15 years) employs the SOLPS4.xxx code for its divertor design, currently version SOLPS4.3. SOLPS.xxx is a special variant of the B2-EIRENE code, which was originally developed by an European consortium (FZ Juelich, AEA Culham, ERM Belgium/KU Leuven) in the late eighties and early nineties of the last century under NET contracts. Until today even the very similar edge plasma codes within the SOLPS family, if run on a seemingly identical choice of physical parameters, still sometimes disagree significantly with each other. It is obvious that in computational engineering applications, as they are carried out for the various ITER divertor aspects with SOLPS4.3 for more than a decade now, any transition from one to another code must be fully backward compatible, or, at least, the origin of differences in the results must be identified and fully understood quantitatively. In this report we document efforts undertaken in 2010 to ultimately eliminate the third issue. For the kinetic EIRENE part within SOLPS this backward compatibility (back until 1996) was basically achieved (V. Kotov, 2004-2006) and SOLPS4.3 is now essentially up to date with the current EIRENE master maintained at FZ Juelich. In order to achieve a similar level of reproducibility for the plasma fluid (B2, B2.5) part, we follow a similar strategy, which is quite distinct from the previous SOLPS benchmark attempts: the codes are ''disintegrated'' and pieces of it are run on smallest (i.e. simplest) problems. Only after full quantitative understanding is achieved, the code model is enlarged, integrated, piece by piece again, until, hopefully, a fully backward compatible B2 / B2.5 ITER edge plasma simulation will be achieved. The status of this code dis-integration effort and its findings until now (Nov. 2010) are documented in the present technical note. This work was initiated in a small workshop by the three partner teams of KU Leuven, St. Petersburg
International Nuclear Information System (INIS)
Mebel', A.M.; Charkin, O.P.
1991-01-01
Nonempirical calculations of sections of potential surface (PS) along the shortest way of reaction of hydrogen interaction with different active centres in AlB 5 H 5 - cluster were conducted. Mechanisms of reactions of valent-saturated hydrides (BH, AlH) and clusters (B 6 H 5 - , AlB 5 H 5 - ) with molecular hydrogen are correlated. Qualitative model enabling to form an opinion about the presence or the absence of barrier on PS of the shortest way of reactions of breaking σ-bond of H-H type on the active centre of cluster, is suggested. The model is based on analysis of the character of canonical MO reagents and products
Remarks on broken chiral SU(5) x SU(5) symmetry and B mesons
International Nuclear Information System (INIS)
Kim, D.Y.; Sinha, S.N.
1985-01-01
In a recent paper, Hatzis has estimated the masses and weak decay constants of b-flavored pseudoscalar mesons in a broken chiral SU(5) x SU(5) symmetry method. The estimated weak decay constant of B meson, f sub(B) f sub(K)(f sub(B)/f sub(K) approximately equal to 1.4) evaluated by Mathur et al. with the quantum chromodynamics (QCD) sum-rule model. We re-examined the problem applying the broken chiral SU(5) x SU(5) symmetry approach using a set of mass formulae. With this method we estimate the symmetry-breaking parameters and decay constants of pseudoscalar mesons. We found a consistent result for the decay constant: f sub(K) < or approximately equal to f sub(D) < or approximately equal to f sub(B). The explicit numerical value of these constants, however, are lower than that of the QCD sum rule. This may be due to the limited validity of the broken chiral symmetry approach for heavy mesons
Energy Technology Data Exchange (ETDEWEB)
Cheng, Z; Zheng, X; Deen, J; Peng, H [McMaster University, Hamilton, ON (Canada); Xing, L [Stanford University School of Medicine, Stanford, CA (United States)
2016-06-15
Purpose: Silicon photomultiplier (SiPM) has recently emerged as a promising photodetector for biomedical imaging applications. Due to its high multiplication gain (comparable to PMT), fast timing, low cost and compactness, it is considered a good candidate for photon counting CT. Dark noise is a limiting factor which impacts both energy resolution and detection dynamic range. Our goal is to develop a comprehensive model for noise sources for SiPM sensors. Methods: The physical parameters used in this work were based upon a test SPAD fabricated in 130nm CMOS process. The SPAD uses an n+/p-well junction, which is isolated from the p-substrate by a deep n-well junction. Inter-avalanche time measurement was used to record the time interval between two adjacent avalanche pulses. After collecting 1×106 counts, the histogram was obtained and multiple exponential fitting process was used to extract the lifetime associated with the traps within the bandgap. Results: At room temperature, the breakdown voltage of the SPAD is ∼11.4V and shows a temperature coefficient of 7.7mV/°C. The dark noise of SPAD increases with both the excess biasing voltage and temperature. The primary dark counts from the model were validated against the measurement results. A maximum relative error of 8.7% is observed at 20 °C with an excess voltage of 0.5V. The probabilities of after-pulsing are found to be dependent of both temperature and excess voltage. With 0.5V excess voltage, the after-pulsing probability is 63.5% at - 30 °C and drops to ∼6.6% at 40 °C. Conclusion: A comprehensive noise model for SPAD sensor was proposed. The model takes into account of static, dynamic and statistical behavior of SPADs. We believe that this is the first SPAD circuit simulation model that includes the band-to-band tunneling dark noise contribution and temporal dependence of the after-pulsing probability.
Biochemical characterization of a haloalkane dehalogenase DadB from Alcanivorax dieselolei B-5.
Directory of Open Access Journals (Sweden)
Anzhang Li
Full Text Available Recently, we found that Alcanivorax bacteria from various marine environments were capable of degrading halogenated alkanes. Genome sequencing of A. dieselolei B-5 revealed two putative haloalkane dehalogenase (HLD genes, which were supposed to be involved in degradation of halogenated compounds. In this report, we confirm for the first time that the Alcanivorax bacterium encodes a truly functional HLD named DadB. An activity assay with 46 halogenated substrates indicated that DadB possesses broad substrate range and has the highest overall activity among the identified HLDs. DadB prefers brominated substrates; chlorinated alkenes; and the C2-C3 substrates, including the persistent pollutants of 1,2-dichloroethane, 1,2-dichloropropane and 1,2,3-trichloropropane. As DadB displays no detectable activity toward long-chain haloalkanes such as 1-chlorohexadecane and 1-chlorooctadecane, the degradation of them in A. dieselolei B-5 might be attributed to other enzymes. Kinetic constants were determined with 6 substrates. DadB has highest affinity and largest k cat/K m value toward 1,3-dibromopropane (K(m = 0.82 mM, k(cat/K(m = 16.43 mM(-1 · s(-1. DadB aggregates fast in the buffers with pH ≤ 7.0, while keeps stable in monomer form when pH ≥ 7.5. According to homology modeling, DadB has an open active cavity with a large access tunnel, which is supposed important for larger molecules as opposed to C2-C3 substrates. Combined with the results for other HLDs, we deduce that residue I247 plays an important role in substrate selection. These results suggest that DadB and its host, A. dieselolei B-5, are of potential use for biocatalysis and bioremediation applications.
Biochemical characterization of a haloalkane dehalogenase DadB from Alcanivorax dieselolei B-5.
Li, Anzhang; Shao, Zongze
2014-01-01
Recently, we found that Alcanivorax bacteria from various marine environments were capable of degrading halogenated alkanes. Genome sequencing of A. dieselolei B-5 revealed two putative haloalkane dehalogenase (HLD) genes, which were supposed to be involved in degradation of halogenated compounds. In this report, we confirm for the first time that the Alcanivorax bacterium encodes a truly functional HLD named DadB. An activity assay with 46 halogenated substrates indicated that DadB possesses broad substrate range and has the highest overall activity among the identified HLDs. DadB prefers brominated substrates; chlorinated alkenes; and the C2-C3 substrates, including the persistent pollutants of 1,2-dichloroethane, 1,2-dichloropropane and 1,2,3-trichloropropane. As DadB displays no detectable activity toward long-chain haloalkanes such as 1-chlorohexadecane and 1-chlorooctadecane, the degradation of them in A. dieselolei B-5 might be attributed to other enzymes. Kinetic constants were determined with 6 substrates. DadB has highest affinity and largest k cat/K m value toward 1,3-dibromopropane (K(m) = 0.82 mM, k(cat)/K(m) = 16.43 mM(-1) · s(-1)). DadB aggregates fast in the buffers with pH ≤ 7.0, while keeps stable in monomer form when pH ≥ 7.5. According to homology modeling, DadB has an open active cavity with a large access tunnel, which is supposed important for larger molecules as opposed to C2-C3 substrates. Combined with the results for other HLDs, we deduce that residue I247 plays an important role in substrate selection. These results suggest that DadB and its host, A. dieselolei B-5, are of potential use for biocatalysis and bioremediation applications.
Graphite nodule count and size distribution in thin-walled ductile cast iron
DEFF Research Database (Denmark)
Pedersen, Karl Martin; Tiedje, Niels Skat
2008-01-01
Graphite nodule count and size distribution have been analysed in thin walled ductile cast iron. The 2D nodule counts have been converted into 3D nodule count by using Finite Difference Method (FDM). Particles having a diameter smaller than 5 µm should be neglected in the nodule count as these ar......Graphite nodule count and size distribution have been analysed in thin walled ductile cast iron. The 2D nodule counts have been converted into 3D nodule count by using Finite Difference Method (FDM). Particles having a diameter smaller than 5 µm should be neglected in the nodule count...... as these are inclusions and micro porosities that do not influence the solidification morphology. If there are many small graphite nodules as in thin walled castings only 3D nodule count calculated by FDM will give reliable results. 2D nodule count and 3D nodule count calculated by simple equations will give too low...
Assembly and Regulation of the Membrane Attack Complex Based on Structures of C5b6 and sC5b9
Directory of Open Access Journals (Sweden)
Michael A. Hadders
2012-03-01
Full Text Available Activation of the complement system results in formation of membrane attack complexes (MACs, pores that disrupt lipid bilayers and lyse bacteria and other pathogens. Here, we present the crystal structure of the first assembly intermediate, C5b6, together with a cryo-electron microscopy reconstruction of a soluble, regulated form of the pore, sC5b9. Cleavage of C5 to C5b results in marked conformational changes, distinct from those observed in the homologous C3-to-C3b transition. C6 captures this conformation, which is preserved in the larger sC5b9 assembly. Together with antibody labeling, these structures reveal that complement components associate through sideways alignment of the central MAC-perforin (MACPF domains, resulting in a C5b6-C7-C8β-C8α-C9 arc. Soluble regulatory proteins below the arc indicate a potential dual mechanism in protection from pore formation. These results provide a structural framework for understanding MAC pore formation and regulation, processes important for fighting infections and preventing complement-mediated tissue damage.
An automated cell-counting algorithm for fluorescently-stained cells in migration assays
Directory of Open Access Journals (Sweden)
Novielli Nicole M
2011-10-01
Full Text Available Abstract A cell-counting algorithm, developed in Matlab®, was created to efficiently count migrated fluorescently-stained cells on membranes from migration assays. At each concentration of cells used (10,000, and 100,000 cells, images were acquired at 2.5 ×, 5 ×, and 10 × objective magnifications. Automated cell counts strongly correlated to manual counts (r2 = 0.99, P
International Nuclear Information System (INIS)
McLaughlin, P.K.
1986-05-01
This document summarizes the modifications made to the ENDF/B-5 evaluated neutron data files in 1986. The new versions of the files are available from the IAEA Nuclear Data Section upon request, costfree, on magnetic tape. (author)
Heterogeneous counting on filter support media
International Nuclear Information System (INIS)
Long, E.; Kohler, V.; Kelly, M.J.
1976-01-01
Many investigators in the biomedical research area have used filter paper as the support for radioactive samples. This means that a heterogeneous counting of sample sometimes results. The count rate of a sample on a filter will be affected by positioning, degree of dryness, sample application procedure, the type of filter, and the type of cocktail used. Positioning of the filter (up or down) in the counting vial can cause a variation of 35% or more when counting tritiated samples on filter paper. Samples of varying degrees of dryness when added to the counting cocktail can cause nonreproducible counts if handled improperly. Count rates starting at 2400 CPM initially can become 10,000 CPM in 24 hours for 3 H-DNA (deoxyribonucleic acid) samples dried on standard cellulose acetate membrane filters. Data on cellulose nitrate filters show a similar trend. Sample application procedures in which the sample is applied to the filter in a small spot or on a large amount of the surface area can cause nonreproducible or very low counting rates. A tritiated DNA sample, when applied topically, gives a count rate of 4,000 CPM. When the sample is spread over the whole filter, 13,400 CPM are obtained with a much better coefficient of variation (5% versus 20%). Adding protein carrier (bovine serum albumin-BSA) to the sample to trap more of the tritiated DNA on the filter during the filtration process causes a serious beta absorption problem. Count rates which are one-fourth the count rate applied to the filter are obtained on calibrated runs. Many of the problems encountered can be alleviated by a proper choice of filter and the use of a liquid scintillation cocktail which dissolves the filter. Filter-Solv has been used to dissolve cellulose nitrate filters and filters which are a combination of cellulose nitrate and cellulose acetate. Count rates obtained for these dissolved samples are very reproducible and highly efficient
26 CFR 301.7701(b)-9 - Effective/applicability dates of §§ 301.7701(b)-1 through 301.7701(b)-7.
2010-04-01
... years, see §§ 1.871-2 through 1.871-5 of this chapter. (b) Special rules—(1) Green card test-residency... green card test in 1985, be considered a resident of the United States as of January 1, 1985, regardless..., days of presence in 1984 will only be counted for aliens who had been residents under prior law (§§ 1...
Directory of Open Access Journals (Sweden)
Mojtaba Jafari
2016-02-01
Full Text Available Background and Objectives: The purpose of the present study was to investigate effects of various heat shock conditions and fast freezing and subsequent thawing on the viability and recovery of Bacillus coagulans and Bacillus subtilis as probiotic sporeformers, and also to compare spore plate and microscopic counts. Materials and Methods: After preparing the final suspensions of B. coagulans and Bacillus subtilis subsp. Natto spores, they were spread-plated before and after fast freezing treatment (-70°C for about 1 min. Heat shock treatments of the spores were carried out at 68oC for 15, 20, and 30 min as well as at 80oC for 10 and 15 min. Concentrations of the examined probiotic sporeformers were determined simultaneously by plate enumerations and microscopically determined counts. Student’s t-test and one-way analysis of variance (ANOVA of SPSS were used for statistical analysis of the data. Analysis of DoE results was carried out using Minitab. Results: The results presented here show that the highest recovery rates for B. coagulans (14.75 log CFU/mL and B. subtilis spores (14.80 log CFU/mL were under a heat shock condition of 68°C for 20 min in nutrient agar (p<0.05. In addition, the survival rates of B. coagulans and B. subtilis spores under the fast freezing and subsequent thawing condition were about 90% and 88%, respectively. Plate counts differed significantly from counts determined microscopically, with differences of almost 0.5 and 0.8 log for B. coagulans and B. subtilis spores, respectively (p<0.05. In addition, DoE results of the study revealed that both factors of spore count method and only freezing factor in fast freezing treatment have a significant effect on concentrations of the spores examined (p<0.05. Conclusions: Heat shock conditions, freezing and subsequent thawing circumstances, and plate counts or enumerations determined microscopically have significant influences on the viability of probiotic sporeformers and
Energy Technology Data Exchange (ETDEWEB)
Huo, Wen-Sheng [Xinjiang University, Department of Physics, Ueruemqi (China); Chen, Guo-Ying [Xinjiang University, Department of Physics, Ueruemqi (China); Institute of Theoretical Physics, Chinese Academy of Sciences, State Key Laboratory of Theoretical Physics, Beijing (China)
2016-03-15
With a combined analysis of data on Υ(5S) → h{sub b}(1P, 2P)π{sup +}π{sup -} and Υ(5S) → B{sup (*)} anti B{sup (*)}π in an effective field theory approach, we determine resonance parameters of Z{sub b} states in two scenarios. In one scenario we assume that Z{sub b} states are pure molecular states, while in the other one we assume that Z{sub b} states contain compact components. We find that the present data favor that there should be some compact components inside Z{sub b}{sup (')} associated with themolecular components. By fitting the invariant mass spectra of Υ(5S) → h{sub b}(1P, 2P)π{sup +}π{sup -} and Υ(5S) → B{sup (*)} anti B{sup *}π, we determine that the probability of finding the compact components in Z{sub b} states may be as large as about 40 %. (orig.)
Counting statistics in low level radioactivity measurements fluctuating counting efficiency
International Nuclear Information System (INIS)
Pazdur, M.F.
1976-01-01
A divergence between the probability distribution of the number of nuclear disintegrations and the number of observed counts, caused by counting efficiency fluctuation, is discussed. The negative binominal distribution is proposed to describe the probability distribution of the number of counts, instead of Poisson distribution, which is assumed to hold for the number of nuclear disintegrations only. From actual measurements the r.m.s. amplitude of counting efficiency fluctuation is estimated. Some consequences of counting efficiency fluctuation are investigated and the corresponding formulae are derived: (1) for detection limit as a function of the number of partial measurements and the relative amplitude of counting efficiency fluctuation, and (2) for optimum allocation of the number of partial measurements between sample and background. (author)
Directory of Open Access Journals (Sweden)
Remco Bouckaert
2017-08-01
Full Text Available Background Indigenous populations of the circumpolar Arctic are considered to be endemically infected (>2% prevalence with hepatitis B virus (HBV, with subgenotype B5 (formerly B6 unique to these populations. The distinctive properties of HBV/B5, including high nucleotide diversity yet no significant liver disease, suggest virus adaptation through long-term host-pathogen association. Methods To investigate the origin and evolutionary spread of HBV/B5 into the circumpolar Arctic, fifty-seven partial and full genome sequences from Alaska, Canada and Greenland, having known location and sampling dates spanning 40 years, were phylogeographically investigated by Bayesian analysis (BEAST 2 using a reversible-jump-based substitution model and a clock rate estimated at 4.1 × 10−5 substitutions/site/year. Results Following an initial divergence from an Asian viral ancestor approximately 1954 years before present (YBP; 95% highest probability density interval [1188, 2901], HBV/B5 coalescence occurred almost 1000 years later. Surprisingly, the HBV/B5 ancestor appears to locate first to Greenland in a rapid coastal route progression based on the landscape aware geographic model, with subsequent B5 evolution and spread westward. Bayesian skyline plot analysis demonstrated an HBV/B5 population expansion occurring approximately 400 YBP, coinciding with the disruption of the Neo-Eskimo Thule culture into more heterogeneous and regionally distinct Inuit populations throughout the North American Arctic. Discussion HBV/B5 origin and spread appears to occur coincident with the movement of Neo-Eskimo (Inuit populations within the past 1000 years, further supporting the hypothesis of HBV/host co-expansion, and illustrating the concept of host-pathogen adaptation and balance.
ENDF/B-5. Fission Product Yields File
International Nuclear Information System (INIS)
Schwerer, O.
1985-10-01
The ENDF/B-5 Fission Product Yields File contains a complete set of independent and cumulative fission product yields, representing the final data from ENDF/B-5 as received at the IAEA Nuclear Data Section in June 1985. Yields for 11 fissioning nuclides at one or more neutron incident energies are included. The data are available costfree on magnetic tape from the IAEA Nuclear Data Section. (author). 4 refs
Quality control of radiation counting systems and measurement of minimum detectable activity
International Nuclear Information System (INIS)
Song, Byoung Chul; Han, Sung Sim; Kim, Young Bok; Jee, Kwang Yong; Sohn, Se Chul
2004-01-01
Various radiation counters have been using to determine radioactivity of radwastes for disposal. A radiation counting system was set up using a radiation detector chosen in this study and its stability was investigated through the periodic determination of background and counting efficiencies in accordance with a quality control program to increase the confidence level. The average background level for the γ-spectrometer was 1.59 cps and the average counting level for the standard sample was 45248 dps within 20 confidence levels. The average alpha background level for the low background α/β counting system was 0.31 cpm and the efficiency for alpha counting was 34.38 %. The average beta background level for the α/β counting system was 1.30 cpm and the efficiency for beta counting was 46.5%. The background level in the region of 3H and 14C for the liquid scintillation counting system was 2.52 and 3.31 cpm and the efficiency for alpha counting was 58.5 and 95.6%, respectively. The minimum detectable activity for the γ-spectrometer was found to be 3.2 Bq/mL and 3.8 Bq/mL for the liquid scintillation counter, and 20.5 and 23.0 Bq/mL, respectively for the α and β counting system
A glossary of policy frameworks: the many forms of 'universalism' and policy 'targeting'.
Carey, Gemma; Crammond, Brad
2017-03-01
The recognition that certain characteristics (such as poverty, disadvantage or membership of marginalised social or cultural groups) can make individuals more susceptible to illness has reignited interest in how to combine universal programmes and policies with ones targeted at specific groups. However, 'universalism' and 'targeting' are used in different ways for different purposes. In this glossary, we define different types and approaches to universalism and targeting. We anticipate that greater clarity in relation to what is meant by 'universalism' and 'targeting' will lead to a more nuanced debate and practice in this area. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/.
Harschneck, Tobias; Zhou, Nanjia; Manley, Eric F; Lou, Sylvia J; Yu, Xinge; Butler, Melanie R; Timalsina, Amod; Turrisi, Riccardo; Ratner, Mark A; Chen, Lin X; Chang, Robert P H; Facchetti, Antonio; Marks, Tobin J
2014-04-21
The influence of solubilizing substituents on the photovoltaic performance and thin-film blend morphology of new benzo[1,2-b:6,5-b']dithiophene (bBDT) based small molecule donor semiconductors is investigated. Solar cells based on bBDT(TDPP)2-PC71BM with two different types of side chains exhibit high power conversion efficiencies, up to 5.53%.
Metal ion levels and lymphocyte counts
DEFF Research Database (Denmark)
Penny, Jeannette Ø; Varmarken, Jens-Erik; Ovesen, Ole
2013-01-01
BACKGROUND AND PURPOSE: Wear particles from metal-on-metal arthroplasties are under suspicion for adverse effects both locally and systemically, and the DePuy ASR Hip Resurfacing System (RHA) has above-average failure rates. We compared lymphocyte counts in RHA and total hip arthroplasty (THA) an....../ppb. INTERPRETATION: Circulating T-lymphocyte levels may decline after surgery, regardless of implant type. Metal ions-particularly cobalt-may have a general depressive effect on T- and B-lymphocyte levels. Registered with ClinicalTrials.gov under # NCT01113762.......BACKGROUND AND PURPOSE: Wear particles from metal-on-metal arthroplasties are under suspicion for adverse effects both locally and systemically, and the DePuy ASR Hip Resurfacing System (RHA) has above-average failure rates. We compared lymphocyte counts in RHA and total hip arthroplasty (THA....... RESULTS: The T-lymphocyte counts for both implant types declined over the 2-year period. This decline was statistically significant for CD3(+)CD8(+) in the THA group, with a regression coefficient of -0.04 × 10(9)cells/year (95% CI: -0.08 to -0.01). Regression analysis indicated a depressive effect...
Determining random counts in liquid scintillation counting
International Nuclear Information System (INIS)
Horrocks, D.L.
1979-01-01
During measurements involving coincidence counting techniques, errors can arise due to the detection of chance or random coincidences in the multiple detectors used. A method and the electronic circuits necessary are here described for eliminating this source of error in liquid scintillation detectors used in coincidence counting. (UK)
Kebede, Mihiretu; Zegeye, Desalegn Tigabu; Zeleke, Berihun Megabiaw
2017-12-01
To monitor the progress of therapy and disease progression, periodic CD4 counts are required throughout the course of HIV/AIDS care and support. The demand for CD4 count measurement is increasing as ART programs expand over the last decade. This study aimed to predict CD4 count changes and to identify the predictors of CD4 count changes among patients on ART. A cross-sectional study was conducted at the University of Gondar Hospital from 3,104 adult patients on ART with CD4 counts measured at least twice (baseline and most recent). Data were retrieved from the HIV care clinic electronic database and patients` charts. Descriptive data were analyzed by SPSS version 20. Cross-Industry Standard Process for Data Mining (CRISP-DM) methodology was followed to undertake the study. WEKA version 3.8 was used to conduct a predictive data mining. Before building the predictive data mining models, information gain values and correlation-based Feature Selection methods were used for attribute selection. Variables were ranked according to their relevance based on their information gain values. J48, Neural Network, and Random Forest algorithms were experimented to assess model accuracies. The median duration of ART was 191.5 weeks. The mean CD4 count change was 243 (SD 191.14) cells per microliter. Overall, 2427 (78.2%) patients had their CD4 counts increased by at least 100 cells per microliter, while 4% had a decline from the baseline CD4 value. Baseline variables including age, educational status, CD8 count, ART regimen, and hemoglobin levels predicted CD4 count changes with predictive accuracies of J48, Neural Network, and Random Forest being 87.1%, 83.5%, and 99.8%, respectively. Random Forest algorithm had a superior performance accuracy level than both J48 and Artificial Neural Network. The precision, sensitivity and recall values of Random Forest were also more than 99%. Nearly accurate prediction results were obtained using Random Forest algorithm. This algorithm could be
Superconducting state in (W, Ta)5SiB2
Fukuma, M.; Kawashima, K.; Akimitsu, J.
We characterize the superconducting state in a boro-silicide (W, Ta)5SiB2, with Tc of 6.5 K by means of magnetization, electrical resistivity, and specific heat measurements. As x increased, the transition temperature Tc abruptly enhances from 5.8 to 6.5 K. The magnetization versus magnetic field (M-H) curve indicated that (W, Ta)5SiB2 was a conventional type-II superconductor. The estimated lower critical field Hc1(0) and upper critical field Hc2(T) are about 121 Oe and 14.7 kOe, respectively. The penetration depth λ(0) and coherence length ξ(0) are calculated to be approximately 369 and 14.9 nm, respectively, using Ginzburg-Landau (GL) equations. Specific heat data shows the superconductivity in W4.5Ta0.5SiB2 belongs to a week-coupling BCS superconductor. Finally, we discuss the increasing of Tc in of (W, Ta)5SiB2 system.
Energy Technology Data Exchange (ETDEWEB)
Kinsey, R; Magurno, B A
1986-09-01
The ENDF-5 Format, originally the format of the US Evaluated Nuclear Data File ENDF/B-5, was internationally recommended for the computer storage, processing and exchange of evaluated neutron nuclear data. The present document contains the original Formats Manual of 1979, updated with revisions of Nov. 1983. (author) Figs, tabs
26 CFR 48.4161(b)-5 - Effective date.
2010-04-01
...)-5 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) MISCELLANEOUS EXCISE TAXES MANUFACTURERS AND RETAILERS EXCISE TAXES Sporting Goods § 48.4161(b)-5 Effective date. The taxes imposed by section 4161(b) are effective with respect to sales made on and after January 1, 1975. ...
David Morgan, Matthew; Richter, Alex; Al-Ali, Samer; Flint, Julia; Yiannakis, Constantina; Drayson, Mark; Goldblatt, David; Harper, Lorraine
2016-06-01
Patients with systemic vasculitis (SV) have an increased risk of all-cause mortality, often due to infection, compared to the healthy population. We investigated whether humoral response to vaccination and biomarkers of immune dysfunction were associated with infection and death. Patients with SV in remission were vaccinated with pneumococcal 7-valent conjugate, Haemophilus influenzae type b, and meningococcal group C conjugate vaccine and meningococcal polysaccharide groups A, C, Y, and W135 vaccines. Total IgG and antibody titers against specific antigens and lymphocyte subset analysis were performed before vaccination. Postvaccination antibody titers were measured at 4 weeks and 2 years, from which an antibody response score was calculated. Infections and death following vaccination were collected prospectively following vaccination. A total of 92 patients were safely vaccinated with no increase in disease relapse, median followup 4.6 years (interquartile range [IQR] 3.6-4.8 years). Eighteen patients died at a median of 2 years and the overall infection rate was 0.4 (IQR 0.2-1.3) infections/patient/year. Reduced serum IgG, B cell count, and CD4+ cell counts predicted poor vaccine response and infection but not death. The response rates to individual vaccine antigens was highly variable, with a median response rate of 46% (IQR 39-58%) of patients responding to each individual antigen. Vaccine response, age, and reduced renal function were independent predictors of all-cause mortality in multivariate analysis. Total IgG and B cell counts predict infection and response to vaccination. Vaccination in patients with SV in remission is safe and the response predicts all-cause mortality. Vaccine response is a surrogate marker of immune system health. © 2016, American College of Rheumatology.
STAT5A and STAT5B have opposite correlations with drug response gene expression
International Nuclear Information System (INIS)
Lamba, V.; Jia, B.; Liang, F.
2016-01-01
Introduction: STAT5A and STAT5B are important transcription factors that play a key role in regulation of several important physiological processes including proliferation, survival, mediation of responses to cytokines and in regulating gender differences in drug response genes such as the hepatic cytochrome P450s (CYPs) that are responsible for a large majority of drug metabolism reactions in the human body. STAT5A and STAT5b have a high degree of sequence homology and have been reported to have largely similar functions. Recent studies have, however, indicated that they can also often have distinct and unique roles in regulating gene expression. Objective: In this study, we evaluated the association of STAT5A and STAT5B mRNA expression levels with those of several key hepatic cytochrome P450s (CYPs) and hepatic transcription factors (TFs) and evaluated the potential roles of STAT5A and 5b in mediating gender differences in these CYPs and TFs. Methods: Expression profiling for major hepatic CYP isoforms and transcription factors was performed using RNA sequencing (RNA-seq) in 102 human liver samples (57 female, 45 male). Real time PCR gene expression data for selected CYPs and TFs was available on a subset of 50 human liver samples (25 female, 25 male) and was used to validate the RNA-seq findings. Results: While STAT5A demonstrated significant negative correlation with expression levels of multiple hepatic transcription factors (including NR1I2 and HNF4A) and DMEs such as CYP3A4 and CYP2C19, STAT5B expression was observed to demonstrate positive associations with several CYPs and TFs analyzed. As STAT5A and STAT5B have been shown to be important in regulation of gender differences in CYPs, we also analyzed STAT5A and 5b associations with CYPs and TFs separately in males and females and observed gender dependent differential associations of STATs with several CYPs and TFs. Results from the real time PCR validation largely supported our RNA-seq findings
Energy Technology Data Exchange (ETDEWEB)
Suh, M. Y.; Jee, K. Y.; Park, K. K.; Park, Y. J.; Kim, W. H
1999-08-01
This report is intended to describe the statistical methods necessary to design and conduct radiation counting experiments and evaluate the data from the experiment. The methods are described for the evaluation of the stability of a counting system and the estimation of the precision of counting data by application of probability distribution models. The methods for the determination of the uncertainty of the results calculated from the number of counts, as well as various statistical methods for the reduction of counting error are also described. (Author). 11 refs., 8 tabs., 8 figs.
Energy Technology Data Exchange (ETDEWEB)
Suh, M. Y.; Jee, K. Y.; Park, K. K. [Korea Atomic Energy Research Institute, Taejon (Korea)
1999-08-01
This report is intended to describe the statistical methods necessary to design and conduct radiation counting experiments and evaluate the data from the experiments. The methods are described for the evaluation of the stability of a counting system and the estimation of the precision of counting data by application of probability distribution models. The methods for the determination of the uncertainty of the results calculated from the number of counts, as well as various statistical methods for the reduction of counting error are also described. 11 refs., 6 figs., 8 tabs. (Author)
International Nuclear Information System (INIS)
Suh, M. Y.; Jee, K. Y.; Park, K. K.; Park, Y. J.; Kim, W. H.
1999-08-01
This report is intended to describe the statistical methods necessary to design and conduct radiation counting experiments and evaluate the data from the experiment. The methods are described for the evaluation of the stability of a counting system and the estimation of the precision of counting data by application of probability distribution models. The methods for the determination of the uncertainty of the results calculated from the number of counts, as well as various statistical methods for the reduction of counting error are also described. (Author). 11 refs., 8 tabs., 8 figs
Investigating the impact of LSO on the count rate of wholebody PET tomographs
International Nuclear Information System (INIS)
Douglas, J.L.; Moisan, C.; Rogers, J.G.
1996-05-01
We investigated the impact of using detectors made of lutetium oxyorthosilicate (LSO) on the count rate performances of wholebody PET tomographs. To that end, we used a single computational model that predicts the prompt and random contributions to the total event rate in septaless PET tomographs. Dead time factors at all stages of a typical event acquisition stream are calculated from specified values of their respective processing clock cycle. We validated our approach by fitting the true, random and multiple count rates measured with the ECAT-953B and the EXACT HR PLUS scanners for a standard 20 x 20 cm cylindrical phantom. We then investigated the implications of using position encoding detectors made of LSO in the EXACT HR PLUS scanner geometry. The results in indicate that only replacing BGO by the faster LSO incurs no appreciable change in the maximum noise-equivalent-count (NEC) rate of the scanner. However, one could realistically increase the NEC by a factor 2.5 using a 4 nsec coincidence window width with the detector processing front-end operating on a 128 nsec clock cycle. Further reducing the coincidence window width to 600 psec and the front-end clock cycle to 64 nsec leads to an increase of the NEC by a factor 7.5. To sustain the operation of an HR Plus with these specifications, the saturation bandwidth of the data acquisition system would have to be increased to no more than 4.5 MHz. (authors)
Glossario per la città europea / Glossary for the European city
Directory of Open Access Journals (Sweden)
Yannis Tsiomis
2014-09-01
Full Text Available Il concetto di “città in estensione” di Giuseppe Samonà è l'occasione per riflettere sul significato del fenomeno urbano oggi. L’autore lo fa attraverso nove punti, da “estensione” a “polisemia”, passando per “scala”, “metodo” e “funzione”, che diventano i termini di un nuovo glossario ragionato per la città europea, per un approccio cosciente allo studio e al progetto di quello che lui chiama “il dilemma territoriale”. / Giuseppe Samonà's idea of the "city in extension" offers the occasion to reflect on the meaning of the urban phenomenon today. The author does so through nine points, from “extension” to “polysemy”, passing via “scale”, “method” and “function”, which become the terms of a new reasoned glossary for the European city, for an aware approach to studio and the project of what he calls “the territorial dilemma”.
High Reproducibility of ELISPOT Counts from Nine Different Laboratories
Directory of Open Access Journals (Sweden)
Srividya Sundararaman
2015-01-01
Full Text Available The primary goal of immune monitoring with ELISPOT is to measure the number of T cells, specific for any antigen, accurately and reproducibly between different laboratories. In ELISPOT assays, antigen-specific T cells secrete cytokines, forming spots of different sizes on a membrane with variable background intensities. Due to the subjective nature of judging maximal and minimal spot sizes, different investigators come up with different numbers. This study aims to determine whether statistics-based, automated size-gating can harmonize the number of spot counts calculated between different laboratories. We plated PBMC at four different concentrations, 24 replicates each, in an IFN-γ ELISPOT assay with HCMV pp65 antigen. The ELISPOT plate, and an image file of the plate was counted in nine different laboratories using ImmunoSpot® Analyzers by (A Basic Count™ relying on subjective counting parameters set by the respective investigators and (B SmartCount™, an automated counting protocol by the ImmunoSpot® Software that uses statistics-based spot size auto-gating with spot intensity auto-thresholding. The average coefficient of variation (CV for the mean values between independent laboratories was 26.7% when counting with Basic Count™, and 6.7% when counting with SmartCount™. Our data indicates that SmartCount™ allows harmonization of counting ELISPOT results between different laboratories and investigators.
Directory of Open Access Journals (Sweden)
Zaccheaus A Jeremiah
2010-05-01
Full Text Available Zaccheaus A Jeremiah1, Justina E Oburu2, Osaro Erhabor1, Fiekumo I Buseri1, Teddy C Adias31Haematology and Blood Transfusion Science Unit, Department of Medical Laboratory Sciences, College of Health Sciences, Niger Delta University, Wilberforce Island, Nigeria; 2Department of Haematology and Blood Transfusion, University of Port Harcourt Teaching Hospital, Port Harcourt, Nigeria; 3Rivers State University of Science and Technology, Port Harcourt, NigeriaBackground: Human platelet antibodies are often implicated in some disease conditions, such as neonatal alloimmune thrombocytopenia (NAIT, idiopathic thrombocytopenic purpura (ITP and platelet refractoriness. The frequencies of these alloantibodies have not been reported in Nigeria and West Africa.Methods: Screening for allontibodies to human platelet antigens (HPA was undertaken using the GTI PakPlus® qualitative solid phase ELISA reagent. Platelet count was done using the ICSH approved procedure using 1% ammonium oxalate reagent.Study design: A cross-section of apparently healthy adult Nigerian multiparous non-pregnant women, who were staff of a tertiary health facility in the Niger Delta, Nigeria, were screened for alloantibodies to human platelet antigens.Results: Of the one hundred (100 women screened, the prevalence of anti-glycoprotein IIb/IIIa (anti-HPA-Ia,-3a,-4a was zero percent (0%, anti-glycoprotein Ia/IIa (anti-HPA-5b accounted for 30% of results, while anti-glycoprotein Ia/IIa (anti-HPA-5a was 18%. Parity was found to exert significant influence on the development to HPA antibodies (Fisher’s Exact Test = 11.683, P < 0.05; 13.577, P < 0.01. The platelet count of the women did not appear to exert any influence on the development of the antibodies (P > 0.05.Conclusion: This study has observed a high prevalence of anti-HPA-5b in our sample population. The prevalence of alloantibodies to HPA antigens was found to associate strongly with parity. These results indicate that there is a
Counts of low-Redshift SDSS quasar candidates
International Nuclear Information System (INIS)
Zeljko Ivezic
2004-01-01
We analyze the counts of low-redshift quasar candidates selected using nine-epoch SDSS imaging data. The co-added catalogs are more than 1 mag deeper than single-epoch SDSS data, and allow the selection of low-redshift quasar candidates using UV-excess and also variability techniques. The counts of selected candidates are robustly determined down to g = 21.5. This is about 2 magnitudes deeper than the position of a change in the slope of the counts reported by Boyle (and others) (1990, 2000) for a sample selected by UV-excess, and questioned by Hawkins and Veron (1995), who utilized a variability-selected sample. Using SDSS data, we confirm a change in the slope of the counts for both UV-excess and variability selected samples, providing strong support for the Boyle (and others) results
International Nuclear Information System (INIS)
Greene, N.M.; Forsberg, V.M.; Raiford, G.B.; Arwood, J.W.; Flanagan, G.F.
1979-01-01
SACRD is a data base of material properties and other handbook data needed in computer codes used for fast reactor safety studies. This document lists the contents of Version 1 and also serves as a glossary of terminology used in the data base. Data are available in the thermodynamics, heat transfer, fluid mechanics, structural mechanics, aerosol transport, meteorology, neutronics and dosimetry areas. Tabular, graphical and parameterized data are provided in many cases
A count rate model for PET and its application to an LSO HR PLUS scanner
International Nuclear Information System (INIS)
Moisan, C.; Rogers, J.G.; Douglas, J.L.
1996-10-01
We present a count rate model for PET. Considering a standard 20 x 20 cm phantom in the field-of-view of a cylindrical septaless tomograph, the model computes the acceptance to prompt and random events from simple geometric considerations. Dead time factors at all stages of a typical event acquisition architecture are calculated from specified processing clock cycles. Validations of the model's predictions against the measured performances of the ECAT-953B and the EXACT HR PLUS are presented. The model is then used to investigate the benefit of using detectors made of LSO in the EXACT HR PLUS scanner geometry. The results indicate that in replacing BGO by the faster LSO, one can count on an increase of the peak noise-equivalent-count rate by a factor 2.2. This gain will be achieved by using a 5 nsec coincidence window, buckets operating on 128 nsec clock cycle, and front-end data acquisition that can sustain a total rate of 2.9 MHz. (authors)
Woody, Carol Ann; Johnson, D.H.; Shrier, Brianna M.; O'Neal, Jennifer S.; Knutzen, John A.; Augerot, Xanthippe; O'Neal, Thomas A.; Pearsons, Todd N.
2007-01-01
Counting towers provide an accurate, low-cost, low-maintenance, low-technology, and easily mobilized escapement estimation program compared to other methods (e.g., weirs, hydroacoustics, mark-recapture, and aerial surveys) (Thompson 1962; Siebel 1967; Cousens et al. 1982; Symons and Waldichuk 1984; Anderson 2000; Alaska Department of Fish and Game 2003). Counting tower data has been found to be consistent with that of digital video counts (Edwards 2005). Counting towers do not interfere with natural fish migration patterns, nor are fish handled or stressed; however, their use is generally limited to clear rivers that meet specific site selection criteria. The data provided by counting tower sampling allow fishery managers to determine reproductive population size, estimate total return (escapement + catch) and its uncertainty, evaluate population productivity and trends, set harvest rates, determine spawning escapement goals, and forecast future returns (Alaska Department of Fish and Game 1974-2000 and 1975-2004). The number of spawning fish is determined by subtracting subsistence, sport-caught fish, and prespawn mortality from the total estimated escapement. The methods outlined in this protocol for tower counts can be used to provide reasonable estimates ( plus or minus 6%-10%) of reproductive salmon population size and run timing in clear rivers.
Oligonol Supplementation Affects Leukocyte and Immune Cell Counts after Heat Loading in Humans
Directory of Open Access Journals (Sweden)
Jeong Beom Lee
2014-06-01
Full Text Available Oligonol is a low-molecular-weight form of polyphenol and has antioxidant and anti-inflammatory activity, making it a potential promoter of immunity. This study investigates the effects of oligonol supplementation on leukocyte and immune cell counts after heat loading in 19 healthy male volunteers. The participants took a daily dose of 200 mg oligonol or a placebo for 1 week. After a 2-week washout period, the subjects were switched to the other study arm. After each supplement, half-body immersion into hot water was made, and blood was collected. Then, complete and differential blood counts were performed. Flow cytometry was used to enumerate and phenotype lymphocyte subsets. Serum concentrations of interleukin (IL-1β and IL-6 in blood samples were analyzed. Lymphocyte subpopulation variables included counts of total T cells, B cells, and natural killer (NK cells. Oligonol intake attenuated elevations in IL-1β (an 11.1-fold change vs. a 13.9-fold change immediately after heating; a 12.0-fold change vs. a 12.6-fold change 1h after heating and IL-6 (an 8.6-fold change vs. a 9.9-fold change immediately after heating; a 9.1-fold change vs. a 10.5-fold change 1h after heating immediately and 1 h after heating in comparison to those in the placebo group. Oligonol supplementation led to significantly higher numbers of leukocytes (a 30.0% change vs. a 21.5% change immediately after heating; a 13.5% change vs. a 3.5% change 1h after heating and lymphocytes (a 47.3% change vs. a 39.3% change immediately after heating; a 19.08% change vs. a 2.1% change 1h after heating relative to those in the placebo group. Oligonol intake led to larger increases in T cells, B cells, and NK cells at rest (p < 0.05, p < 0.05, and p < 0.001, respectively and immediately after heating (p < 0.001 in comparison to those in the placebo group. In addition, levels of T cells (p < 0.001 and B cells (p < 0.001 were significantly higher 1 h after heating in comparison to those in
Kuttippurathu, Lakshmi; Patra, Biswanath; Hoek, Jan B; Vadigepalli, Rajanikanth
2016-03-01
Liver regeneration after partial hepatectomy is a clinically important process that is impaired by adaptation to chronic alcohol intake. We focused on the initial time points following partial hepatectomy (PHx) to analyze the genome-wide binding activity of NF-κB, a key immediate early regulator. We investigated the effect of chronic alcohol intake on immediate early NF-κB genome-wide localization, in the adapted state as well as in response to partial hepatectomy, using chromatin immunoprecipitation followed by promoter microarray analysis. We found many ethanol-specific NF-κB binding target promoters in the ethanol-adapted state, corresponding to the regulation of biosynthetic processes, oxidation-reduction and apoptosis. Partial hepatectomy induced a diet-independent shift in NF-κB binding loci relative to the transcription start sites. We employed a novel pattern count analysis to exhaustively enumerate and compare the number of promoters corresponding to the temporal binding patterns in ethanol and pair-fed control groups. The highest pattern count corresponded to promoters with NF-κB binding exclusively in the ethanol group at 1 h post PHx. This set was associated with the regulation of cell death, response to oxidative stress, histone modification, mitochondrial function, and metabolic processes. Integration with the global gene expression profiles to identify putative transcriptional consequences of NF-κB binding patterns revealed that several of ethanol-specific 1 h binding targets showed ethanol-specific differential expression through 6 h post PHx. Motif analysis yielded co-incident binding loci for STAT3, AP-1, CREB, C/EBP-β, PPAR-γ and C/EBP-α, likely participating in co-regulatory modules with NF-κB in shaping the immediate early response to PHx. We conclude that adaptation to chronic ethanol intake disrupts the NF-κB promoter binding landscape with consequences for the immediate early gene regulatory response to the acute challenge of PHx.
Bacon, John B; McCarty, David Charles; Bacon, John B
1999-01-01
First published in the most ambitious international philosophy project for a generation; the Routledge Encyclopedia of Philosophy. Logic from A to Z is a unique glossary of terms used in formal logic and the philosophy of mathematics. Over 500 entries include key terms found in the study of: * Logic: Argument, Turing Machine, Variable * Set and model theory: Isomorphism, Function * Computability theory: Algorithm, Turing Machine * Plus a table of logical symbols. Extensively cross-referenced to help comprehension and add detail, Logic from A to Z provides an indispensable reference source for students of all branches of logic.
Biomimetic Designs Inspired by Seashells
Indian Academy of Sciences (India)
Admin
from the Greek word 'keramikos', which means burnt stuff. ... Glossary*. Stress is the force divided by the area on which the force acts. Its unit is ..... (b) monolithic glass specimen of same thickness. (a). (b). Figure A. 0. 5. 10. 15. 20. 25. 30. 35.
45 CFR 5b.10 - Parents and guardians.
2010-10-01
... 45 Public Welfare 1 2010-10-01 2010-10-01 false Parents and guardians. 5b.10 Section 5b.10 Public... Parents and guardians. For the purpose of this part, a parent or guardian of any minor or the legal guardian or any individual who has been declared incompetent due to physical or mental incapacity or age by...
International Nuclear Information System (INIS)
Makino, Kenichi; Masuda, Yasuhiko; Gotoh, Satoshi
1998-01-01
The experimental subjects were 189 patients with cerebrovascular disorders. 123 I-IMP, 222 MBq, was administered by intravenous infusion. Continuous arterial blood sampling was carried out for 5 minutes, and arterial blood was also sampled once at 5 minutes after 123 I-IMP administration. Then the whole blood count of the one-point arterial sampling was compared with the octanol-extracted count of the continuous arterial sampling. A positive correlation was found between the two values. The ratio of the continuous sampling octanol-extracted count (OC) to the one-point sampling whole blood count (TC5) was compared with the whole brain count ratio (5:29 ratio, Cn) using 1-minute planar SPECT images, centering on 5 and 29 minutes after 123 I-IMP administration. Correlation was found between the two values. The following relationship was shown from the correlation equation. OC/TC5=0.390969 x Cn-0.08924. Based on this correlation equation, we calculated the theoretical continuous arterial sampling octanol-extracted count (COC). COC=TC5 x (0.390969 x Cn-0.08924). There was good correlation between the value calculated with this equation and the actually measured value. The coefficient improved to r=0.94 from the r=0.87 obtained before using the 5:29 ratio for correction. For 23 of these 189 cases, another one-point arterial sampling was carried out at 6, 7, 8, 9 and 10 minutes after the administration of 123 I-IMP. The correlation coefficient was also improved for these other point samplings when this correction method using the 5:29 ratio was applied. It was concluded that it is possible to obtain highly accurate input functions, i.e., calculated continuous arterial sampling octanol-extracted counts, using one-point arterial sampling whole blood counts by performing correction using the 5:29 ratio. (K.H.)
Rinaldi, L; Coles, G C; Maurelli, M P; Musella, V; Cringoli, G
2011-05-11
The present study was aimed at carrying out a calibration and a comparison of diagnostic accuracy of three faecal egg counts (FEC) techniques, simple flotation, McMaster and FLOTAC, in order to find the best flotation solution (FS) for Dicrocoelium dendriticum, Moniezia expansa and gastrointestinal (GI) strongyle eggs, and to evaluate the influence of faecal preservation methods combined with FS on egg counts. Simple flotation failed to give satisfactory results with any samples. Overall, FLOTAC resulted in similar or higher eggs per gram of faeces (EPG) and lower coefficient of variation (CV) than McMaster. The "gold standard" for D. dendriticum was obtained with FLOTAC when using FS7 (EPG=219, CV=3.9%) and FS8 (EPG=226, CV=5.2%) on fresh faeces. The "gold standard" for M. expansa was obtained with FLOTAC, using FS3 (EPG=122, CV=4.1%) on fresh faeces. The "gold standard" for GI strongyles was obtained with FLOTAC when using FS5 (EPG=320, CV=4%) and FS2 (EPG=298, CV=5%). As regard to faecal preservation methods, formalin 5% and 10% or freezing showed performance similar to fresh faeces for eggs of D. dendriticum and M. expansa. However, these methods of preservation were not as successful with GI strongyle eggs. Vacuum packing with storage at +4°C permitted storage of GI strongyle eggs for up to 21 days prior to counting. Where accurate egg counts are required in ovine samples the optimum method of counting is the use of FLOTAC. In addition, we suggest the use of two solutions that are easy and cheap to purchase and prepare, saturated sodium chloride (FS2) for nematoda and cestoda eggs and saturated zinc sulphate (FS7) for trematoda eggs and nematoda larvae. Copyright © 2010 Elsevier B.V. All rights reserved.
Carb counting; Carbohydrate-controlled diet; Diabetic diet; Diabetes-counting carbohydrates ... Many foods contain carbohydrates (carbs), including: Fruit and fruit juice Cereal, bread, pasta, and rice Milk and milk products, soy milk Beans, legumes, ...
Koop, G.; Dik, N.; Nielen, M.; Lipman, L.J.A.
2010-01-01
The aims of this study were to assess how different bacterial groups in bulk milk are related to bulk milk somatic cell count (SCC), bulk milk total bacterial count (TBC), and bulk milk standard plate count (SPC) and to measure the repeatability of bulk milk culturing. On 53 Dutch dairy goat farms, 3 bulk milk samples were collected at intervals of 2 wk. The samples were cultured for SPC, coliform count, and staphylococcal count and for the presence of Staphylococcus aureus. Furthermore, SCC ...
Sperm motility and morphology as changing parameters linked to sperm count variations.
Dua A; Vaidya S
1996-01-01
Variations in semen analyses of 177 males over a 1 year period were assessed. The average means of total counts, motility, morphology, total motile count and non-motile % were determined for 5 classes of patients ranging from azoospermic to normospermic. Positive relationships between a falling sperm count, a decrease in motility and total motile counts were seen. Also, increasingly, abnormal forms were found with lower sperm counts.
Broken SU(5) x SU(5) chiral symmetry and the classification of B mesons
International Nuclear Information System (INIS)
Hatzis, M.
1984-01-01
We consider broken SU(5) x SU(5) chiral summetry and we assume that the vacuum is SU(5)-symmetric. Using the observed mass spectrum of pseudoscalar mesons, and setting the bu mass in the range 5.2 +- 0.06 GeV, we predict the masses of bs, bc, and etasub(b) states as well as axial current couplings fsub(i)/fsub(π). SU(5) x SU(5) is found to be consistent with SU(4) x SU(4) breaking. The problem of eta - eta' - eta sub(c) - eta sub(b) mixing is also discussed
Relationship between γ detection dead-time and count correction factor
International Nuclear Information System (INIS)
Wu Huailong; Zhang Jianhua; Chu Chengsheng; Hu Guangchun; Zhang Changfan; Hu Gen; Gong Jian; Tian Dongfeng
2015-01-01
The relationship between dead-time and count correction factor was investigated by using interference source for purpose of high γ activity measurement. The count rates maintain several 10 s"-"l with γ energy of 0.3-1.3 MeV for 10"4-10"5 Bq radioactive source. It is proved that the relationship between count loss and dead-time is unconcerned at various energy and various count intensities. The same correction formula can be used for any nuclide measurement. (authors)
Structure and physical properties of Cr_5B_3-type Ta_5Si_3 and Ta_5Ge_3
International Nuclear Information System (INIS)
Yuan, Fang; Forbes, Scott; Ramachandran, Krishna Kumar; Mozharivskyj, Yurij
2015-01-01
The Cr_5B_3-type Ta_5Si_3 phase was prepared by arc-melting, while the Cr_5B_3-type Ta_5Ge_3 one was synthesized through sintering at 1000 °C. X-ray single crystal diffraction was employed to elucidate their structure. According to the magnetization measurements, both Ta_5Si_3 and Ta_5Ge_3 are Pauli paramagnets, with Ta_5Ge_3 showing a Curie-Weiss-like paramagnetic behavior at low temperatures likely due to presence of paramagnetic impurity. Both Ta_5Si_3 and Ta_5Ge_3 display a very low electrical resistivity from 2 to 300 K. The resistivity is constant below 20 K, but displays a positive temperature coefficient above 20 K. Electronic structure calculations with the TB-LMTO-ASA method support the metallic character of the two phases and suggest that the bonding is optimized in both phases. - Highlights: • Synthesis of Cr_5B_3-type Ta_5Si_3 and Ta_5Ge_3 phases with high purity by arc-melting and sintering, respectively. • Magnetization data and electrical resistivity of the Cr_5B_3-type Ta_5Si_3 and Ta_5Ge_3 phases. • Crystal and electronic structure analysis for Ta_5Si_3 and Ta_5Ge_3 phase by X-ray diffraction and TB-LMTO-ASA calculations.
Kane, Nick; Acharya, Jayant; Benickzy, Sandor; Caboclo, Luis; Finnigan, Simon; Kaplan, Peter W.; Shibasaki, Hiroshi; Pressler, Ronit; van Putten, Michel J.A.M.
2017-01-01
This glossary includes the terms most commonly used in clinical EEG. It is based on the previous proposals (Chatrian et al., 1974; Noachtar et al., 1999) and includes terms necessary to describe the EEG and to generate the EEG report. All EEG phenomena should be described as precisely as possible in
International Nuclear Information System (INIS)
Çelik, Haydar; Koşar, Müberra; Arinç, Emel
2013-01-01
Highlights: • We assessed inhibitory effects of 8 dietary flavonoids on cytochrome b5 reduction by purified NADH-cytochrome b5 reductase. • The flavonol myricetin was the most potent in inhibiting cytochrome b5 reduction with an IC 50 value of 0.35 μM. • We investigated kinetics of myricetin-induced inhibition in detail. • We explored the structure–inhibitory activity relationship of compounds. • Modulation of cytochrome b5 reduction indicates a potential for myricetin to lead to some food–drug/xenobiotic interactions. - Abstract: The microsomal NADH-dependent electron transport system consisting of cytochrome b5 reductase and cytochrome b5 participates in a number of physiologically important processes including lipid metabolism as well as is involved in the metabolism of various drug and xenobiotics. In the present study, we assessed the inhibitory effects of eight dietary flavonoids representing five distinct chemical classes on cytochrome b5 reduction by purified cytochrome b5 reductase. From the flavonoids tested, myricetin was the most potent in inhibiting cytochrome b5 reduction with an IC 50 value of 0.35 μM. Myricetin inhibited b5 reductase noncompetitively with a K i of 0.21 μM with respect to cofactor NADH, and exhibited a non-linear relationship indicating non-Michaelis–Menten kinetic binding with respect to cytochrome b5. In contrast to the potent inhibitory activity of myricetin, (+)-taxifolin was found to be a weak inhibitor (IC 50 = 9.8 μM). The remaining flavonoids were inactive within the concentration range tested (1–50 μM). Analysis of structure–activity data suggested that simultaneous presence of three OH groups in ring B is a primary structural determinant for a potent enzyme inhibition. Our results suggest that inhibition of the activity of this system by myricetin or myricetin containing diets may influence the metabolism of therapeutic drugs as well as detoxification of xenobiotics
Prospects and current status of B5 biodiesel implementation in Malaysia
International Nuclear Information System (INIS)
Yusoff, Mohd.Hizami Mohd.; Abdullah, Ahmad Zuhairi; Sultana, Shazia; Ahmad, Mushtaq
2013-01-01
This paper addresses B5 biodiesel programs in Malaysia, global challenges on the production of palm oil. Protective measures for future efficiency as well as continued viability of this renewable energy sector are also discussed. Crude palm oil (CPO) prices are currently suppressed because of high palm oil inventory. Malaysian government has taken a pro-active step in implementing the B5 biodiesel for transportation and industrial sectors through the introduction of B5 biodiesel. The B5 Biodiesel Program which was initially targeted at selected government agencies has been fully implemented for subsidized sectors in the Central Region. The promotion of B5 development is highly attractive due to its potential local feedstock from palm oil industry and the availability of production technologies that offer opportunities for the sustainable development in energy entrepreneurships. Nationally, produced B5 will improve the access to alternative energy services and is expected to help in improving productivity and sustainability. Despite successful local B5 implementation, Malaysia is recently facing global challenges on the biodiesel production which currently remains stagnant due to weak domestic demand and uncompetitive export tax structure. -- Highlights: •Prospects of B5 biodiesel implementation in Malaysia. •National Biofuel Policy thrusts pertinent to B5 program. •Successful application of B5 in government and industrial sectors. •Challenges in CPO production, weak domestic demand and export tax. •Reassessment of national policy according to global issues
Sperm motility and morphology as changing parameters linked to sperm count variations.
Directory of Open Access Journals (Sweden)
Dua A
1996-10-01
Full Text Available Variations in semen analyses of 177 males over a 1 year period were assessed. The average means of total counts, motility, morphology, total motile count and non-motile % were determined for 5 classes of patients ranging from azoospermic to normospermic. Positive relationships between a falling sperm count, a decrease in motility and total motile counts were seen. Also, increasingly, abnormal forms were found with lower sperm counts.
Computational investigation of hydrogen storage on B5V3
Guo, Chen; Wang, Chong
2018-05-01
Based on density functional theory method with 6-311+G(d,p) basis set, the structures, stability and hydrogen storage capacity of B5V3 have been theoretically investigated. It is found that a maximum of seven hydrogen molecules can be adsorbed on B5V3 with gravimetric uptake capacity of 6.39 wt%. The uptake capacity exceeds the target set by the US Department of Energy for vehicular application. Moreover, the average adsorption energy of B5V3 01 (7H2) is 0.60 eV/H2 in the desirable range of reversible hydrogen storage. The kinetic stability of H2 adsorbed on B5V3 01 is confirmed by using gap between highest occupied molecular orbital (HOMO)and the lowest unoccupied molecular orbital (LUMO). The gap value of B5V3 01 (7H2) is 2.81 eV, which indicates the compound with high stability. In addition, the thermochemistry calculation (Gibbs free energy corrected adsorption energy) is used to analyse if the adsorption is favourable or not at different temperatures. It can be found that the Gibbs corrected adsorption energy of B5V3 01 (7H2) is still positive at 400 K at 1 atm. It means that the adsorption of seven hydrogen molecules on B5V3 01 is energetically favourable in a fairly wide temperature range. All the results show that B5V3 01 can be considered as a promising material for hydrogen storage.
26 CFR 301.6226(b)-1 - 5-percent group.
2010-04-01
... 26 Internal Revenue 18 2010-04-01 2010-04-01 false 5-percent group. 301.6226(b)-1 Section 301.6226... ADMINISTRATION PROCEDURE AND ADMINISTRATION Assessment In General § 301.6226(b)-1 5-percent group. (a) In general. All members of a 5-percent group shall join in filing any petition for judicial review. The...
CD4+ count and Nitro-Blue Tetrazolium reduction rate of neutrophil ...
African Journals Online (AJOL)
CD4+ count and Nitro-Blue Tetrazolium reduction rate of neutrophil in newly diagnosed HIV-infected adults in Sokoto Metropolis. U.K. Mustapha, C.C. Onyenekwe, A. Yakubu, B.R. Alkali, M.H. Yeldu, K.M. Hamid, I. Abdullahi, N.M. Bunza, M. Bello, A.B. Ibrahim ...
UNC5B receptor deletion exacerbates tissue injury in response to AKI.
Ranganathan, Punithavathi; Jayakumar, Calpurnia; Navankasattusas, Sutip; Li, Dean Y; Kim, Il-man; Ramesh, Ganesan
2014-02-01
Netrin-1 regulates cell survival and apoptosis by activation of its receptors, including UNC5B. However, the in vivo role of UNC5B in cell survival during cellular stress and tissue injury is unknown. We investigated the role of UNC5B in cell survival in response to stress using mice heterozygously expressing the UNC5B gene (UNC5B(-/flox)) and mice with targeted homozygous deletion of UNC5B in kidney epithelial cells (UNC5B(-/flox/GGT-cre)). Mice were subjected to two different models of organ injury: ischemia reperfusion injury of the kidney and cisplatin-induced nephrotoxicity. Both mouse models of UNC5B depletion had normal organ function and histology under basal conditions. After AKI, however, UNC5B(-/flox/GGT-cre) mice exhibited significantly worse renal function and damage, increased tubular apoptosis, enhanced p53 activation, and exacerbated inflammation compared with UNC5B(-/flox) and wild-type mice. shRNA-mediated suppression of UNC5B expression in cultured tubular epithelial cells exacerbated cisplatin-induced cell death in a p53-dependent manner and blunted Akt phosphorylation. Inhibition of PI3 kinase similarly exacerbated cisplatin-induced apoptosis; in contrast, overexpression of UNC5B reduced cisplatin-induced apoptosis in these cells. Taken together, these results show that the netrin-1 receptor UNC5B plays a critical role in cell survival and kidney injury through Akt-mediated inactivation of p53 in response to stress.
Evaluation of misplaced event count rate using a scintillation camera
International Nuclear Information System (INIS)
Yanagimoto, Shin-ichi; Tomomitsu, Tatsushi; Muranaka, Akira
1985-01-01
Misplaced event count rates were evaluated using an acryl scatter body of various thickness and a gamma camera. The count rate in the region of interest (ROI) within the camera view field, which was thought to represent part of the misplaced event count rate, increased as the thickness of the scatter body was increased to 5 cm, followed by a steep decline in the count rate. On the other hand, the ratio of the count rate in the ROI to the total count rate continuously increased as the thickness of the scatter body was increased. As the thickness of the scatter body was increased, the count rates increased, and the increments of increase were greater in the lower energy region of the photopeak than in the higher energy region. In ranges energy other than the photopeak, the influence of the scatter body on the count rate in the ROI was the greatest at 76 keV, which was the lowest energy we examined. (author)
O'Brien, Lisa; Shaffer, Nathan; Sangrujee, Nalinee; Abimbola, Taiwo O
2014-03-01
To estimate the incremental cost over 5 years of a policy switch from the Option B to the Option B+ protocol for the prevention of mother-to-child transmission (PMTCT) of the human immunodeficiency virus (HIV). Data from cost studies and other published sources were used to determine the cost, per woman and per cohort (1000 breastfeeding and 1000 non-breastfeeding women), of switching from Option B (maternal triple antiretroviral [ARV] regimen during pregnancy and breastfeeding plus daily nevirapine for the infant for 6 weeks) to Option B+ (maternal triple ARV regimen initiated during pregnancy and continued for life). The variables used to model the different scenarios were maternal CD4+ T lymphocyte (CD4+ cell) count (350-500 versus > 500 cells/µl), rate of decline in CD4+ cells (average, rapid, slow), breastfeeding status (yes, no) and breastfeeding duration (12, 18 or 24 months). For women with CD4+ cell counts of 350-500 cells/µl, the incremental cost per 1000 women was 157,345 United States dollars (US$) for breastfeeding women and US$ 92,813 for non-breastfeeding women. For women with CD4+ cell counts > 500 cells/µl, the incremental cost per 1000 women ranged from US$ 363,443 to US$ 484,591 for breastfeeding women and was US$ 605,739 for non-breastfeeding women. From a cost perspective, a policy switch from Option B to Option B+ is feasible in PMTCT programme settings where resources are currently being allocated to Option B.
Invertebrate neurophylogeny: suggested terms and definitions for a neuroanatomical glossary
Directory of Open Access Journals (Sweden)
Müller Carsten HG
2010-11-01
Full Text Available Abstract Background Invertebrate nervous systems are highly disparate between different taxa. This is reflected in the terminology used to describe them, which is very rich and often confusing. Even very general terms such as 'brain', 'nerve', and 'eye' have been used in various ways in the different animal groups, but no consensus on the exact meaning exists. This impedes our understanding of the architecture of the invertebrate nervous system in general and of evolutionary transformations of nervous system characters between different taxa. Results We provide a glossary of invertebrate neuroanatomical terms with a precise and consistent terminology, taxon-independent and free of homology assumptions. This terminology is intended to form a basis for new morphological descriptions. A total of 47 terms are defined. Each entry consists of a definition, discouraged terms, and a background/comment section. Conclusions The use of our revised neuroanatomical terminology in any new descriptions of the anatomy of invertebrate nervous systems will improve the comparability of this organ system and its substructures between the various taxa, and finally even lead to better and more robust homology hypotheses.
On the structure of Lattice code WIMSD-5B
International Nuclear Information System (INIS)
Kim, Won Young; Min, Byung Joo
2004-03-01
The WIMS-D code is a freely available thermal reactor physics lattice code used widely for thermal research and power reactor calculation. Now the code WIMS-AECL, developed on the basis of WIMS-D, has been used as one of lattice codes for the cell calculation in Canada and also, in 1998, the latest version WIMSD-5B is released for OECD/NEA Data Bank. While WIMS-KAERI was developed and has been used, originated from WIMS-D, in Korea, it was adjusted for the cell calculation of research reactor HANARO and so it has no confirmaty to CANDU reactor. Therefore, the code development applicable to cell calculation of CANDU reactor is necessary not only for technological independence and but also for the establishment of CANDU safety analysis system. A lattice code WIMSD-5B was analyzed in order to set the system of reactor physics computer codes, to be used in the assessment of void reactivity effect. In order to improve and validate WIMSD-5B code, the analysis of the structure of WIMSD-5B lattice code was made and so its structure, algorithm and the subroutines of WIMSD-5B were presented for the cluster type and the pij method modelling the CANDU-6 fuel
International Nuclear Information System (INIS)
Balpardo, C.; Capoulat, M.E.; Rodrigues, D.; Arenillas, P.
2010-01-01
The nuclide 241 Am decays by alpha emission to 237 Np. Most of the decays (84.6%) populate the excited level of 237 Np with energy of 59.54 keV. Digital coincidence counting was applied to standardize a solution of 241 Am by alpha-gamma coincidence counting with efficiency extrapolation. Electronic discrimination was implemented with a pressurized proportional counter and the results were compared with two other independent techniques: Liquid scintillation counting using the logical sum of double coincidences in a TDCR array and defined solid angle counting taking into account activity inhomogeneity in the active deposit. The results show consistency between the three methods within a limit of a 0.3%. An ampoule of this solution will be sent to the International Reference System (SIR) during 2009. Uncertainties were analysed and compared in detail for the three applied methods.
Implication of 5-HT(2B) receptors in the serotonin syndrome.
Diaz, Silvina Laura; Maroteaux, Luc
2011-09-01
The serotonin (5-HT) syndrome occurs in humans after antidepressant overdose or combination of drugs inducing a massive increase in extracellular 5-HT. Several 5-HT receptors are known to participate in this syndrome in humans and animal models. The 5-HT(2B) receptor has been proposed as a positive modulator of serotonergic activity, but whether it is involved in 5-HT syndrome has not yet been studied. We analyzed here, a putative role of 5-HT(2B) receptors in this disorder by forced swimming test (FST) and behavioral assessment in the open field. In FST, genetic (5-HT(2B)(-/-) mice) or pharmacological (antagonist RS127445 at 0.5 mg/kg) ablation of 5-HT(2B) receptors facilitated selective 5-HT reuptake inhibitors (SSRI)-induced increase of immobility time as well as expression of other symptoms related to 5-HT syndrome like hind limb abduction and Straub tail. Increase in immobility was also developed in FST by both wild type (WT) and 5-HT(2B)(-/-) mice after the administration of 5-HT(1A), 5-HT(2A) or 5-HT(2C) receptor agonists, 8-OH-DPAT (5 mg/kg), DOI (1 mg/kg), or WAY161503 (5 mg/kg), respectively. In contrast, the 5-HT(2B) receptor agonist BW723C86 (3 mg/kg) or 5-HT(1B) receptor agonist CGS12066A (2 mg/kg) decreased immobility time in both genotypes. The 5-HT syndrome induced by fluoxetine at high doses was blocked in WT and 5-HT(2B)(-/-) mice by administration of 5-HT(1A) and 5-HT(2C) receptor antagonists (WAY100635 0.5 mg/kg and SB242084 0.5 mg/kg) but not by the 5-HT(2A) receptor antagonist MDL100907 (1 mg/kg). By behavioral assessment, we confirmed that 5-HT(2B)(-/-) mice were more prone to develop 5-HT syndrome symptoms after administration of high dose of SSRIs or the 5-HT precursor 5-Hydroxytryptophan, 5-HTP, even if increases in 5-HT plasma levels were similar in both genotypes. This evidence suggests that the presence of 5-HT(2B) receptors hinders acute 5-HT toxicity once high levels of 5-HT are attained. Therefore, differential agonism
Directory of Open Access Journals (Sweden)
Zahra Bahrololoumi
2017-03-01
Full Text Available Introduction: Early childhood caries (ECC is one of the most common problems in children worldwide which is seen in 3-45% preschool children population. Bacterial factor is one of the main four components (time, microorganism, diet, host to create caries. Streptococcus mutans is one of the most important cariogenic microorganisms. The objective of this study is evaluating Streptococcus mutans count in children with ECC and caries free children considering other factors. The aim of this study was to find the CFU of Streptococcus mutans in saliva of children with ECC versus caries free ones. In addition environmental factors affecting CFU of this micro organism. Methods: Salivary Streptococcus mutans count in 76 3-5 year old children was done in two groups (ECC and caries free. Non stimulated saliva was collected and cultured on Streptococcus mutans specific growth medium. Data was analyzed with Chi-Square, spearman, Kruskal–Wallis,Mann–Whitney tests. Results: Differences in colony count in study groups were statistically significant and was less in caries free children (p value<0.001. Colony count had no relationship with age, sex, weight, Body Mass Index(BMI and parents educational level but sugar consumption frequency, feeding method (breast or bottle and night time breast feeding had significant effect on colony count (p value=0.019. Conclusion: In the current study, a statistically significant difference was seen in colony count in two groups. Sugar consumption frequency and feeding method had a significant impact on colony count. Micro organisms are still the most important factors in creating caries but feeding pattern and sugar consumption frequency also have an important role. The results also showed that parents educational level does not influence reducing caries which should be noted.
Benjamin Thompson, Count Rumford Count Rumford on the nature of heat
Brown, Sanborn C
1967-01-01
Men of Physics: Benjamin Thompson - Count Rumford: Count Rumford on the Nature of Heat covers the significant contributions of Count Rumford in the fields of physics. Count Rumford was born with the name Benjamin Thompson on March 23, 1753, in Woburn, Massachusetts. This book is composed of two parts encompassing 11 chapters, and begins with a presentation of Benjamin Thompson's biography and his interest in physics, particularly as an advocate of an """"anti-caloric"""" theory of heat. The subsequent chapters are devoted to his many discoveries that profoundly affected the physical thought
Road safety performance measures and AADT uncertainty from short-term counts.
Milligan, Craig; Montufar, Jeannette; Regehr, Jonathan; Ghanney, Bartholomew
2016-12-01
The objective of this paper is to enable better risk analysis of road safety performance measures by creating the first knowledge base on uncertainty surrounding annual average daily traffic (AADT) estimates when the estimates are derived by expanding short-term counts with the individual permanent counter method. Many road safety performance measures and performance models use AADT as an input. While there is an awareness that the input suffers from uncertainty, the uncertainty is not well known or accounted for. The paper samples data from a set of 69 permanent automatic traffic recorders in Manitoba, Canada, to simulate almost 2 million short-term counts over a five year period. These short-term counts are expanded to AADT estimates by transferring temporal information from a directly linked nearby permanent count control station, and the resulting AADT values are compared to a known reference AADT to compute errors. The impacts of five factors on AADT error are considered: length of short-term count, number of short-term counts, use of weekday versus weekend counts, distance from a count to its expansion control station, and the AADT at the count site. The mean absolute transfer error for expanded AADT estimates is 6.7%, and this value varied by traffic pattern group from 5% to 10.5%. Reference percentiles of the error distribution show that almost all errors are between -20% and +30%. Error decreases substantially by using a 48-h count instead of a 24-h count, and only slightly by using two counts instead of one. Weekday counts are superior to weekend counts, especially if the count is only 24h. Mean absolute transfer error increases with distance to control station (elasticity 0.121, p=0.001), and increases with AADT (elasticity 0.857, proad safety performance measures that use AADT as inputs. Analytical frameworks for such analysis exist but are infrequently used in road safety because the evidence base on AADT uncertainty is not well developed. Copyright
Preverbal and verbal counting and computation.
Gallistel, C R; Gelman, R
1992-08-01
We describe the preverbal system of counting and arithmetic reasoning revealed by experiments on numerical representations in animals. In this system, numerosities are represented by magnitudes, which are rapidly but inaccurately generated by the Meck and Church (1983) preverbal counting mechanism. We suggest the following. (1) The preverbal counting mechanism is the source of the implicit principles that guide the acquisition of verbal counting. (2) The preverbal system of arithmetic computation provides the framework for the assimilation of the verbal system. (3) Learning to count involves, in part, learning a mapping from the preverbal numerical magnitudes to the verbal and written number symbols and the inverse mappings from these symbols to the preverbal magnitudes. (4) Subitizing is the use of the preverbal counting process and the mapping from the resulting magnitudes to number words in order to generate rapidly the number words for small numerosities. (5) The retrieval of the number facts, which plays a central role in verbal computation, is mediated via the inverse mappings from verbal and written numbers to the preverbal magnitudes and the use of these magnitudes to find the appropriate cells in tabular arrangements of the answers. (6) This model of the fact retrieval process accounts for the salient features of the reaction time differences and error patterns revealed by experiments on mental arithmetic. (7) The application of verbal and written computational algorithms goes on in parallel with, and is to some extent guided by, preverbal computations, both in the child and in the adult.
International Nuclear Information System (INIS)
Langenback, E.G.; Foster, W.M.; Bergofsky, E.H.
1989-01-01
We determined the overall external counting efficiency of radiolabeled particles deposited in the sheep lung. This efficiency permits the noninvasive calculation of the number of particles and microcuries from gamma-scintillation lung images of the live sheep. Additionally, we have calculated the attenuation of gamma radiation (120 keV) by the posterior chest wall and the gamma-scintillation camera collection efficiency of radiation emitted from the lung. Four methods were employed in our experiments: (1) by light microscopic counting of discrete carbonized polystyrene particles with a count median diameter (CMD) of 2.85 microns and tagged with cobalt-57, we delineated a linear relationship between the number of particles and the emitted counts per minute (cpm) detected by well scintillation counting; (2) from this conversion relationship we determined the number of particles inhaled and deposited in the lungs by scintillation counting fragments of dissected lung at autopsy; (3) we defined a linear association between the number of particles or microcuries contained in the lung and the emitted radiation as cpm detected by a gamma scintillation camera in the live sheep prior to autopsy; and (4) we compared the emitted radiation from the lungs of the live sheep to that of whole excised lungs in order to calculate the attenuation coefficient (ac) of the chest wall. The mean external counting efficiency was 4.00 X 10(4) particles/cpm (5.1 X 10(-3) microCi/cpm), the camera collection efficiency was 1 cpm/10(4) disintegrations per minute (dpm), and the ac had a mean of 0.178/cm. The external counting efficiency remained relatively constant over a range of particles and microcuries, permitting a more general use of this ratio to estimate number of particles or microcuries depositing after inhalation in a large mammalian lung if a similarly collimated gamma camera system is used
Bayesian approach in MN low dose of radiation counting
International Nuclear Information System (INIS)
Serna Berna, A.; Alcaraz, M.; Acevedo, C.; Navarro, J. L.; Alcanzar, M. D.; Canteras, M.
2006-01-01
The Micronucleus assay in lymphocytes is a well established technique for the assessment of genetic damage induced by ionizing radiation. Due to the presence of a natural background of MN the net MN is obtained by subtracting this value to the gross value. When very low doses of radiation are given the induced MN is close even lower than the predetermined background value. Furthermore, the damage distribution induced by the radiation follows a Poisson probability distribution. These two facts pose a difficult task to obtain the net counting rate in the exposed situations. It is possible to overcome this problem using a bayesian approach, in which the selection of a priori distributions for the background and net counting rate plays an important role. In the present work we make a detailed analysed using bayesian theory to infer the net counting rate in two different situations: a) when the background is known for an individual sample, using exact value value for the background and Jeffreys prior for the net counting rate, and b) when the background is not known and we make use of a population background distribution as background prior function and constant prior for the net counting rate. (Author)
Directory of Open Access Journals (Sweden)
Hamid Alizadeh
2009-12-01
Full Text Available In this paper the impact scope of Natural Language Processing (NLP on translating search statements was determined by testing out research hypotheses. The NLP techniques employed for search statement processing included text parsing, linguistic forms identification, stopword removal, morphological analysis, and tokenization. Examination of the hypotheses indicated that using the method of translating the first equivalent term selected versus the method of selecting all equivalent terms, would contribute to increased efficiency of the review that while morphological analysis of the terms not translated by the glossary, would increase the retrieval precision cutoff, there would be no significant difference established by the lack of such analysis thereof that sentence translation as opposed to term by term translation, would increase the efficiency of Farsi-English proofreading. Other findings are also represented.
DEFF Research Database (Denmark)
Bregnballe, Thomas; Carss, David N; Lorentsen, Svein-Håkon
2013-01-01
This chapter focuses on Cormorant population counts for both summer (i.e. breeding) and winter (i.e. migration, winter roosts) seasons. It also explains differences in the data collected from undertaking ‘day’ versus ‘roost’ counts, gives some definitions of the term ‘numbers’, and presents two...
CERN{sub D}xCTA counting mode chip
Energy Technology Data Exchange (ETDEWEB)
Moraes, D. [CERN, CH-1211 Geneva 23 (Switzerland)], E-mail: danielle.moraes@cern.ch; Kaplon, J. [CERN, CH-1211 Geneva 23 (Switzerland); Nygard, E. [Interon AS, Asker, Norway and DX-ray Inc., Northridge, CA (United States)
2008-06-11
This ASIC is a counting mode front-end electronic optimized for the readout of CdZnTe/CdTe and silicon sensors, for possible use in applications where the flux of ionizing radiation is high. The chip is implemented in 0.25 {mu}m CMOS technology. The circuit comprises 128 channels equipped with a transimpedance amplifier followed by a gain shaper stage with 21 ns peaking time, two discriminators and two 18-bit counters. The channel architecture is optimized for the detector characteristics in order to achieve the best energy resolution at counting rates of up to 5 M counts/second. The amplifier shows a linear sensitivity of 118 mV/fC and an equivalent noise charge of about 711 e{sup -}, for a detector capacitance of 5 pF. Complete evaluation of the circuit is presented using electronic pulses and pixel detectors.
Koop, G; Dik, N; Nielen, M; Lipman, L J A
2010-06-01
The aims of this study were to assess how different bacterial groups in bulk milk are related to bulk milk somatic cell count (SCC), bulk milk total bacterial count (TBC), and bulk milk standard plate count (SPC) and to measure the repeatability of bulk milk culturing. On 53 Dutch dairy goat farms, 3 bulk milk samples were collected at intervals of 2 wk. The samples were cultured for SPC, coliform count, and staphylococcal count and for the presence of Staphylococcus aureus. Furthermore, SCC (Fossomatic 5000, Foss, Hillerød, Denmark) and TBC (BactoScan FC 150, Foss) were measured. Staphylococcal count was correlated to SCC (r=0.40), TBC (r=0.51), and SPC (r=0.53). Coliform count was correlated to TBC (r=0.33), but not to any of the other variables. Staphylococcus aureus did not correlate to SCC. The contribution of the staphylococcal count to the SPC was 31%, whereas the coliform count comprised only 1% of the SPC. The agreement of the repeated measurements was low. This study indicates that staphylococci in goat bulk milk are related to SCC and make a significant contribution to SPC. Because of the high variation in bacterial counts, repeated sampling is necessary to draw valid conclusions from bulk milk culturing. 2010 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.
Structural aspects of B2O3-substituted (PbO)0.5(SiO2)0.5 glasses
International Nuclear Information System (INIS)
Sudarsan, V.; Kulshreshtha, S.K.; Shrikhande, V.K.; Kothiyal, G.P.
2002-01-01
Lead borosilicate glasses having general formulae (PbO) 0.5-x (SiO 2 ) 0.5 (B 2 O 3 ) x with 0.0≤x≤0.4 and (PbO) 0.5 (SiO 2 ) 0.5-y (B 2 O 3 ) y with 0.0≤y≤0.5 have been prepared by a conventional melt-quench method and characterized by 29 Si, 11 B magic angle spinning (MAS) NMR techniques and infrared spectroscopy, as regards their structural features. From 29 Si NMR results, it has been inferred that with increasing concentration of boron oxide, (PbO) 0.5-x (SiO 2 ) 0.5 (B 2 O 3 )x glasses exhibit a systematic increase in the number of Q 4 structural units of Si at the expense of Q 2 structural units, along with the formation of Si-O-B linkages. On the other hand, for (PbO) 0.5 (SiO 2 ) 0.5-y (B 2 O 3 ) y glasses, there is no direct interaction between SiO 2 and B 2 O 3 in the glass network, as revealed by the 29 Si MAS NMR studies. Boron exists in both trigonal and tetrahedral configurations for these two series of glasses and for the (PbO) 0.5 (SiO 2 ) 0.5-y (B 2 O 3 ) y series of glasses; the relative concentration of these two structural units remains almost constant with increasing B 2 O 3 concentration. In contrast, for (PbO) 0.5-x (SiO 2 ) 0.5 (B 2 O 3 ) x glasses, there is a slight increase in the number of BO 3 structural units above x = 0.2, as there is a competition between SiO 2 and B 2 O 3 for interaction with Pb 2+ , thereby leading to the formation of BO 3 structural units. For both series of glasses, the thermal expansion coefficient is found to decrease with increasing B 2 O 3 concentration, the effect being more pronounced for the (PbO) 0.5-x (SiO 2 ) 0.5 (B 2 O 3 ) x series of glasses due to the increased concentration of Q 4 structural units of silicon and better cross-linking as a result of the formation of Si-O-B-type linkages. (author)
Pressure-based impact method to count bedload particles
Antico, Federica; Mendes, Luís; Aleixo, Rui; Ferreira, Rui M. L.
2017-04-01
Bedload transport processes determine morphological changes in fluvial, estuarine and coastal domains, thus impacting the diversity and quality of ecosystems and human activities such as river management, coastal protection or dam operation. In spite of the advancements made in the last 60 years, driven by the improvements in measurement techniques, research efforts on grain-scale mechanics of bedload are still required, especially to clarify the intermittent nature of bedload, its stochastic structure and its scale dependence. A new impact-based device to measure bedload transport - MiCas system - is presented in this work. It was designed to meet the following key requirements: simple data output composed of time instant and location of impacts; no need for post-processing - impacts determined through hardware and firmware; capable of computing simple statistics in real time such as cumulative particle counting and discrete lateral distribution of cumulative particle counts; able to run for very large time periods (days, weeks); ability to detect particle impacts of large size fractions that are separated by a few milliseconds; composed of robust and relatively cheap components. The system's firmware analyses pressure time series, namely recognizing the imprints of impacts of individual particles as they hit pressurized membranes. A pattern analysis algorithm is used to identify the impact events. The implementation of this principle in a dedicated microprocessor allows for the real-time measurements of particle hits and cumulative particle count. To validate the results obtained by the MiCas system, Experiments were carried out in the 12.5m long and 40.5cm wide glass-sided flume of the Laboratory of Hydraulics and Environment of Instituto Superior Técnico, Lisbon. This flume has two independent circuits for water and sediment recirculation. A cohesionless granular bed, composed of 4 layers of 5 mm glass beads, subjected to a steady-uniform turbulent open
Directory of Open Access Journals (Sweden)
Rima Parwati Sari
2017-12-01
Full Text Available Background: Bone damage can be caused by various factors with treatment usually involving graft materials being applied to the defective area. Moreover, in the bone defect healing process, blood vessels are also considered to be an important energy source for cell proliferation. One of the angiogenic factors playing an important role in blood vessel formation is basic fibroblast growth factor (bFGF. Furthermore, synthesized hydroxyapatite derived from Anadara granosa (AG shells constitutes one of the potential materials for use in bone graft. The gold sea cucumber genus Stichopus hermanni (SH possesses the ability to stimulate endothelial progenitor cells inducing bFGF. Purpose: This study aims to investigate the effects of AG shells and SH on bFGF expressions and blood vessel counts within the bone healing process. Methods: Twenty four male Wistar rats were divided into three groups, namely: a control group (C, a treatment group was administered with blood cockle shell (AG, and a treatment group with blood cockle shell and golden sea cucumber (AG+SH. Defects were made on their femurs measuring half the diameter of a circular, no. 018. bur These rats were subsequently sacrificed on day 7 after surgery. The expressions of bFGF were measured by means of IHC technique, while the number of blood vessels was quantified using HE technique. The resulting data was subjected to statistical analysis using an Anova test followed by an LSD test (p < 0.05. Results: The one-way Anova test results combined with those of an LSD test showed there to be significant differences in bFGF expressions and blood vessel counts between the control group (K and the treatment group (AG as well as between the treatment group (AG and the treatment group (AG+SH. Conclusions: A combination of Anadara granosa shell and Stichopus hermanni can increase the expression of bFGF and the number of blood vessels on day 7 during the bone healing process in Wistar rats.
DEFF Research Database (Denmark)
Eugen-Olsen, J; Iversen, Anton; Benfield, Thomas
1998-01-01
We have investigated the role of the recently described mutation in CCR2b named 64I in relation to HIV resistance, CD4 T-cell counts, and disease progression in Danish individuals by polymerase chain reaction (PCR)-based methods as well as sequenced full-length CXCR4 and CCR5 genes from HIV...... of AIDS, in AIDS-free survival as well as survival with AIDS, between 64I allele carriers and wild-type individuals. Among 9 long-term nonprogressors, 2 carried the 64I allele, while none of 9 fast progressors carried the 64I allele. However, this was not significantly different (p=.47). Long......-term nonprogression could not be explained by CXCR4 polymorphism or other polymorphisms in the CCR5 gene than the CCR5delta32 allele. Furthermore, we were not able to detect any significant independent effect of the 64I allele on development to AIDS, overall survival, and annual CD4 T-cell decline in this cohort....
Interim performance criteria for photovoltaic energy systems. [Glossary included
Energy Technology Data Exchange (ETDEWEB)
DeBlasio, R.; Forman, S.; Hogan, S.; Nuss, G.; Post, H.; Ross, R.; Schafft, H.
1980-12-01
This document is a response to the Photovoltaic Research, Development, and Demonstration Act of 1978 (P.L. 95-590) which required the generation of performance criteria for photovoltaic energy systems. Since the document is evolutionary and will be updated, the term interim is used. More than 50 experts in the photovoltaic field have contributed in the writing and review of the 179 performance criteria listed in this document. The performance criteria address characteristics of present-day photovoltaic systems that are of interest to manufacturers, government agencies, purchasers, and all others interested in various aspects of photovoltaic system performance and safety. The performance criteria apply to the system as a whole and to its possible subsystems: array, power conditioning, monitor and control, storage, cabling, and power distribution. They are further categorized according to the following performance attributes: electrical, thermal, mechanical/structural, safety, durability/reliability, installation/operation/maintenance, and building/site. Each criterion contains a statement of expected performance (nonprescriptive), a method of evaluation, and a commentary with further information or justification. Over 50 references for background information are also given. A glossary with definitions relevant to photovoltaic systems and a section on test methods are presented in the appendices. Twenty test methods are included to measure performance characteristics of the subsystem elements. These test methods and other parts of the document will be expanded or revised as future experience and needs dictate.
The nature of Zb states from a combined analysis of Υ(5S) → hb(mP)π+π- and Υ(5S) → B(*) anti B(*)π
International Nuclear Information System (INIS)
Huo, Wen-Sheng; Chen, Guo-Ying
2016-01-01
With a combined analysis of data on Υ(5S) → h b (1P, 2P)π + π - and Υ(5S) → B (*) anti B (*) π in an effective field theory approach, we determine resonance parameters of Z b states in two scenarios. In one scenario we assume that Z b states are pure molecular states, while in the other one we assume that Z b states contain compact components. We find that the present data favor that there should be some compact components inside Z b (') associated with themolecular components. By fitting the invariant mass spectra of Υ(5S) → h b (1P, 2P)π + π - and Υ(5S) → B (*) anti B * π, we determine that the probability of finding the compact components in Z b states may be as large as about 40 %. (orig.)
Koop, G.; Dik, N.; Nielen, M.; Lipman, L.J.A.
2010-01-01
The aims of this study were to assess how different bacterial groups in bulk milk are related to bulk milk somatic cell count (SCC), bulk milk total bacterial count (TBC), and bulk milk standard plate count (SPC) and to measure the repeatability of bulk milk culturing. On 53 Dutch dairy goat farms,
A new stratification of mourning dove call-count routes
Blankenship, L.H.; Humphrey, A.B.; MacDonald, D.
1971-01-01
The mourning dove (Zenaidura macroura) call-count survey is a nationwide audio-census of breeding mourning doves. Recent analyses of the call-count routes have utilized a stratification based upon physiographic regions of the United States. An analysis of 5 years of call-count data, based upon stratification using potential natural vegetation, has demonstrated that this uew stratification results in strata with greater homogeneity than the physiographic strata, provides lower error variance, and hence generates greatet precision in the analysis without an increase in call-count routes. Error variance was reduced approximately 30 percent for the contiguous United States. This indicates that future analysis based upon the new stratification will result in an increased ability to detect significant year-to-year changes.
Energy Technology Data Exchange (ETDEWEB)
Balpardo, C., E-mail: balpardo@cae.cnea.gov.a [Laboratorio de Metrologia de Radioisotopos, CNEA, Buenos Aires (Argentina); Capoulat, M.E.; Rodrigues, D.; Arenillas, P. [Laboratorio de Metrologia de Radioisotopos, CNEA, Buenos Aires (Argentina)
2010-07-15
The nuclide {sup 241}Am decays by alpha emission to {sup 237}Np. Most of the decays (84.6%) populate the excited level of {sup 237}Np with energy of 59.54 keV. Digital coincidence counting was applied to standardize a solution of {sup 241}Am by alpha-gamma coincidence counting with efficiency extrapolation. Electronic discrimination was implemented with a pressurized proportional counter and the results were compared with two other independent techniques: Liquid scintillation counting using the logical sum of double coincidences in a TDCR array and defined solid angle counting taking into account activity inhomogeneity in the active deposit. The results show consistency between the three methods within a limit of a 0.3%. An ampoule of this solution will be sent to the International Reference System (SIR) during 2009. Uncertainties were analysed and compared in detail for the three applied methods.
Valence behavior of Eu-ions in intermetallic compound Ce{sub 0.5}Eu{sub 0.5}Pd{sub 3}B{sub 0.5}
Energy Technology Data Exchange (ETDEWEB)
Pandey, Abhishek, E-mail: apandey@ameslab.gov [Experimental Condensed Matter Physics Division, Saha Institute of Nuclear Physics, 1/AF, Bidhannagar, Kolkata 700064 (India); S.N. Bose National Centre for Basic Sciences, Block-JD, Sector-III, Salt Lake, Kolkata 700098 (India); Mazumdar, Chandan, E-mail: chandan.mazumdar@saha.ac.in [S.N. Bose National Centre for Basic Sciences, Block-JD, Sector-III, Salt Lake, Kolkata 700098 (India); Ranganathan, R. [S.N. Bose National Centre for Basic Sciences, Block-JD, Sector-III, Salt Lake, Kolkata 700098 (India); Raghavendra Reddy, V.; Gupta, Ajay [UGC-DAE Consortium for Scientific Research, University Campus, Khandawa Road, Indore (India)
2011-12-15
We have studied the valence behavior of rare-earth ions, in particular Eu-ions, in a cubic intermetallic compound Ce{sub 0.5}Eu{sub 0.5}Pd{sub 3}B{sub 0.5} which is a homogeneous solid solution of two mixed-valent compounds CePd{sub 3} and EuPd{sub 3}B. Results of {sup 151}Eu Moessbauer spectroscopic measurements show that two different valence states, i.e., divalent- and trivalent-like states of Eu-ions exist in the compound. The possible reason for the observed heterogeneous valency vis-a-vis the variation in the chemical environment and the number of nearest-neighbor B atoms surrounding the Eu-ions has been discussed. Our results demonstrate that B incorporation in such Eu-based cubic intermetallic compounds leads to a situation where heterogeneous-valence state of Eu-ions is an energetically favorable ground state. - Highlights: > Intermetallic compound Ce{sub 0.5}Eu{sub 0.5}Pd{sub 3}B{sub 0.5} crystallizes in a single phase. > Eu-ions in Ce{sub 0.5}Eu{sub 0.5}Pd{sub 3}B{sub 0.5} are charge-ordered compared to +2.3 valency in Ce{sub 0.5}Eu{sub 0.5}Pd{sub 3}. > B incorporation makes charge-ordered state of Eu-ions energetically more favorable. > Nearest-neighbor chemical environment affects the Eu valency.
A method for the measurement of the intrinsic dead time of a counting system
International Nuclear Information System (INIS)
Wyllie, H.A.
1989-01-01
Equations are derived for (a) the determination of the intrinsic dead time of a counting system in the components preceding the paralysis unit which imposes the set dead time, and (b) a more accurate correction of count rates in a single-channel system, taking into account the extension of the set dead time by the intrinsic dead time. (author)
International Nuclear Information System (INIS)
Sinistrero, G.; Sismondi, P.; Rumore, A.; Zola, P.
1993-01-01
We analysed the complications of 215 patients with uterine cervix cancer, treated by radiotherapy (RT) alone. It was done according to the rules of the Franco-Italian glossary, presented at the 7th ESTRO meeting, held in The Hague on September 1988. They were ranked by organ sites and by degrees of gravity. The analysis was done on the total number of complications and they were scored at the highest reached grade of gravity. Seventy one complications were found in 55 patients; they were studied by patient, degree of severity, time of onset, organ system and grade, time of onset and grade, time of onset and organ sites, stage and RT doses and brachytherapy volumes. The importance of the study of complications is stressed, particularly when treatment combines external RT and brachytherapy; some guidelines are given to avoid severe complications. (author) tabs. figs
Sinistrero, G; Sismondi, P; Rumore, A; Zola, P
1993-03-01
We analysed the complications of 215 patients with uterine cervix cancer, treated by radiotherapy (RT) alone. It was done according to the rules of the Franco-Italian glossary, presented at the 7th ESTRO meeting, held in The Hague on September 1988. They were ranked by organ sites and by degrees of gravity. The analysis was done on the total number of complications and they were scored at the highest reached grade of gravity. Seventy one complications were found in 55 patients; they were studied by patient, degree of severity, time of onset, organ system and grade, time of onset and grade, time of onset and organ sites, stage and RT doses and brachytherapy volumes. The importance of the study of complications is stressed, particularly when treatment combines external RT and brachytherapy; some guidelines are given to avoid severe complications.
Low 5-HT1B receptor binding in the migraine brain
DEFF Research Database (Denmark)
Deen, Marie; Hansen, Hanne D; Hougaard, Anders
2018-01-01
Background The pathophysiology of migraine may involve dysfunction of serotonergic signaling. In particular, the 5-HT1B receptor is considered a key player due to the efficacy of 5-HT1B receptor agonists for treatment of migraine attacks. Aim To examine the cerebral 5-HT1B receptor binding....... Patients who reported migraine brain regions involved in pain modulation as regions of interest and applied a latent variable model (LVM) to assess the group effect on binding across these regions. Results Our data...... support a model wherein group status predicts the latent variable ( p = 0.038), with migraine patients having lower 5-HT1B receptor binding across regions compared to controls. Further, in a whole-brain voxel-based analysis, time since last migraine attack correlated positively with 5-HT1B receptor...
2010-10-01
... DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION PRIVACY ACT REGULATIONS § 5b.13 Fees. (a) Policy. Where applicable, fees for copying records will be charged in accordance with the schedule set... whether the search is manual, mechanical, or electronic. Where a copy of the record must be made in order...
Investigating Children's Abilities to Count and Make Quantitative Comparisons
Lee, Joohi; Md-Yunus, Sham'ah
2016-01-01
This study was designed to investigate children's abilities to count and make quantitative comparisons. In addition, this study utilized reasoning questions (i.e., how did you know?). Thirty-four preschoolers, mean age 4.5 years old, participated in the study. According to the results, 89% of the children (n = 30) were able to do rote counting and…
IDENTIFICATION OF BACTERIA CAUSING DIARRHOEA IN HIV/AIDS PATIENTS AND ITS CORRELATION WITH CD4 COUNT
Directory of Open Access Journals (Sweden)
Anand Premanand
2016-05-01
Full Text Available BACKGROUND The number of HIV-positive patients is increasing in India. Data on the prevalence of diarrhoea and the spectrum of bacteria responsible for diarrhoea in HIV- positive patients is lacking in our area. The identification of enteric pathogens in patients with HIV/AIDS is important because an increasing array of therapeutic regimens is becoming available to treat many of these infections. Thus, an attempt is done to elucidate the associations between causative bacteria of acute and chronic diarrhoea and CD4 count. METHODS Stool specimens were obtained over a period of eighteen months from HIV infected adults with diarrhoea presenting to Shri B M Patil Medical College Hospital and Research Centre, Vijayapura. In all patients with diarrhoea, stool specimens were examined by microscopy and cultures to identify bacterial pathogens and blood sample was analysed for CD4 count. RESULTS A total of 80 individuals were enrolled in this study. Cases included 46 males and 34 females. Among the cases, maximum subjects were found to be in the age group of 30-40 years in which 23 (62.2% were males and 14 (37.8% were females. 56 had acute and 24 had chronic diarrhoea. The percentages of bacteria isolated were 5 (8.9% in acute and 16 (66.7% in chronic diarrhoea respectively. The most common bacteria isolated was E. Coli (17.5% followed by Klebsiella (5% and Shigella Sps (3.75%. Patients with chronic diarrhoea had lower CD4 cell counts. The maximum bacterial isolation was in the patients whose CD4 cell counts were below 200 cells/mm3. CONCLUSION Bacterial isolation was most strongly associated with low CD4 counts and chronic diarrhoea. E. coli was isolated maximum among all the bacteria in the HIV patients. Over two-thirds of diarrhoeal episodes were undiagnosed, suggesting that unidentified agents or primary HIV enteropathy are important causes of diarrhoea in this population. There is a strong negative association between duration of diarrhoea and CD4
296-B-5 Stack monitoring and sampling system annual system assessment report
International Nuclear Information System (INIS)
Ridge, T.M.
1995-02-01
The B Plant Administration Manual requires an annual system assessment to evaluate and report the present condition of the sampling and monitoring system associated with Stack 296-B-5 at B Plant. The sampling and monitoring system associated with stack 296-B-5 is functional and performing satisfactorily. This document is an annual assessment report of the systems associated with the 296-B-5 stack
Influence of 5% dextrose volume on amphotericin B deoxycholate preparation.
Sun, Pingping; Chen, Jie; Zhang, Zhihao; Gao, Xiang; Chen, Pan; Li, Shuxia
2016-04-01
Preparation of amphotericin B deoxycholate (AmB-d) in different volumes of 5% dextrose (D5W) was studied to investigate a interesting phenomenon that AmB-d was easy to bring pipe blockage when diluted in 500 ml but not in 50 ml. AmB-d (25 mg/vial) in 50 ml, 250 ml or 500 ml D5W was prepared. Fluids were collected before and after infusion, then were assayed by validated high-performance liquid chromatography (HPLC) method. Light obscuration assay was used to detect the particles in transfusions. pH values of different volumes of D5W were all about 3.7, which was lower than the requirement of AmB-d package insert (pH > 4.2). The number of insoluble particles >10 μm/25 μm in 25 mg/500 ml infusions exceeded China Pharmacopoeia limit. Filters in 25 mg/500 ml infusion set were full of AmB-d after dripping slowly for 6 h, and 331.3 ml solution was left in the bottles and only 11.3% of AmB-d could flow out. Whereas the AmB-d infusion consists of 25 mg/50 ml, 25 mg/250 ml and 50 mg/500 ml could meet with China Pharmacopoeia standards, and they flowed out easily and completely. In practice, 25 mg/250 ml and 50 mg/500 ml would be more suitable for clinical use, rather than 25 mg/500 ml. We provided a convenient method for AmB-d preparation. © 2016 Royal Pharmaceutical Society, Journal of Pharmacy and Pharmacology.
Coincidence and noncoincidence counting (81Rb and 43K): a comparative study
International Nuclear Information System (INIS)
Ikeda, S.; Duken, H.; Tillmanns, H.; Bing, R.J.
1975-01-01
The accuracy of imaging and resolution obtained with 81 Rb and 43 K using coincidence and noncoincidence counting was compared. Phantoms and isolated infarcted dog hearts were used. The results clearly show the superiority of coincidence counting with a resolution of 0.5 cm. Noncoincidence counting failed to reveal even sizable defects in the radioactive source. (U.S.)
5 CFR 870.1205 - Electing portability for Option B.
2010-01-01
... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Electing portability for Option B. 870... portability for Option B. (a) The employing agency must notify the employee/assignee(s) of the loss of coverage and the right to elect portability for Option B either before or immediately after the event...
Full Text Available ... Like this video? Sign in to make your opinion count. Sign in 131 2 Don't like this video? Sign in to make your opinion count. Sign in 3 Loading... Loading... Transcript The ...
Lai, Chieh-Hsien; Wu, Sih-Rong; Pang, Jen-Chieh; Ramireddy, Latha; Chiang, Yu-Cheng; Lin, Chien-Ku; Tsen, Hau-Yang
2017-07-01
The purpose of this study is to evaluate the efficiency of using propidium monoazide (PMA) real-time quantitative polymerase chain reaction (qPCR) to count the viable cells of Lactobacillus gasseri and Lactobacillus salivarius in probiotic products. Based on the internal transcription spacer and 23S rRNA genes, two primer sets specific for these two Lactobacillus species were designed. For a probiotic product, the total deMan Rogosa Sharpe plate count was 8.65±0.69 log CFU/g, while for qPCR, the cell counts of L. gasseri and L. salivarius were 8.39±0.14 log CFU/g and 8.57±0.24 log CFU/g, respectively. Under the same conditions, for its heat-killed product, qPCR counts for L. gasseri and L. salivarius were 6.70±0.16 log cells/g and 7.67±0.20 log cells/g, while PMA-qPCR counts were 5.33±0.18 log cells/g and 5.05±0.23 log cells/g, respectively. For cell dilutions with a viable cell count of 8.5 log CFU/mL for L. gasseri and L. salivarius, after heat killing, the PMA-qPCR count for both Lactobacillus species was near 5.5 log cells/mL. When the PMA-qPCR counts of these cell dilutions were compared before and after heat killing, although some DNA might be lost during the heat killing, significant qPCR signals from dead cells, i.e., about 4-5 log cells/mL, could not be reduced by PMA treatment. Increasing PMA concentrations from 100 μM to 200 μM or light exposure time from 5 minutes to 15 minutes had no or, if any, only minor effect on the reduction of qPCR signals from their dead cells. Thus, to differentiate viable lactic acid bacterial cells from dead cells using the PMA-qPCR method, the efficiency of PMA to reduce the qPCR signals from dead cells should be notable. Copyright © 2016. Published by Elsevier B.V.
Automation system for optical counting of nuclear tracks
Energy Technology Data Exchange (ETDEWEB)
Boulyga, S.F.; Boulyga, E.G.; Lomonosova, E.M.; Zhuk, I.V
1999-06-01
An automation system consisting of the microscope, video camera and Pentium PC with frame recorder was created. The system provides counting of nuclear tracks on the SSNTD surface with a resolution of 752 x 582 points, determination of the surface area and main axis of the track. The pattern recognition program was developed for operation in Windows 3.1 (or higher) ensuring a convenient interface with the user. In a comparison of the results on automatic track counting with the more accurate hand mode it was shown that the program enables the tracks to be detected even on images with a rather high noise level. It ensures a high accuracy of track counting being comparable with the accuracy of manual counting for densities of tracks in the range of up to 2{center_dot}10{sup 5} tracks/cm{sup 2}. The automatic system was applied in the experimental investigation of uranium and transuranium elements.
Automation system for optical counting of nuclear tracks
International Nuclear Information System (INIS)
Boulyga, S.F.; Boulyga, E.G.; Lomonosova, E.M.; Zhuk, I.V.
1999-01-01
An automation system consisting of the microscope, video camera and Pentium PC with frame recorder was created. The system provides counting of nuclear tracks on the SSNTD surface with a resolution of 752 x 582 points, determination of the surface area and main axis of the track. The pattern recognition program was developed for operation in Windows 3.1 (or higher) ensuring a convenient interface with the user. In a comparison of the results on automatic track counting with the more accurate hand mode it was shown that the program enables the tracks to be detected even on images with a rather high noise level. It ensures a high accuracy of track counting being comparable with the accuracy of manual counting for densities of tracks in the range of up to 2·10 5 tracks/cm 2 . The automatic system was applied in the experimental investigation of uranium and transuranium elements
Automation system for optical counting of nuclear tracks
Boulyga, S F; Lomonosova, E M; Zhuk, I V
1999-01-01
An automation system consisting of the microscope, video camera and Pentium PC with frame recorder was created. The system provides counting of nuclear tracks on the SSNTD surface with a resolution of 752 x 582 points, determination of the surface area and main axis of the track. The pattern recognition program was developed for operation in Windows 3.1 (or higher) ensuring a convenient interface with the user. In a comparison of the results on automatic track counting with the more accurate hand mode it was shown that the program enables the tracks to be detected even on images with a rather high noise level. It ensures a high accuracy of track counting being comparable with the accuracy of manual counting for densities of tracks in the range of up to 2 centre dot 10 sup 5 tracks/cm sup 2. The automatic system was applied in the experimental investigation of uranium and transuranium elements.
International Nuclear Information System (INIS)
Lemmel, H.D.
1986-05-01
This document summarizes the contents of the Actinides part of the ENDF/B-5 nuclear data library released by the US National Nuclear Data Center. This library or selective retrievals of it, are available costfree from the IAEA Nuclear Data Section upon request. The present version of the library is the Revision of 1986. (author). Refs, figs and tabs
75 FR 31810 - Information Collection for IDEIA Part B and C Child Counts; Comment Request
2010-06-04
... education and related services for American Indian children aged 0 to 5 with disabilities on reservations... for special education and related services for Indian children aged 0 to 5 with disabilities on... children aged 0 to 2 covered by IDEIA Part C. In IDEIA Part B--Assistance for Education of All Children...
Memory Enhancement by Targeting Cdk5 Regulation of NR2B
Plattner, Florian; Hernandéz, Adan; Kistler, Tara M.; Pozo, Karine; Zhong, Ping; Yuen, Eunice Y.; Tan, Chunfeng; Hawasli, Ammar H.; Cooke, Sam F.; Nishi, Akinori; Guo, Ailan; Wiederhold, Thorsten; Yan, Zhen; Bibb, James A.
2014-01-01
SUMMARY Many psychiatric and neurological disorders are characterized by learning and memory deficits, for which cognitive enhancement is considered a valid treatment strategy. The N-methyl-D-aspartate receptor (NMDAR) is a prime target for the development of cognitive enhancers due to its fundamental role in learning and memory. In particular, the NMDAR subunit NR2B improves synaptic plasticity and memory when over-expressed in neurons. However, NR2B regulation is not well understood and no therapies potentiating NMDAR function have been developed. Here, we show that serine 1116 of NR2B is phosphorylated by cyclin-dependent kinase 5 (Cdk5). Cdk5-dependent NR2B phosphorylation is regulated by neuronal activity and controls the receptor’s cell surface expression. Disrupting NR2B-Cdk5 interaction using a small interfering peptide (siP) increases NR2B surface levels, facilitates synaptic transmission, and improves memory formation in vivo. Our results reveal a novel regulatory mechanism critical to NR2B function that can be targeted for the development of cognitive enhancers. PMID:24607229
A Novel Role for C5a in B-1 Cell Homeostasis
Directory of Open Access Journals (Sweden)
Katharina Bröker
2018-02-01
Full Text Available B-1 cells constitute a unique subpopulation of lymphocytes residing mainly in body cavities like the peritoneal cavity (PerC but are also found in spleen and bone marrow (BM. As innate-like B cells, they mediate first line immune defense through low-affinity natural IgM (nIgM antibodies. PerC B-1 cells can egress to the spleen and differentiate into nIgM antibody-secreting plasma cells that recognize conserved exogenous and endogenous cellular structures. Homing to and homeostasis within the PerC are regulated by the chemokine CXCL13 released by PerC macrophages and stroma cells. However, the exact mechanisms underlying the regulation of CXCL13 and B-1 homeostasis are not fully explored. B-1 cells play important roles in the inflammatory response to infection, autoimmunity, ischemia/reperfusion injury, obesity, and atherosclerosis. Remarkably, this list of inflammatory entities has a strong overlap with diseases that are regulated by complement suggesting a link between B-1 cells and the complement system. Interestingly, up to now, no data exist regarding the role of complement in B-1 cell biology. Here, we demonstrate for the first time that C5a regulates B-1 cell steady-state dynamics within the peritoneum, the spleen, and the BM. We found decreased B-1a cell numbers in the peritoneum and the spleen of C5aR1−/− mice associated with increased B1-a and B1-b numbers in the spleen and high serum titers of nIgM antibodies directed against phosphorylcholine and several pneumococcal polysaccharides. Similarly, peritoneal B-1a cells were decreased in the peritoneum and splenic B-1a and B-1b cells were increased in C5aR2−/− mice. The decrease in peritoneal B-1 cell numbers was associated with decreased peritoneal CXCL13 levels in C5aR1−/− and C5aR2−/− mice. In search for mechanisms, we found that combined TLR2 and IL-10 receptor activation in PerC macrophages induced strong CXCL13 production, which was significantly reduced in cells
Noun Countability; Count Nouns and Non-count Nouns, What are the Syntactic Differences Between them?
Directory of Open Access Journals (Sweden)
Azhar A. Alkazwini
2016-11-01
Full Text Available Words that function as the subjects of verbs, objects of verbs or prepositions and which can have a plural form and possessive ending are known as nouns. They are described as referring to persons, places, things, states, or qualities and might also be used as an attributive modifier. In this paper, classes and subclasses of nouns shall be presented, then, noun countability branching into count and non-count nous shall be discussed. A number of present examples illustrating differences between count and non-count nouns and this includes determiner-head-co-occurrence restrictions of number, subject-verb agreement, in addition to some exceptions to this agreement rule shall be discussed. Also, the lexically inherent number in nouns and how inherently plural nouns are classified in terms of (+/- count are illustrated. This research will discuss partitive construction of count and non-count nouns, nouns as attributive modifier and, finally, conclude with the fact that there are syntactic difference between count and non-count in the English Language.
Shaffer, Nathan; Sangrujee, Nalinee; Abimbola, Taiwo O
2014-01-01
Abstract Objective To estimate the incremental cost over 5 years of a policy switch from the Option B to the Option B+ protocol for the prevention of mother-to-child transmission (PMTCT) of the human immunodeficiency virus (HIV). Methods Data from cost studies and other published sources were used to determine the cost, per woman and per cohort (1000 breastfeeding and 1000 non-breastfeeding women), of switching from Option B (maternal triple antiretroviral [ARV] regimen during pregnancy and breastfeeding plus daily nevirapine for the infant for 6 weeks) to Option B+ (maternal triple ARV regimen initiated during pregnancy and continued for life). The variables used to model the different scenarios were maternal CD4+ T lymphocyte (CD4+ cell) count (350–500 versus > 500 cells/µl), rate of decline in CD4+ cells (average, rapid, slow), breastfeeding status (yes, no) and breastfeeding duration (12, 18 or 24 months). Findings For women with CD4+ cell counts of 350–500 cells/µl, the incremental cost per 1000 women was 157 345 United States dollars (US$) for breastfeeding women and US$ 92 813 for non-breastfeeding women. For women with CD4+ cell counts > 500 cells/µl, the incremental cost per 1000 women ranged from US$ 363 443 to US$ 484 591 for breastfeeding women and was US$ 605 739 for non-breastfeeding women. Conclusion From a cost perspective, a policy switch from Option B to Option B+ is feasible in PMTCT programme settings where resources are currently being allocated to Option B. PMID:24700975
Distributed plastic optical fibre measurement of pH using a photon counting OTDR
International Nuclear Information System (INIS)
Saunders, C; Scully, P J
2005-01-01
Distributed measurement of pH was demonstrated at a sensitised region 4m from the distal end of a 20m length of plastic optical fibre. The cladding was removed from the fibre over 150mm and the bare core was exposed to an aqueous solution of methyl red at three values of pH, between 2.89 and 9.70. The optical fibre was interrogated at 648nm using a Luciol photon counting optical time domain reflectometer, and demonstrated that the sensing region was attenuated as a function of pH. The attenuation varied from 16.3 dB at pH 2.89 to 8.6 dB at pH 9.70; this range equated to -1.13 ± 0.04 dB/pH. It is thus possible to determine both the position to ± 12mm and pH to an estimated ± 0.5pH at the sensing region
Full Text Available ... starting stop Loading... Watch Queue Queue __count__/__total__ It’s YouTube. Uninterrupted. Loading... Want music and videos with ... ads? Get YouTube Red. Working... Not now Try it free Find out why Close Clean Hands Count ...
Inhibin B as a serum marker of spermatogenesis
DEFF Research Database (Denmark)
Jensen, T K; Andersson, A M; Hjollund, N H
1997-01-01
= -0.61, P sperm concentration (r = -0.40, P sperm concentration (r = 0.38, P sperm counts below 20 mill/mL among men who's inhibin B....... All blood samples were analyzed in the same laboratory. Median sperm concentration and the percentage of morphologically normal spermatozoa were significantly higher among men from centre A (56.0 mill/mL and 42.5%), compared with men from centre B (44.8 mill/mL and 39%). Men from centre B had...... reproductive health, may serve as a new marker of spermatogenesis, in addition to sperm concentration and serum FSH....
Evaluating call-count procedures for measuring local mourning dove populations
Armbruster, M.J.; Baskett, T.S.; Goforth, W.R.; Sadler, K.C.
1978-01-01
Seventy-nine mourning dove call-count runs were made on a 32-km route in Osage County, Missouri, May 1-August 31, 1971 and 1972. Circular study areas, each 61 ha, surrounding stop numbers 4 and 5, were delineated for intensive nest searches and population estimates. Tallies of cooing male doves along the entire call-count route were quite variable in repeated runs, fluctuating as much as 50 percent on consecutive days. There were no consistent relationships between numbers of cooing males tallied at stops 4 and 5 and the numbers of current nests or doves estimated to be present in the surrounding study areas. We doubt the suitability of call-count procedures to estimate precisely the densities of breeding pairs, nests or production of doves on small areas. Our findings do not dispute the usefulness of the national call-count survey as an index to relative densities of mourning doves during the breeding season over large portions of the United States, or as an index to annual population trends.
Daily variability of strongyle fecal egg counts in horses
DEFF Research Database (Denmark)
Carstensen, Helena; Larsen, Lene; Ritz, Christian
2013-01-01
Strongyle parasites are ubiquitous in grazing horses and constitute a potential threat to equine health. Feces were collected from six horses four times daily over a period of 5 days. Fecal egg counts (FECs) were performed to identify any diurnal rhythms in strongyle egg shedding and to quantify...... variability at the different levels: individual horses, repeated counts, repeated subsamples, different time points, and different days. No significant differences in FECs were found between the different time points (P = .11). The variables-horse, day, subsample, and egg count-accounted for a variance of 104...... subsamples and repeated egg counts on the same subsamples, whereas the variability of FECs between following days can be considered negligible. The findings of this study have implication for designing and performing field surveillance of strongyle FEC levels and applying the FEC reduction test...
Energy Technology Data Exchange (ETDEWEB)
Foeldiak, G; Stenger, V
1982-01-01
It is a textbook and manual of a training course held at the Budapest Technical University for operators of irradiation devices. Calculation methods of radiation technology (estimation of activity variation, space dependence of dose rates, shielding, efficiency) are presented. Instructions for laboratory exercises (dose and dose rate measurements, sterilization by irradiation, handling of irradiation devices) involved in the course given. Two laboratory irradiation devices (RH-GAMMA-30, produced in the Soviet Union and the K-120-type semi-large scale device of the Isotope Institute of the Hungarian Academy of Sciences are described in detail. Handling instructions for the two devices and radiation protection regulations are given. A brief glossary in the field of radiation technology is added.
Count-to-count time interval distribution analysis in a fast reactor
International Nuclear Information System (INIS)
Perez-Navarro Gomez, A.
1973-01-01
The most important kinetic parameters have been measured at the zero power fast reactor CORAL-I by means of the reactor noise analysis in the time domain, using measurements of the count-to-count time intervals. (Author) 69 refs
International Nuclear Information System (INIS)
Alfassi, Z.B.; Lavi, N.
2005-01-01
The effect of the density of the radioactive material packed in a Marinelli beaker on the counting efficiency was studied. It was found that for all densities (0.4-1.7g/cm 3) studied the counting efficiency (ε) fits the linear log-log dependence on the photon energy (E) above 200keV, i.e. obeying the equation ε=αE β (α, β-parameters). It was found that for each photon energy the counting efficiency is linearly dependent on the density (ρ) of the matrix. ε=a-bρ (a, b-parameters). The parameters of the linear dependence are energy dependent (linear log-log dependence), leading to a final equation for the counting efficiency of Marinelli beaker involving both density of the matrix and the photon energy: ε=α 1 .E β 1 -α 2 E β 2 ρ
Microstructural analysis of hot press formed 22MnB5 steel
Aziz, Nuraini; Aqida, Syarifah Nur; Ismail, Izwan
2017-10-01
This paper presents a microstructural study on hot press formed 22MnB5 steel for enhanced mechanical properties. Hot press forming process consists of simultaneous forming and quenching of heated blank. The 22MnB5 steel was processed at three different parameter settings: quenching time, water temperature and water flow rate. 22MnB5 was processed using 33 full factorial design of experiment (DOE). The full factorial DOE was designed using three factors of quenching time, water temperature and water flow rate at three levels. The factors level were quenching time range of 5 - 11 s, water temperature; 5 - 27°C and water flow rate; 20 - 40 L/min. The as-received and hot press forming processed steel was characterised for metallographic study and martensitic structure area percentage using JEOL Field Emission Scanning Electron Microscopic (FESEM). From the experimental finding, the hot press formed 22MnB5 steel consisted of 50 to 84% martensitic structure area. The minimum quenching time of 8 seconds was required to obtain formed sample with high percentage of martensite. These findings contribute to initial design of processing parameters in hot press forming of 22MnB5 steel blanks for automotive component.
46 CFR 32.63-5 - Barge hull classifications-B/ALL.
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Barge hull classifications-B/ALL. 32.63-5 Section 32.63..., AND HULL REQUIREMENTS Hull and Cargo Tank Requirements for Tank Barges Constructed or Converted On or After July 1, 1964, and Carrying Certain Dangerous Bulk Cargoes § 32.63-5 Barge hull classifications—B...
[Complete blood count reference values of donated cord blood from Korean neonates].
Lee, Hye Ryun; Shin, Sue; Yoon, Jong Hyun; Kim, Byoung Jae; Hwang, Kyu Ri; Kim, Jin Ju; Roh, Eun Youn
2009-06-01
In the public cord blood (CB) banks, only safe CB units with adequate cell doses are processed and stored. Complete blood count (CBC) of CB is crucial for estimating total nucleated cells (TNC) and screening suitable CB units without hematologic abnormalities. We analyzed CBC parameters of the donated CB from healthy Korean neonates to establish CBC reference values. A total of 2,129 Korean CB units, donated and processed during the period from August 2007 to December 2007, were enrolled. We measured hemoglobin (Hb), white blood cell (WBC) count, differential count of WBC, platelets and nucleated red blood cell (nRBC) count by XE-2100 automated hematology analyzer (Sysmex, Japan), and estimated reference value of each parameter by using parametric (Mean+/-2SD) and/or non-parametric methods (2.5-97.5 percentile). And also, we compared the result of each parameter in relation to sex of neonates and delivery method. Because the differences of CBC values among different subgroups were not remarkable, we established the reference intervals as follows without subgroup division: Hb, 9.0-14.4 g/dL; WBC count, 5.6-18.5 x 10(3)/microL; differential count of WBC (neutrophils, 40.8-72.4%; lymphocytes, 17.2-46.7%; monocytes, 4.9-12.8%; eosinophils, 0.7-7.0%; basophils, 0.0-1.6%); platelet, 130-287 x 10(3)/microL; nRBCs, 0.0-13.1/100 WBC. We established cord blood CBC reference values of healthy Korean neonates using a large-scale CB units. The established CBC reference values from our study will be useful as basic data for CBC interpretation and assessment of transplant suitability of donated CB.
Alvin Leroy Medina
1988-01-01
The English-Spanish/Spanish-English equivalent translations of scientific and management terms (jargon) commonly used in the field of natural resource management are presented. The glossary is useful in improving communications and fostering understanding between Spanish- and English-speaking persons.
Directory of Open Access Journals (Sweden)
Narsimha Reddy Penthala
2016-05-01
Full Text Available (Z-5-[2-(Benzo[b]thiophen-2-yl-1-(3,5-dimethoxyphenylethenyl]-1H-tetrazole methanol monosolvate, C19H16N4O2S·CH3OH, (I, was prepared by the reaction of (Z-3-(benzo[b]thiophen-2-yl-2-(3,5-dimethoxyphenylacrylonitrile with tributyltin azide via a [3 + 2]cycloaddition azide condensation reaction. The structurally related compound (Z-5-[2-(benzo[b]thiophen-3-yl-1-(3,4,5-trimethoxyphenylethenyl]-1H-tetrazole, C20H18N4O3S, (II, was prepared by the reaction of (Z-3-(benzo[b]thiophen-3-yl-2-(3,4,5-trimethoxyphenylacrylonitrile with tributyltin azide. Crystals of (I have two molecules in the asymmetric unit (Z′ = 2, whereas crystals of (II have Z′ = 1. The benzothiophene rings in (I and (II are almost planar, with r.m.s deviations from the mean plane of 0.0084 and 0.0037 Å in (I and 0.0084 Å in (II. The tetrazole rings of (I and (II make dihedral angles with the mean planes of the benzothiophene rings of 88.81 (13 and 88.92 (13° in (I, and 60.94 (6° in (II. The dimethoxyphenyl and trimethoxyphenyl rings make dihedral angles with the benzothiophene rings of 23.91 (8 and 24.99 (8° in (I and 84.47 (3° in (II. In both structures, molecules are linked into hydrogen-bonded chains. In (I, these chains involve both tetrazole and methanol, and are parallel to the b axis. In (II, molecules are linked into chains parallel to the a axis by N—H...N hydrogen bonds between adjacent tetrazole rings.
ELECTRON-CAPTURE FROM LI BY B-5+, N-5+ AND BE-4+ IONS
HOEKSTRA, R; OLSON, RE; FOLKERTS, HO; WOLFRUM, E; PASCALE, J; DEHEER, FJ; MORGENSTERN, R; WINTER, H
1993-01-01
We present state selective experimental and theoretical results for electron capture in B-5+ and N5+-Li collisons at energies in the range of 1-10 keV amu-1. Experimentally we have used photon emission spectroscopy in the VUV and visible spectral range and theoretically we have performed classical
International Nuclear Information System (INIS)
Knoche, H.W.; Parkhurst, A.M.; Tam, S.W.
1979-01-01
The effect of volume on the liquid scintillation counting performance of 14 C-samples has been investigated. A decrease in counting efficiency was observed for samples with volumes below about 6 ml and those above about 18 ml when unquenched samples were assayed. Two quench-correction methods, sample channels ratio and external standard channels ratio, and three different liquid scintillation counters, were used in an investigation to determine the magnitude of the error in predicting counting efficiencies when small volume samples (2 ml) with different levels of quenching were assayed. The 2 ml samples exhibited slightly greater standard deviations of the difference between predicted and determined counting efficiencies than did 15 ml samples. Nevertheless, the magnitude of the errors indicate that if the sample channels ratio method of quench correction is employed, 2 ml samples may be counted in conventional counting vials with little loss in counting precision. (author)
Nutritional status, quality of life and CD4 cell count of adults living ...
African Journals Online (AJOL)
Keywords: CD4 cell count; Quality of Life; adults; nutritional status; nutritional intake. Nutritional status .... used to calculate the Body Mass Index (BMI). BMI was ... fat consumption as a percentage of the total food energy intake, and component ..... except when the CD4 counts fall very low.5,27 The CD4 cell count may offer a ...
Stable knockdown of Kif5b in MDCK cells leads to epithelial–mesenchymal transition
International Nuclear Information System (INIS)
Cui, Ju; Jin, Guoxiang; Yu, Bin; Wang, Zai; Lin, Raozhou; Huang, Jian-Dong
2015-01-01
Polarization of epithelial cells requires vectorial sorting and transport of polarity proteins to apical or basolateral domains. Kif5b is the mouse homologue of the human ubiquitous Kinesin Heavy Chain (uKHC). To investigate the function of Kif5b in epithelial cells, we examined the phenotypes of Kif5b-deficient MDCK cells. Stable knockdown of Kif5b in MDCK cells resulted in reduced cell proliferation rate, profound changes in cell morphology, loss of epithelial cell marker, and gain of mesenchymal marker, as well as increased cell migration, invasion, and tumorigenesis abilities. E-cadherin and NMMIIA could interact with Kif5b in polarized MDCK cells, and their expression levels were decreased in Kif5b-deficient MDCK cells. Overexpression of E-cadherin and NMMIIA in Kif5b depleted MDCK cells could decrease mesenchymal marker expression and cell migration ability. These results indicate that stable knockdown of Kif5b in MDCK cells can lead to epithelial–mesenchymal transition, which is mediated by defective E-cadherin and NMMIIA expression. - Highlights: • Knockdown of Kif5b in MDCK cells resulted in reduced cell proliferation rate. • Kif5b deficient MDCK cells underwent epithelial–mesenchymal transition. • E-cadherin and NMMIIA could interact with Kif5b in polarized MDCK cells. • Decreased E-cadherin and NMMIIA levels mediate EMT in Kif5b deficient MDCK cells. • Overexpression of E-cadherin and NMMIIA reverse the effects of Kif5b knockdown
Stable knockdown of Kif5b in MDCK cells leads to epithelial–mesenchymal transition
Energy Technology Data Exchange (ETDEWEB)
Cui, Ju, E-mail: juzi.cui@gmail.com [The Key Laboratory of Geriatrics, Beijing Hospital & Beijing Institute of Geriatrics, Ministry of Health, Beijing (China); Department of Biochemistry, LKS Faculty of Medicine, The University of Hong Kong, Hong Kong SAR (China); Jin, Guoxiang; Yu, Bin [Department of Biochemistry, LKS Faculty of Medicine, The University of Hong Kong, Hong Kong SAR (China); Wang, Zai [Department of Biochemistry, LKS Faculty of Medicine, The University of Hong Kong, Hong Kong SAR (China); Institute of Clinical Medical Sciences, China-Japan Friendship Hospital, Beijing (China); Lin, Raozhou [Department of Biochemistry, LKS Faculty of Medicine, The University of Hong Kong, Hong Kong SAR (China); Huang, Jian-Dong, E-mail: jdhuang@hku.hk [Department of Biochemistry, LKS Faculty of Medicine, The University of Hong Kong, Hong Kong SAR (China); The Centre for Synthetic Biology Engineering Research, Shenzhen Institutes of Advanced Technology, Shenzhen (China)
2015-07-17
Polarization of epithelial cells requires vectorial sorting and transport of polarity proteins to apical or basolateral domains. Kif5b is the mouse homologue of the human ubiquitous Kinesin Heavy Chain (uKHC). To investigate the function of Kif5b in epithelial cells, we examined the phenotypes of Kif5b-deficient MDCK cells. Stable knockdown of Kif5b in MDCK cells resulted in reduced cell proliferation rate, profound changes in cell morphology, loss of epithelial cell marker, and gain of mesenchymal marker, as well as increased cell migration, invasion, and tumorigenesis abilities. E-cadherin and NMMIIA could interact with Kif5b in polarized MDCK cells, and their expression levels were decreased in Kif5b-deficient MDCK cells. Overexpression of E-cadherin and NMMIIA in Kif5b depleted MDCK cells could decrease mesenchymal marker expression and cell migration ability. These results indicate that stable knockdown of Kif5b in MDCK cells can lead to epithelial–mesenchymal transition, which is mediated by defective E-cadherin and NMMIIA expression. - Highlights: • Knockdown of Kif5b in MDCK cells resulted in reduced cell proliferation rate. • Kif5b deficient MDCK cells underwent epithelial–mesenchymal transition. • E-cadherin and NMMIIA could interact with Kif5b in polarized MDCK cells. • Decreased E-cadherin and NMMIIA levels mediate EMT in Kif5b deficient MDCK cells. • Overexpression of E-cadherin and NMMIIA reverse the effects of Kif5b knockdown.
TasselNet: counting maize tassels in the wild via local counts regression network.
Lu, Hao; Cao, Zhiguo; Xiao, Yang; Zhuang, Bohan; Shen, Chunhua
2017-01-01
Accurately counting maize tassels is important for monitoring the growth status of maize plants. This tedious task, however, is still mainly done by manual efforts. In the context of modern plant phenotyping, automating this task is required to meet the need of large-scale analysis of genotype and phenotype. In recent years, computer vision technologies have experienced a significant breakthrough due to the emergence of large-scale datasets and increased computational resources. Naturally image-based approaches have also received much attention in plant-related studies. Yet a fact is that most image-based systems for plant phenotyping are deployed under controlled laboratory environment. When transferring the application scenario to unconstrained in-field conditions, intrinsic and extrinsic variations in the wild pose great challenges for accurate counting of maize tassels, which goes beyond the ability of conventional image processing techniques. This calls for further robust computer vision approaches to address in-field variations. This paper studies the in-field counting problem of maize tassels. To our knowledge, this is the first time that a plant-related counting problem is considered using computer vision technologies under unconstrained field-based environment. With 361 field images collected in four experimental fields across China between 2010 and 2015 and corresponding manually-labelled dotted annotations, a novel Maize Tassels Counting ( MTC ) dataset is created and will be released with this paper. To alleviate the in-field challenges, a deep convolutional neural network-based approach termed TasselNet is proposed. TasselNet can achieve good adaptability to in-field variations via modelling the local visual characteristics of field images and regressing the local counts of maize tassels. Extensive results on the MTC dataset demonstrate that TasselNet outperforms other state-of-the-art approaches by large margins and achieves the overall best counting
TasselNet: counting maize tassels in the wild via local counts regression network
Directory of Open Access Journals (Sweden)
Hao Lu
2017-11-01
Full Text Available Abstract Background Accurately counting maize tassels is important for monitoring the growth status of maize plants. This tedious task, however, is still mainly done by manual efforts. In the context of modern plant phenotyping, automating this task is required to meet the need of large-scale analysis of genotype and phenotype. In recent years, computer vision technologies have experienced a significant breakthrough due to the emergence of large-scale datasets and increased computational resources. Naturally image-based approaches have also received much attention in plant-related studies. Yet a fact is that most image-based systems for plant phenotyping are deployed under controlled laboratory environment. When transferring the application scenario to unconstrained in-field conditions, intrinsic and extrinsic variations in the wild pose great challenges for accurate counting of maize tassels, which goes beyond the ability of conventional image processing techniques. This calls for further robust computer vision approaches to address in-field variations. Results This paper studies the in-field counting problem of maize tassels. To our knowledge, this is the first time that a plant-related counting problem is considered using computer vision technologies under unconstrained field-based environment. With 361 field images collected in four experimental fields across China between 2010 and 2015 and corresponding manually-labelled dotted annotations, a novel Maize Tassels Counting (MTC dataset is created and will be released with this paper. To alleviate the in-field challenges, a deep convolutional neural network-based approach termed TasselNet is proposed. TasselNet can achieve good adaptability to in-field variations via modelling the local visual characteristics of field images and regressing the local counts of maize tassels. Extensive results on the MTC dataset demonstrate that TasselNet outperforms other state-of-the-art approaches by large
Hybrid statistics-simulations based method for atom-counting from ADF STEM images.
De Wael, Annelies; De Backer, Annick; Jones, Lewys; Nellist, Peter D; Van Aert, Sandra
2017-06-01
A hybrid statistics-simulations based method for atom-counting from annular dark field scanning transmission electron microscopy (ADF STEM) images of monotype crystalline nanostructures is presented. Different atom-counting methods already exist for model-like systems. However, the increasing relevance of radiation damage in the study of nanostructures demands a method that allows atom-counting from low dose images with a low signal-to-noise ratio. Therefore, the hybrid method directly includes prior knowledge from image simulations into the existing statistics-based method for atom-counting, and accounts in this manner for possible discrepancies between actual and simulated experimental conditions. It is shown by means of simulations and experiments that this hybrid method outperforms the statistics-based method, especially for low electron doses and small nanoparticles. The analysis of a simulated low dose image of a small nanoparticle suggests that this method allows for far more reliable quantitative analysis of beam-sensitive materials. Copyright © 2017 Elsevier B.V. All rights reserved.
Characterization of a new computer-ready photon counting system
Andor, Gyorgy
1998-08-01
The photon-counting system seems to be the best solution for extremely low optical power measurements. The Hamamatsu HC135 photon counting module has a built-in high-voltage power supply amplifier, discriminator, micro-controller with an RS232 serial output. It requires only a +5V supply voltage and an IBM PC or compatible computer to run. The system is supplied with an application software. This talk is about the testing of the device.
Directory of Open Access Journals (Sweden)
Na Luo
Full Text Available Inositol phosphatases are important regulators of cell signaling, polarity, and vesicular trafficking. Mutations in OCRL, an inositol polyphosphate 5-phosphatase, result in Oculocerebrorenal syndrome of Lowe, an X-linked recessive disorder that presents with congenital cataracts, glaucoma, renal dysfunction and mental retardation. INPP5B is a paralog of OCRL and shares similar structural domains. The roles of OCRL and INPP5B in the development of cataracts and glaucoma are not understood. Using ocular tissues, this study finds low levels of INPP5B present in human trabecular meshwork but high levels in murine trabecular meshwork. In contrast, OCRL is localized in the trabecular meshwork and Schlemm's canal endothelial cells in both human and murine eyes. In cultured human retinal pigmented epithelial cells, INPP5B was observed in the primary cilia. A functional role for INPP5B is revealed by defects in cilia formation in cells with silenced expression of INPP5B. This is further supported by the defective cilia formation in zebrafish Kupffer's vesicles and in cilia-dependent melanosome transport assays in inpp5b morphants. Taken together, this study indicates that OCRL and INPP5B are differentially expressed in the human and murine eyes, and play compensatory roles in cilia development.
Maekawa, Toshio; Kim, Seungjoon; Nakai, Daisuke; Makino, Chieko; Takagi, Tsuyoshi; Ogura, Hiroo; Yamada, Kazuyuki; Chatton, Bruno; Ishii, Shunsuke
2010-01-01
Many symptoms induced by isolation rearing of rodents may be relevant to neuropsychiatric disorders, including depression. However, identities of transcription factors that regulate gene expression in response to chronic social isolation stress remain elusive. The transcription factor ATF-7 is structurally related to ATF-2, which is activated by various stresses, including inflammatory cytokines. Here, we report that Atf-7-deficient mice exhibit abnormal behaviours and increased 5-HT receptor 5B (Htr5b) mRNA levels in the dorsal raphe nuclei. ATF-7 silences the transcription of Htr5B by directly binding to its 5′-regulatory region, and mediates histone H3-K9 trimethylation via interaction with the ESET histone methyltransferase. Isolation-reared wild-type (WT) mice exhibit abnormal behaviours that resemble those of Atf-7-deficient mice. Upon social isolation stress, ATF-7 in the dorsal raphe nucleus is phosphorylated via p38 and is released from the Htr5b promoter, leading to the upregulation of Htr5b. Thus, ATF-7 may have a critical role in gene expression induced by social isolation stress. PMID:19893493
SrBeB2O5: Growth, crystal structure and optical properties
International Nuclear Information System (INIS)
Yao, Wenjiao; Wang, Xiaoshan; Huang, Hongwei; Xu, Tao; Jiang, Xingxing; Wang, Xiaoyang; Lin, Zheshuai; Chen, Chuangtian
2014-01-01
Graphical abstract: The crystal displays a layered configuration along c axis with the wrinkled infinite (BeB 2 O 5 ) ∞ layers. Display Omitted - Highlights: • A new beryllium borate SrBeB 2 O 5 was synthesized. • A layered structure (BeB 2 O 5 ) ∞ was formed by BO 3 triangles and B/BeO 4 tetrahedrons. • SrBeB 2 O 5 has a very wide transparency range of wavelengths from 200 nm to 1800 nm. • A-site ions impact greatly on the structures of beryllium borates. - Abstract: A novel beryllium borate SrBeB 2 O 5 is discovered for the first time through traditional solid state reaction and high temperature solution method. The framework of the structure is composed by two-dimensional [BeB 2 O 5 ] layers determined from single-crystal X-ray diffraction data. The further structural analysis of beryllium borates reveals that the arrangement of anionic groups attributes to the structural stability. Moreover, the influences of the A-site cations on the structural features of fundamental building blocks in the alkaline or alkaline earth beryllium borates are discussed. The UV–Vis–NIR diffuse-reflectance pattern reveals that this compound has a very wide transparency range of wavelengths down to 200 nm. In addition, the properties of SrBeB 2 O 5 were also characterized by powder X-ray diffraction, differential scanning calorimetry, and IR spectroscopy
On the fast response of charnel electron multipliers in coUnting mode operation
International Nuclear Information System (INIS)
Belyaevskij, O.A.; Gladyshev, I.L.; Korobochko, Yu.S.; Mineev, V.I.
1983-01-01
Dependences of amplitude distribution of pulses at the outlet of channel electron multipliers (CEM) and effectiveness of monitoring on counting rate at different supply voltages are determined. It is shown that the maximUm counting rate of CEM runs into 6x10 5 s -1 at short-term and 10 5 s -1 at long-term operation using monitoring eqUipment with operation threshold of 2.5 mV
Molecular Study of Parvovirus B19 Infection in Children with
Tharwat Abou El-Khier, Noha; Darwish, Ahmad; El Sayed Zaki, Maysaa
2018-02-26
Background: Parvovirus B19 is a common viral infection in children. Nearby evidences are present about its association with acute leukemia, especially acute lymphoblast leukemia. Nevertheless, scanty reports have discussed any role in acute myeloid leukemia (AML). Purpose: To evaluate the frequency of virological markers of B19 infection including its DNA along with specific immunoglobulins G (IgG) and M (IgM) among children with newly diagnosed AML. Besides, describing the clinical importance of Parvovirus B19 infection in those patients. Patients and methods: A case-control retrospective study was conducted on 48 children recently diagnosed with AML before and during chemotherapy induction and 60 healthy control. Specific serum IgM and IgG levels were determined by enzyme linked immunosorbant assay (ELISA) and DNA detection by polymerase chain reaction (PCR). Results: Parvovirus DNA was detected in 20 patients with AML. IgM was found in sera of four patients and one case had positive DNA and IgG (5%). Patients with recent parvovirus B19 infection had a significantly reduced hemoglobin levels, RBCs counts, platelet counts, neutrophil counts and absolute lymphocytosis (p=0.01, p=0.0001, p=0.01, p=0.02, p=0.0003, respectively). There were no clinical findings with statistically significant association to recent infection. Half of the patients with AML had positive PCR and/or IgM for parvovirus B19. Among children with AML under chemotherapy, there were reduced hemoglobin levels (P=0.03), reduced platelet counts (P=0.0001) and absolute neutropenia (mean±SD, 1.200 ±1.00) in those with parvovirus B19 infection. More than half of patients with parvovirus B19 (72.2%) had positive PCR and/or IgM and 36.4% of them had positive IgG. Conclusion: This study highlights that parvovirus B19 is common in children with AML either at diagnosis or under chemotherapy. There are no clinical manifestations that can be used as markers for its presence, but hematological laboratory
Isospectral discrete and quantum graphs with the same flip counts and nodal counts
Juul, Jonas S.; Joyner, Christopher H.
2018-06-01
The existence of non-isomorphic graphs which share the same Laplace spectrum (to be referred to as isospectral graphs) leads naturally to the following question: what additional information is required in order to resolve isospectral graphs? It was suggested by Band, Shapira and Smilansky that this might be achieved by either counting the number of nodal domains or the number of times the eigenfunctions change sign (the so-called flip count) (Band et al 2006 J. Phys. A: Math. Gen. 39 13999–4014 Band and Smilansky 2007 Eur. Phys. J. Spec. Top. 145 171–9). Recent examples of (discrete) isospectral graphs with the same flip count and nodal count have been constructed by Ammann by utilising Godsil–McKay switching (Ammann private communication). Here, we provide a simple alternative mechanism that produces systematic examples of both discrete and quantum isospectral graphs with the same flip and nodal counts.
The influence of lime and nitrogen fertilisers on spore counts of Pithomyces chartarum in pasture.
Cuttance, E L; Laven, R A; Mason, W A; Stevenson, M
2016-11-01
To determine whether the application of lime or nitrogen to pasture affected the spore counts of Pithomyces chartarum. The lime application studies were undertaken on a spring-calving, pasture-based, commercial dairy farm near Te Awamutu, New Zealand. On 6 November 2012, five randomly selected paddocks were split into three equal sections. In two of the sections, lime was applied at either 1.5 or 2.5 t/ha, and the central section was left as an untreated control. Each section was sampled for spore counting weekly from 16 January to 15 May 2013. Starting in January 2013, five other randomly selected paddocks were monitored for spore counts. On 20 March 2013 the average spore counts in three paddocks were >100,000 spores/g of pasture. These paddocks were then divided into three equal sections and lime was applied as described above. Spore counting in each section continued weekly until 15 May 2013. The nitrogen application study was carried out on three commercial dairy farms near Te Awamutu, New Zealand. Two randomly selected paddocks on each farm were divided into three equal sections and, on 20 December 2012, nitrogen in the form of urea was applied at either 50 or 80 kg urea/ha to two of the sections; the central section remained as an untreated control. Each section was sampled for spore counting weekly from 16 January to 15 May 2013. Following pre-summer lime application, treatment at 1.5 or 2.5 t/ha did not affect spore counts over time compared with the control section (p>0.26). Similarly following autumn lime application, treatment at 1.5 or 2.5 t/ha did not affect spore counts over time compared with the control section (p>0.11). Following nitrogen application median spore counts remained 0.49). This study found that application of lime before the risk period for facial eczema, in November, application of lime after a spore count rise, in March, or urea application in December did not affect changes in number of spores produced by P. chartarum. This
Hyperfine splitting of B mesons and Bs production at the Υ(5S)
International Nuclear Information System (INIS)
Lee-Franzini, J.; Heintz, U.; Lovelock, D.M.J.; Narain, M.; Schamberger, R.D.; Willins, J.; Yanagisawa, C.; Franzini, P.; Tuts, P.M.
1990-01-01
Using the Columbia University--Stony Brook (CUSB-II) detector we have studied the inclusive photon spectrum from 2.9x10 4 Υ(5S) decays. We observe a strong signal due to B * →Bγ decays. From this we obtain (i) the average B * -B mass difference, 46.7±0.4 MeV, (ii) the photon yield per Υ(5S) decay, left-angle γ/Υ(5S)right-angle=1.09±0.06, and (iii) the average velocity of the B * 's, left-angle β right-angle=0.156±0.010, for a mix of nonstrange (B) and strange (B s ) B * mesons from Υ(5S) decays. From the shape of the photon line, we find that both B and B s mesons are produced with nearly equal values for the hyperfine splitting of the B and B s meson systems
Natsuda, Koji; Eguchi, Susumu; Takatsuki, Mistuhisa; Soyama, Akihiko; Hidaka, Masaaki; Hara, Takanobu; Kugiyama, Tota; Baimakhanov, Zhassulan; Ono, Shinichiro; Kitasato, Amane; Fujita, Fumihiko; Kanetaka, Kengo; Kuroki, Tamotsu
2016-02-01
The role of splenectomy in increasing the CD4-positive T lymphocyte counts (hereafter: CD4 counts) and the CD4 to CD8 ratio have not yet been fully investigated, especially in the case of HIV-positive patients undergoing liver transplantation (LT). The change in the total lymphocyte counts of 32 patients who underwent one-stage splenectomy with living donor (LD) LT with (n=13) or without rituximab (RTX, n=19) therapy were examined to validate our cohort of ABO-incompatible LDLT with RTX. Subsequently, perioperative changes in CD4 counts and the CD 4 to CD8 ratio were measured in 13 patients who underwent ABO-incompatible LDLT/RTX with splenectomy. (1) The administration of RTX did not significantly affect the total lymphocyte counts of patients after LDLT/splenectomy in any of the observation periods. (2) The CD4 counts were significantly higher at 2years after LDLT in comparison to the perioperative CD4 counts but not within the 3-month period (p=0.039). The CD4/CD8 ratio gradually decreased after LDLT/splenectomy under RTX treatment. An immediate increase in the CD4 counts therefore cannot be expected after LDLT with splenectomy. The total lymphocyte and CD4 counts were rather stable in the peritransplant period even in ABO incompatible LDLT with RTX. Copyright © 2015 Elsevier B.V. All rights reserved.
Li, Aiwei; Yang, Shuo; Zhang, Jie; Qiao, Rui
2017-11-01
To observe the changes of complete blood count (CBC) parameters during pregnancy and establish appropriate reference intervals for healthy pregnant women. Healthy pregnant women took the blood tests at all trimesters. All blood samples were processed on Sysmex XE-2100. The following CBC parameters were analyzed: red blood cell count (RBC), hemoglobin (Hb), hematocrit (Hct), mean corpuscular volume (MCV), mean corpuscular hemoglobin (MCH), mean corpuscular hemoglobin concentration (MCHC), red blood cell distribution width (RDW), platelet count (PLT), mean platelet volume (MPV), platelet distribution width (PDW), white blood cell count (WBC), and leukocyte differential count. Reference intervals were established using the 2.5th and 97.5th percentile of the distribution. Complete blood count parameters showed dynamic changes during trimesters. RBC, Hb, Hct declined at trimester 1, reaching their lowest point at trimester 2, and began to rise again at trimester 3. WBC, neutrophil count (Neut), monocyte count (MONO), RDW, and PDW went up from trimester 1 to trimester 3. On the contrary, MCHC, lymphocyte count (LYMPH), PLT, and MPV gradually descended during pregnancy. There were statistical significances in all CBC parameters between pregnant women and normal women, regardless of the trimesters (Ppregnancy) as follows: RBC 4.50 vs 3.94×10 12 /L, Hb 137 vs 120 g/L, WBC 5.71 vs 9.06×10 9 /L, LYMPH% 32.2 vs 18.0, Neut% 58.7 vs 75.0, and PLT 251 vs 202×10 9 /L. The changes of CBC parameters during pregnancy are described, and reference intervals for Beijing pregnant women are demonstrated in this study. © 2017 Wiley Periodicals, Inc.
Zhang, Zongyang; Liu, Xiansong; Feng, Shuangjiu; Rehman, Khalid Mehmood Ur
2018-03-01
In this study, the melt spinning method was used to develop Fe80.5Si7.5B6Nb5Cu amorphous ribbons in the first step. Then, the Fe80.5Si7.5B6Nb5Cu amorphous-nanocrystalline core with a compact microstructure was obtained by multiple processes. The main properties of the magnetic powder core, such as micromorphology, thermal behavior, permeability, power loss and quality factor, have been analyzed. The obtained results show that an Fe80.5Si7.5B6Nb5Cu amorphous-nanocrystalline duplex core has high permeability (54.8-57), is relatively stable at different frequencies and magnetic fields, and the maximum power loss is only 313 W/kg; furthermore, it has a good quality factor.
Schattschneider, Doris
1991-01-01
Provided are examples from many domains of mathematics that illustrate the Fubini Principle in its discrete version: the value of a summation over a rectangular array is independent of the order of summation. Included are: counting using partitions as in proof by pictures, combinatorial arguments, indirect counting as in the inclusion-exclusion…
Symptoms Low white blood cell count By Mayo Clinic Staff A low white blood cell count (leukopenia) is a decrease ... of white blood cell (neutrophil). The definition of low white blood cell count varies from one medical ...
Fetterman, J Gregor; Killeen, P Richard
2010-09-01
Pigeons pecked on three keys, responses to one of which could be reinforced after a few pecks, to a second key after a somewhat larger number of pecks, and to a third key after the maximum pecking requirement. The values of the pecking requirements and the proportion of trials ending with reinforcement were varied. Transits among the keys were an orderly function of peck number, and showed approximately proportional changes with changes in the pecking requirements, consistent with Weber's law. Standard deviations of the switch points between successive keys increased more slowly within a condition than across conditions. Changes in reinforcement probability produced changes in the location of the psychometric functions that were consistent with models of timing. Analyses of the number of pecks emitted and the duration of the pecking sequences demonstrated that peck number was the primary determinant of choice, but that passage of time also played some role. We capture the basic results with a standard model of counting, which we qualify to account for the secondary experiments. Copyright 2010 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
1988-07-01
A successful transportation system for nuclear waste must be safe, efficient, and widely acceptable. To achieve the necessary public understanding, there must be an exchange of information and an identification of issues. This booklet has been developed to assist in that exchange of information and help in the communication of issues. It will provide a glossary of commonly used terms, a list of acronyms, a bibliography selected from the public information developed by the OCRWM Program, and contacts for additional information. Transportation is an integral and essential part of the projected waste management system. The United States has a long history of transporting radioactive material. Commercial spent fuel has been shipped for over 20 years and high-level waste from defense activities for an even longer period. These shipments have been conducted without any accidents causing death or environmental damage because of the radiological nature of the cargo. DOE is taking measures to ensure that this safety record continues. 24 refs
One Family's Struggles with Hepatitis B
Full Text Available ... cmv hepatitis overview current news glossary injection tips kids infect kids labs links & resources milk thistle pediatric hepatitis report ... overview links & resources families advocacy about civil rights kids' rights sample school policies school letter someone you ...
Alabama Kids Count 2002 Data Book.
Curtis, Apreill; Bogie, Don
This Kids Count data book examines statewide trends in well-being of Alabamas children. The statistical portrait is based on 18 indicators in the areas of child health, education, safety, and security: (1) infant mortality rate; (2) low weight births; (3) child health index; (4) births to unmarried teens; (5) first grade retention; (6) school…
[Effects of HiLo for two weeks on erythrocyte immune adhesion and leukocyte count of swimmers].
Zhao, Yong-Cai; Gao, Bing-Hong; Wu, Ge-Lin; Zhang, Jiu-Li
2012-07-01
To investigate the effects of living high-training low (HiLo) on innate immunity in blood of elite swimmers. Six female swimmers undertook HiLo for two weeks, erythrocyte adhesion function and counts of leukocyte were tested in different time of training period. Red blood cell C3b receptor ring rate (RBC-C3bRR) decreased and red blood cell immune complex matter ring rate (RBC-ICR) increased significantly (P < 0.05), the two markers returned to base line 1 week after training. Counts of leukocyte and granulocyte decreased significantly (P < 0.05), and they recovered 1 week after training; Counts of lymphocyte and monocyte decreased without significance during training and did not recovered after training. Immunity of erythrocyte and granulocyte decreased quickly, but lymphocyte and monocyte recovered slowly, swimmers were adaptive to the training.
Steadman, Roger; Herrmann, Christoph; Livne, Amir
2017-08-01
Spectral CT based on energy-resolving photon counting detectors is expected to deliver additional diagnostic value at a lower dose than current state-of-the-art CT [1]. The capability of simultaneously providing a number of spectrally distinct measurements not only allows distinguishing between photo-electric and Compton interactions but also discriminating contrast agents that exhibit a K-edge discontinuity in the absorption spectrum, referred to as K-edge Imaging [2]. Such detectors are based on direct converting sensors (e.g. CdTe or CdZnTe) and high-rate photon counting electronics. To support the development of Spectral CT and show the feasibility of obtaining rates exceeding 10 Mcps/pixel (Poissonian observed count-rate), the ChromAIX ASIC has been previously reported showing 13.5 Mcps/pixel (150 Mcps/mm2 incident) [3]. The ChromAIX has been improved to offer the possibility of a large area coverage detector, and increased overall performance. The new ASIC is called ChromAIX2, and delivers count-rates exceeding 15 Mcps/pixel with an rms-noise performance of approximately 260 e-. It has an isotropic pixel pitch of 500 μm in an array of 22×32 pixels and is tile-able on three of its sides. The pixel topology consists of a two stage amplifier (CSA and Shaper) and a number of test features allowing to thoroughly characterize the ASIC without a sensor. A total of 5 independent thresholds are also available within each pixel, allowing to acquire 5 spectrally distinct measurements simultaneously. The ASIC also incorporates a baseline restorer to eliminate excess currents induced by the sensor (e.g. dark current and low frequency drifts) which would otherwise cause an energy estimation error. In this paper we report on the inherent electrical performance of the ChromAXI2 as well as measurements obtained with CZT (CdZnTe)/CdTe sensors and X-rays and radioactive sources.
Mattera, Shira K.; Jacob, Robin; Morris, Pamela A.
2018-01-01
Early math skills are a strong predictor of later achievement for young children, not only in math, but in other domains as well. Exhibiting strong math skills in elementary school is predictive of later high school completion and college attendance. To that end, the Making Pre-K Count and High 5s studies set out to rigorously assess whether…
Quantitative Compton suppression spectrometry at elevated counting rates
International Nuclear Information System (INIS)
Westphal, G.P.; Joestl, K.; Schroeder, P.; Lauster, R.; Hausch, E.
1999-01-01
For quantitative Compton suppression spectrometry the decrease of coincidence efficiency with counting rate should be made negligible to avoid a virtual increase of relative peak areas of coincident isomeric transitions with counting rate. To that aim, a separate amplifier and discriminator has been used for each of the eight segments of the active shield of a new well-type Compton suppression spectrometer, together with an optimized, minimum dead-time design of the anticoincidence logic circuitry. Chance coincidence losses in the Compton suppression spectrometer are corrected instrumentally by comparing the chance coincidence rate to the counting rate of the germanium detector in a pulse-counting Busy circuit (G.P. Westphal, J. Rad. Chem. 179 (1994) 55) which is combined with the spectrometer's LFC counting loss correction system. The normally not observable chance coincidence rate is reconstructed from the rates of germanium detector and scintillation detector in an auxiliary coincidence unit, after the destruction of true coincidence by delaying one of the coincidence partners. Quantitative system response has been tested in two-source measurements with a fixed reference source of 60 Co of 14 kc/s, and various samples of 137 Cs, up to aggregate counting rates of 180 kc/s for the well-type detector, and more than 1400 kc/s for the BGO shield. In these measurements, the net peak areas of the 1173.3 keV line of 60 Co remained constant at typical values of 37 000 with and 95 000 without Compton suppression, with maximum deviations from the average of less than 1.5%
Hanford whole body counting manual
International Nuclear Information System (INIS)
Palmer, H.E.; Brim, C.P.; Rieksts, G.A.; Rhoads, M.C.
1987-05-01
This document, a reprint of the Whole Body Counting Manual, was compiled to train personnel, document operation procedures, and outline quality assurance procedures. The current manual contains information on: the location, availability, and scope of services of Hanford's whole body counting facilities; the administrative aspect of the whole body counting operation; Hanford's whole body counting facilities; the step-by-step procedure involved in the different types of in vivo measurements; the detectors, preamplifiers and amplifiers, and spectroscopy equipment; the quality assurance aspect of equipment calibration and recordkeeping; data processing, record storage, results verification, report preparation, count summaries, and unit cost accounting; and the topics of minimum detectable amount and measurement accuracy and precision. 12 refs., 13 tabs
Measurement of B(Υ(5S)→Bs(*)Bs(*)) using φ mesons
International Nuclear Information System (INIS)
Huang, G. S.; Miller, D. H.; Pavlunin, V.; Sanghi, B.; Shipsey, I. P. J.; Xin, B.; Adams, G. S.; Anderson, M.; Cummings, J. P.; Danko, I.; Napolitano, J.; He, Q.; Insler, J.; Muramatsu, H.; Park, C. S.; Thorndike, E. H.; Yang, F.; Coan, T. E.; Gao, Y. S.; Liu, F.
2007-01-01
Knowledge of the B s decay fraction of the Υ(5S) resonance, f S , is important for B s meson studies at the Υ(5S) energy. Using a data sample collected by the CLEO III detector at CESR consisting of 0.423 fb -1 on the Υ(5S) resonance, 6.34 fb -1 on the Υ(4S) and 2.32 fb -1 in the continuum below the Υ(4S), we measure B(Υ(5S)→φX)=(13.8±0.7 -1.5 +2.3 )% and B(Υ(4S)→φX)=(7.1±0.1±0.6)%; the ratio of the two rates is (1.9±0.1 -0.2 +0.3 ). This is the first measurement of the φ meson yield from the Υ(5S). Using these rates, and a model dependent estimate of B(B s →φX), we determine f S =(24.6±2.9 -5.3 +11.0 )%. We also update our previous independent measurement of f S made using the inclusive D s yields to now be (16.8±2.6 -3.4 +6.7 )%, due to a better estimate of the number of hadronic events. We also report the total Υ(5S) hadronic cross section above continuum to be σ(e + e - →Υ(5S))=(0.301±0.002±0.039) nb. This allows us to extract the fraction of B mesons as (58.9±10.0±9.2)%, equal to 1-f S . Averaging the three methods gives a model dependent result of f S =(21 -3 +6 )%
Directory of Open Access Journals (Sweden)
R. J. Weber
2010-07-01
Full Text Available Archived Federal Reference Method (FRM Teflon filters used by state regulatory agencies for measuring PM2.5 mass were acquired from 15 sites throughout the southeastern US and analyzed for water-soluble organic carbon (WSOC, water-soluble ions and carbohydrates to investigate biomass burning contributions to fine aerosol mass. Based on over 900 filters that spanned all of 2007, levoglucosan and K+ were studied in conjunction with MODIS Aqua fire count data to compare their performances as biomass burning tracers. Levoglucosan concentrations exhibited a distinct seasonal variation with large enhancement in winter and spring and a minimum in summer, and were well correlated with fire counts, except in winter when residential wood burning contributions were significant. In contrast, K+ concentrations had no apparent seasonal trend and poor correlation with fire counts. Levoglucosan and K+ only correlated well in winter (r2=0.59 when biomass burning emissions were highest, whereas in other seasons they were not correlated due to the presence of other K+ sources. Levoglucosan also exhibited larger spatial variability than K+. Both species were higher in urban than rural sites (mean 44% higher for levoglucosan and 86% for K+. Positive Matrix Factorization (PMF was applied to analyze PM2.5 sources and four factors were resolved: biomass burning, refractory material, secondary light absorbing WSOC and secondary sulfate/WSOC. The biomass burning source contributed 13% to PM2.5 mass annually, 27% in winter, and less than 2% in summer, consistent with other souce apportionment studies based on levoglucosan, but lower in summer compared to studies based on K+.
Draft Genome Sequence of Lactobacillus delbrueckii subsp. bulgaricus LBB.B5
Urshev, Z.; Hajo, K.; Lenoci, L.; Bron, P.A.; Dijkstra, A.; Alkema, W.; Wels, M.; Siezen, R.J.; Minkova, S.; Hijum, S.A. van
2016-01-01
Lactobacillus delbrueckii subsp. bulgaricus LBB.B5 originates from homemade Bulgarian yogurt and was selected for its ability to form a strong association with Streptococcus thermophilus The genome sequence will facilitate elucidating the genetic background behind the contribution of LBB.B5 to the
Alabama Kids Count 2001 Data Book.
Curtis, Apreill; Bogie, Don
This Kids Count data book examines statewide trends in well-being for Alabama's children. The statistical portrait is based on 17 indicators in the areas of health, education, safety, and security. The indicators are: (1) infant mortality rate; (2) low weight births; (3) child health index; (4) births to unmarried teens; (5) first grade retention;…
Nevada Kids Count Data Book, 1997.
We Can, Inc., Las Vegas, NV.
This Kids Count data book is the first to examine statewide indicators of the well being of Nevada's children. The statistical portrait is based on 15 indicators of child well being: (1) percent low birth-weight babies; (2) infant mortality rate; (3) percent of children in poverty; (4) percent of children in single-parent families; (5) percent of…
Count Nouns - Mass Nouns, Neat Nouns - Mess Nouns
Directory of Open Access Journals (Sweden)
Fred Landman
2010-12-01
. 1975. ‘Non-singular reference. Some preliminaries’. In Philosophia 5. Reprinted in Francis Jeffry Pelletier (ed., 1979, Mass Terms. Some Philosophical Problems, Kluwer, Dordrecht.Pelletier, F. J. & Schubert, L. 1989/2002. ‘Mass Expressions’. In Dov Gabbay & Franz Guenthner (eds. ‘The Handbook of Philosophical Logic’, 387–453. Kluwer, Dordrecht.Rothstein, S. 1992. ‘Types of plural individuals’. Journal of Semantics 15: 641–675.Rothstein, S. 2009a. ‘Bare noun semantics’. Talk presented at the workshop on ‘Bare Nouns: Syntactic Projections and their Interpretations’, Paris, November 2009.Rothstein, S. 2009b. ‘Stubborn distributivity, multiparticipant nouns and the count/mass distinction’. To appear in: Proceedings of NELS 39.Rothstein, S. 2010. ‘Counting and the mass-count distinction’. Journal of Semantics 27: 343–397.http://dx.doi.org/10.1093/jos/ffq007Sybesma, R. 2009. Het Chinees en het Nederlands zijn eigenlijk hetzelfde. Het Spectum, Houten.ter Meulen, A. 1980. Substances, Quantities and Individuals. Ph.D. thesis, Stanford University
Chan, Leo Li-Ying; Laverty, Daniel J; Smith, Tim; Nejad, Parham; Hei, Hillary; Gandhi, Roopali; Kuksin, Dmitry; Qiu, Jean
2013-02-28
, and (5) AO/PI dual staining method. The results show comparable total PBMC counting among all five methods, which validate the AO/PI staining method for PBMC measurement in the image cytometry method. Copyright © 2012 Elsevier B.V. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Liang, Liping; Ma, Tianyu, E-mail: maty@zju.edu.cn; Zhang, Pei; Jin, Jiaying; Yan, Mi, E-mail: mse_yanmi@zju.edu.cn
2014-04-15
To improve coercivity without sacrificing other magnetic performance of NdFeB sintered magnets, a low melting point Dy{sub 32.5}Fe{sub 62}Cu{sub 5.5} alloy was introduced as an intergranular additive. Magnetic properties and microstructure of the magnets with different Dy{sub 32.5}Fe{sub 62}Cu{sub 5.5} contents were studied. At the optimum addition of 3 wt%, coercivity H{sub cj} was enhanced from 12.7 to 15.2 kOe, the maximum magnetic energy product (BH){sub max} was simultaneously increased from 46.6 to 47.8 MG Oe, accompanied by a slight reduction in remanence B{sub r}. Further investigation on microstructure and grain boundary composition indicated that the enhanced H{sub cj} and (BH){sub max} could be attributed to the refined and uniform 2:14:1 phase grains, continuous grain boundaries and a (Nd,Dy){sub 2}Fe{sub 14}B hardening shell surrounding the 2:14:1 phase grains. - Highlights: • Low melting-point Dy{sub 32.5}Fe{sub 62}Cu{sub 5.5} alloy was introduced to NdFeB magnets. • The doped magnet exhibits enhanced coercivity and maximum energy product. • (Nd,Dy){sub 2}Fe{sub 14}B shell was expected to form in the surface of Nd{sub 2}Fe{sub 14}B grains. • The continuous grain boundary layer formed between neighboring Nd{sub 2}Fe{sub 14}B grains.
National Oceanic and Atmospheric Administration, Department of Commerce — Fish egg counts and standardized counts for eggs captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets], and...
Optimisation of the magnetic properties of mechanically milled R5.5Fe73.5-xCoxCr3B18 nanocomposites
International Nuclear Information System (INIS)
O'Sullivan, J.F.; Smith, P.A.I.; Coey, J.M.D.
1998-01-01
Mechanical milling and subsequent annealing of R 4.5 R'Fe 73.5-x Co x Cr 3 B 18 (R=Nd,Pr and R'=Tb,Dy) ingots has been found to produce hard magnetic nanocomposites of (R,R') 2 (Fe,Co) 14 B, (Fe,Cr) 2 B and α-(Fe,Co) phases. Here we report on the optimisation of the composition of such nanocomposites. Substituting different rare-earth metals has a significant effect on the magnetic properties. The replacement of Nd with Pr produces higher coercivity and remanence, and better loop squareness. However, the replacement of Tb with Dy produced inferior properties when the main rare-earth component was Nd. Improved properties were obtained with the combination of Pr and Dy or Tb. Substitution of Co for Fe was found to lower coercivity but increase the remanence. The best combination of properties measured was for Pr 4.5 Dy 1 Fe 68.5 Co 5 Cr 3 B 1x , where H c =0.41 MA/m, J r =1 T, and (BH) max for the powder was 100 kJ/m 3 . These results will be discussed in terms of the grain size and the intrinsic properties of the hard and soft magnetic phases identified using X-ray diffraction. (orig.)
Count-doubling time safety circuit
International Nuclear Information System (INIS)
Keefe, D.J.; McDowell, W.P.; Rusch, G.K.
1981-01-01
There is provided a nuclear reactor count-factor-increase time monitoring circuit which includes a pulse-type neutron detector, and means for counting the number of detected pulses during specific time periods. Counts are compared and the comparison is utilized to develop a reactor scram signal, if necessary
Count-doubling time safety circuit
Rusch, Gordon K.; Keefe, Donald J.; McDowell, William P.
1981-01-01
There is provided a nuclear reactor count-factor-increase time monitoring circuit which includes a pulse-type neutron detector, and means for counting the number of detected pulses during specific time periods. Counts are compared and the comparison is utilized to develop a reactor scram signal, if necessary.
DEFF Research Database (Denmark)
Nguyen, Phi Hung; Dao, Trong Tuan; Kim, Jayeon
2011-01-01
.9 ± 1.6 to 19.2 ± 1.1 μM), while compounds (3, 5, and 9) with 2,2-dimethylpyrano ring showed less inhibitory effect (IC₅₀ 22.6 ± 2.3 to 72.9 ± 9.7 μM). These results suggest that prenyl and methoxy groups may be responsible for the increase on the activity of 5-deoxyflavonoids against PTP1B......, but the presence of 2,2-dimethylpyrano ring on the B ring may be induced the decrease of PTP1B inhibitory activity....
Coplestone-Loomis, Lenny
1981-01-01
Pumpkin seeds are counted after students convert pumpkins to jack-o-lanterns. Among the activities involved, pupils learn to count by 10s, make estimates, and to construct a visual representation of 1,000. (MP)
Chang, Yu-Hsun; Yang, Shang-Hsien; Wang, Tso-Fu; Lin, Teng-Yi; Yang, Kuo-Liang; Chen, Shu-Huey
2011-06-01
Cord blood banking has become more popular in recent years. Checking cord blood complete blood count (CBC) and white blood cell (WBC) differential counts (DCs) is essential before cryopreserving the cord blood units. Therefore, establishing the normal reference values of cord blood CBC and WBC DC is important in clinical practice and research. To obtain a large-scale population-based normal CBC and WBC DC reference values of healthy neonates' cord blood from a public cord blood bank and to investigate the influence of the gender and delivery route. From September 2001 to November 2006, the cord blood of healthy Taiwanese neonates with gestational age 36 weeks and more were collected by Tzu Chi Cord Blood Bank with written informed consents. All cord blood samples were analyzed by Sysmex XE2100 automated hematology analyzer (Sysmex Corporation, Kobe, Japan) to obtain the CBC. The WBC DC was calculated by manual method. We used Student's t test and Mann-Whitney U test for investigating the influences of gender and delivery route on the CBC and WBC DC reference values. The results were presented by mean±standard deviation or 2.5-97.5th percentiles. In the study period, totally 5602 cord blood samples were collected eligibly for analysis. The cord blood CBC and WBC DC normal reference values were calculated. The female neonates had significantly higher mean corpuscular volume, platelet count, and WBC count, but lower red blood cell (RBC) count, hemoglobin (Hb), hematocrit, and mean corpuscular Hb concentration values (pTaiwan. Gender and delivery routes were important confounding factors that influenced the cord blood CBC and WBC DC values. Copyright © 2011. Published by Elsevier B.V.
Enrichment of W2B5 from WO3 and B2O3 by Double SHS Method
Directory of Open Access Journals (Sweden)
Bora DERIN
2018-02-01
Full Text Available A second self-propagating high-temperature synthesis (SHS was carried out to enrich the W2B5 content in the SHS product containing a mixture of various tungsten boride compounds. In the experiment, the process called Double-SHS (D-SHS was conducted in two steps. In the first SHS reaction, an initial molar composition ratio of WO3:B2O3:Mg mixture was selected as 1:3:8. The product was then hot-leached with hydrochloric acid to eliminate MgO and Mg3B2O6 phases. The leached product, consisting of 72.6 wt.% W2B5, 16.1 wt.% WB, 8.4 wt.% W2B, and 2.9 wt.% W, was again reacted with the Mg and B2O3 mixture by second SHS. After another acid leaching step, W2B5 content in the D-SHS product was found to be 98.2 wt.%. The study showed that D-SHS is an effective method for boron enrichment in the tungsten compounds.DOI: http://dx.doi.org/10.5755/j01.ms.24.1.17834
Chen, Yingjia; Hu, Fanlei; Dong, Xuejiao; Zhao, Meng; Wang, Jing; Sun, Xiaolin; Kim, Tae Jin; Li, Zhanguo; Liu, Wanli
2017-11-01
Unlike conventional B cells, regulatory B cells exhibit immunosuppressive functions to downregulate inflammation via IL-10 production. However, the molecular mechanism regulating the production of IL-10 is not fully understood. In this study, we report the finding that activation-induced cytidine deaminase (AID) is highly upregulated in the IL-10-competent B cell (B10) cell from Innp5d fl/fl Aicda Cre/+ mice, whereas the 5' inositol phosphatase SHIP-1 is downregulated. Notably, SHIP-1 deficiency in AID + B cells leads to a reduction in cell count and impaired IL-10 production by B10 cells. Furthermore, the Innp5d fl/fl Aicda Cre/+ mouse model shows B cell-dependent autoimmune lupus-like phenotypes, such as elevated IgG serum Abs, formation of spontaneous germinal centers, production of anti-dsDNA and anti-nuclear Abs, and the obvious deposition of IgG immune complexes in the kidney with age. We observe that these lupus-like phenotypes can be reversed by the adoptive transfer of B10 cells from control Innp5d fl/fl mice, but not from the Innp5d fl/fl Aicda Cre/+ mice. This finding highlights the importance of defective B10 cells in Innp5d fl/fl Aicda Cre/+ mice. Whereas p-Akt is significantly upregulated, MAPK and AP-1 activation is impaired in B10 cells from Innp5d fl/fl Aicda Cre/+ mice, resulting in the reduced production of IL-10. These results show that SHIP-1 is required for the maintenance of B10 cells and production of IL-10, and collectively suggests that SHIP-1 could be a new potential therapeutic target for the treatment of autoimmune diseases. Copyright © 2017 by The American Association of Immunologists, Inc.
Structural insights into the globular tails of the human type v myosins Myo5a, Myo5b, And Myo5c.
Directory of Open Access Journals (Sweden)
Hana Velvarska
Full Text Available Vertebrate type V myosins (MyoV Myo5a, Myo5b, and Myo5c mediate transport of several different cargoes. All MyoV paralogs bind to cargo complexes mainly by their C-terminal globular domains. In absence of cargo, the globular domain of Myo5a inhibits its motor domain. Here, we report low-resolution SAXS models for the globular domains from human Myo5a, Myo5b, and Myo5c, which suggest very similar overall shapes of all three paralogs. We determined the crystal structures of globular domains from Myo5a and Myo5b, and provide a homology model for human Myo5c. When we docked the Myo5a crystal structure into a previously published electron microscopy density of the autoinhibited full-length Myo5a, only one domain orientation resulted in a good fit. This structural arrangement suggests the participation of additional region of the globular domain in autoinhibition. Quantification of the interaction of the Myo5a globular domain with its motor complex revealed a tight binding with dissociation half-life in the order of minutes, suggesting a rather slow transition between the active and inactive states.
76 FR 15334 - Information Collection for IDEIA Part B and C Child Count; Comment Request
2011-03-21
... Child Count; Comment Request AGENCY: Bureau of Indian Affairs, Interior. ACTION: Notice of Submission to... for Indian children that are operated or funded by the Department of the Interior (``Bureau-funded... organizations based on the number of such children served. In order to allow the Secretary of the Interior to...
Conventional kinesin KIF5B mediates adiponectin secretion in 3T3-L1 adipocytes
Energy Technology Data Exchange (ETDEWEB)
Cui, Ju, E-mail: juzi.cui@gmail.com [The Key Laboratory of Geriatrics, Beijing Hospital and Beijing Institute of Geriatrics, Beijing (China); Pang, Jing; Lin, Ya-Jun; Jiang, Ping; Gong, Huan [The Key Laboratory of Geriatrics, Beijing Hospital and Beijing Institute of Geriatrics, Beijing (China); Wang, Zai [Institute of Clinical Medical Sciences, China-Japan Friendship Hospital, Beijing (China); Li, Jian; Cai, Jian-Ping [The Key Laboratory of Geriatrics, Beijing Hospital and Beijing Institute of Geriatrics, Beijing (China); Huang, Jian-Dong, E-mail: jdhuang@hku.hk [School of Biomedical Sciences and Shenzhen Institute of Research and Innovation, The University of Hong Kong, Pokfulam (Hong Kong); The Centre for Synthetic Biology Engineering Research, Shenzhen Institutes of Advanced Technology, Shenzhen (China); Zhang, Tie-Mei, E-mail: tmzhang126@126.com [The Key Laboratory of Geriatrics, Beijing Hospital and Beijing Institute of Geriatrics, Beijing (China)
2016-08-05
Insulin stimulates adiponectin secretion and glucose transporter type 4 (GLUT4) translocation in adipocyte to regulate metabolism homeostasis. Similar to GLUT4 translocation, intracellular trafficking and release of adiponectin in adipocytes relies on the trans-Golgi network and endosomal system. Recent studies show that the heavy chain of conventional kinesin (KIF5B) mediates GLUT4 translocation in murine 3T3-L1 adipocytes, however, the motor machinery involved in mediating intracellular trafficking and release of adiponectin is unknown. Here, we examined the role of KIF5B in the regulation of adiponectin secretion. The KIF5B level was up-regulated during 3T3-L1 adipogenesis. This increase in cytosolic KIF5B was synchronized with the induction of adiponectin. Endogenous KIF5B and adiponectin were partially colocalized at the peri-nuclear and cytosolic regions. In addition, adiponectin-containing vesicles were co-immunoprecipitated with KIF5B. Knockdown of KIF5B resulted in a marked inhibition of adiponectin secretion and overexpression of KIF5B enhanced adiponectin release, whereas leptin secretion was not affected by changes in KIF5B expression. These data suggest that the secretion of adiponectin, but not leptin, is dependent on functional KIF5B. - Highlights: • The KIF5B level was up regulated during 3T3-L1 adipogenesis. • Endogenous KIF5B and adiponectin were partially colicalized. • Adiponectin-containing vesicles were co-immunoprecipitated with KIF5B. • The secretion of adiponectin, but not leptin, is dependent on functional KIF5B.
Conventional kinesin KIF5B mediates adiponectin secretion in 3T3-L1 adipocytes
International Nuclear Information System (INIS)
Cui, Ju; Pang, Jing; Lin, Ya-Jun; Jiang, Ping; Gong, Huan; Wang, Zai; Li, Jian; Cai, Jian-Ping; Huang, Jian-Dong; Zhang, Tie-Mei
2016-01-01
Insulin stimulates adiponectin secretion and glucose transporter type 4 (GLUT4) translocation in adipocyte to regulate metabolism homeostasis. Similar to GLUT4 translocation, intracellular trafficking and release of adiponectin in adipocytes relies on the trans-Golgi network and endosomal system. Recent studies show that the heavy chain of conventional kinesin (KIF5B) mediates GLUT4 translocation in murine 3T3-L1 adipocytes, however, the motor machinery involved in mediating intracellular trafficking and release of adiponectin is unknown. Here, we examined the role of KIF5B in the regulation of adiponectin secretion. The KIF5B level was up-regulated during 3T3-L1 adipogenesis. This increase in cytosolic KIF5B was synchronized with the induction of adiponectin. Endogenous KIF5B and adiponectin were partially colocalized at the peri-nuclear and cytosolic regions. In addition, adiponectin-containing vesicles were co-immunoprecipitated with KIF5B. Knockdown of KIF5B resulted in a marked inhibition of adiponectin secretion and overexpression of KIF5B enhanced adiponectin release, whereas leptin secretion was not affected by changes in KIF5B expression. These data suggest that the secretion of adiponectin, but not leptin, is dependent on functional KIF5B. - Highlights: • The KIF5B level was up regulated during 3T3-L1 adipogenesis. • Endogenous KIF5B and adiponectin were partially colicalized. • Adiponectin-containing vesicles were co-immunoprecipitated with KIF5B. • The secretion of adiponectin, but not leptin, is dependent on functional KIF5B.
Half-metallic magnetism in Ti3Co5-xFexB2
Directory of Open Access Journals (Sweden)
Rohit Pathak
2017-05-01
Full Text Available Bulk alloys and thin films of Fe-substituted Ti3Co5B2 have been investigated by first-principle density-functional calculations. The series, which is of interest in the context of alnico magnetism and spin electronics, has been experimentally realized in nanostructures but not in the bulk. Our bulk calculations predict paramagnetism for Ti3Co5B2, Ti3Co4FeB2 and Ti3CoFe4B2, whereas Ti3Fe5B2 is predicted to be ferromagnetic. The thin films are all ferromagnetic, indicating that moment formation may be facilitated at nanostructural grain boundaries. One member of the thin-film series, namely Ti3CoFe4B2, is half-metallic and exhibits perpendicular easy-axis magnetic anisotropy. The half-metallicity reflects the hybridization of the Ti, Fe and Co 3d orbitals, which causes a band gap in minority spin channel, and the limited equilibrium solubility of Fe in bulk Ti3Co5B2 may be linked to the emerging half-metallicity due to Fe substitution.
17 CFR 240.16b-5 - Bona fide gifts and inheritance.
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Bona fide gifts and inheritance. 240.16b-5 Section 240.16b-5 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... gifts and inheritance. Both the acquisition and the disposition of equity securities shall be exempt...
5′ UTR and NS5B-based genotyping of hepatitis C virus in patients from Damietta governorate, Egypt
Directory of Open Access Journals (Sweden)
Radwa R. El-Tahan
2018-03-01
Full Text Available Chronic hepatitis C virus (HCV infection is a main health problem in Egypt causing high rates of mortalities. Egypt has the highest HCV prevalence in the world, with specific HCV subtypes epidemic and circulating extensively in the country. Different antiviral therapy protocols have been implemented for treating Egyptian HCV patients. Due to the limited data about HCV in Egypt, this study aimed to genotype HCV strains circulating in the Nile Delta Damietta governorate and to investigate the variation in the nonstructural 5B (NS5B region targeted by the newly approved antiviral drugs. Thirty HCV samples from treatment-naïve patients were genotyped by restriction fragment length polymorphism. Some samples were genotyped by direct sequencing of their 5′ untranslated region (UTR and NS5B regions. Phylogenetic analysis was also performed on the sequences of their NS5B regions. Fourteen new sequences have been deposited in the GenBank database. Results showed that subtype 4a was prevalent in addition to subtype 1g. None of the previously reported NS5B substitutions were detected in the sequenced isolates from treatment-naïve patients, which may be a good predictor for efficient treatment of HCV Egyptian patients with Sofosbuvir. Further studies on Sofosbuvir treated-HCV Egyptian patients are required to investigate whether any NS5B substitutions can confer resistance to treatment.
Solbakken, Jan Erik; Knap, A.H.; Sleeter, T.D.; Searle, C.E.; Palmork, Karsten H.
1983-01-01
Uptake and elimination of 4 labelled lipid-soluble xenobiotics (naphthalene, phenanthrene, 2,4,5,2',4',5'-hexachlorobiphen(yPlC B), octachlorostyrene) were studied in 19 anthozoans and 1 hydrozoan common to Bermudian waters. The concentration of radioactiv~ty In the tissues was determined using liquid scintillation counting. All organisms tested took up radioactivity from the water. However, elimination rates were very slow compared to those of other marine organisms. Naphthale...
Multiple Sclerosis and EIF2B5: A Paradox or a Missing Link.
Zahoor, Insha; Haq, Ehtishamul; Asimi, Ravouf
2017-01-01
Multiple sclerosis (MS) is an encumbering inflammatory condition of the central nervous system (CNS) caused by axonal demyelination. There is sufficient evidence suggesting role of eukaryotic translation initiation factor 2B (EIF2B) gene family encoding the five subunits of eIF2B complex-α, β, γ, δ and ε respectively, in causing vanishing white matter (VWM) disease of the brain. Incidentally researchers have proposed overlapping between MS and VWM in terms of clinical, biochemical and genetic aspects, which incited us to write this chapter to explore the association between EIF2B5 and MS. eIF2B plays an essential role in translation initiation and its regulation in eukaryotes. Among EIF2B gene family, EIF2B5 gene encodes the catalytic and a crucial epsilon subunit of the eIF2B protein as most of the alterations have been found in this gene. The recent findings on the association between EIF2B5 and MS susceptibility point towards unfathomable and contentious role of EIF2B5 in MS development. This chapter briefly reviews the insights gleaned from recent studies conducted in understanding the association between EIF2B5 and MS risk. The need of hour is to conduct large scale conclusive studies aimed at expounding the mechanisms behind this relationship.
Directory of Open Access Journals (Sweden)
Magdalena Leszczyszyn-Pynka
Full Text Available Association of two HLA class I variants with HIV-1 pretreatment viremia, CD4+ T cell count at the care-entry and CD4+ T cell nadir.414 HIV-positive Caucasians (30% women aged 19-73 years were genotyped for HLA-C -35 (rs9264942 and HLA-B*5701 variants. HIV-1 viral load, as well as CD4+ T cell count at care-entry and nadir, were compared across alleles, genotypes and haplotypes.HLA-C -35 C/C genotype was found in 17.6% patients, C/T genotype in 48.1%, and T/T genotype in 34.3% patients. HLA-B*5701 variant was present in 5.8% of studied population. HIV plasma viremia in the group with C allele was significantly lower (p=0.0002 compared to T/T group [mean:4.66 log (SD:1.03 vs. 5.07 (SD:0.85 log HIV-RNA copies/ml, respectively], while CD4+ T cell count at baseline was notably higher among C allele carriers compared to T/T homozygotes [median: 318 (IQR:127-537 cells/μl vs. median: 203 (IQR:55-410 cells/μl, respectively] (p=0.0007. Moreover, CD4+ T cell nadir among patients with C allele [median: 205 (IQR:83.5-390 cells/μl] was significantly higher compared to T/T group [median: 133 (IQR:46-328 cells/μl] (p=0.006. Among cases with HLA-B*5701 allele, significantly lower pretreatment viremia and higher baseline CD4+ T cell count were found (mean: 4.08 [SD: 1.2] vs. mean: 4.84 [SD:0.97] log HIV-RNA copies/ml, p=0.003 and 431 vs. 270 cells/μl, p=0.04, respectively compared to HLA-B*5701 negative individuals. The lowest viremia (mean: 3.85 log [SD:1.3] HIV-RNA copies/ml and the highest baseline and nadir CD4+ T cell [median: 476 (IQR:304-682 vs. median: 361 (IQR: 205-574 cells/μl, respectively were found in individuals with HLA-B*5701(+/HLA-C -35 C/C haplotype.HLA-C -35 C and HLA-B*5701 allele exert a favorable effect on the immunological (higher baseline and nadir CD4+ T cell count and virologic (lower pretreatment HIV viral load variables. This protective effect is additive for the compound HLA-B*5701(+/HLA-C -35 C/C haplotype.
International Nuclear Information System (INIS)
Ghorbani, Afshin; Bazooyar, Bahamin
2012-01-01
This paper characterizes combustion of petrodiesel and prevalent SOME blends (B100, B5, B10 and B20), which were produced through an alkali-based transesterification in PUT, in a semi industrial boiler by determining its efficiency, exhaust emissions and costs. First, the influence of oxygen content of stock gases (by volume percent) upon regular emissions, thermal efficiency and costs (calculated by a cost function) was studied in order to investigate the performance and feasibility of using biodiesel in the boiler. In the next level, a multi-objective optimization method, named cost-based optimization, was represented and optimized the combustion of the fuels. The overall efficiency of the boiler obtained with the different fuels is comparable for the same operating points. Soy bean methyl ester and the blends emitted lower emissions than petrodiesel. Results demonstrate that the use of pure biodiesel is not economically feasible in the boiler. The total costs of the boiler obtained with the blends and petrodiesel are quite competitive. B5 is introduced to be the best fuel for using in the boiler. Results also reveal an optimum (“compromise”) in total cost of all the fuels in relation to the oxygen concentration of stock gases, which promises a cost saving in the boiler performance. -- Highlights: ► Efficiency, emissions and economy of the boiler fuelled with SOME, B5, B10, B20 and petrodiesel are investigated. ► The use of pure biodiesel was not economically feasible while economy of the blends and petrodiesel is competitive. ► B5 is introduced to be the most appropriate and economic fuel for the boiler. ► Presentation of a cost-based method optimization method. ► Introducing an optimum, “compromise”, O 2 % for the combustion of each fuel which promises a cost saving.
Synthesis of Al-5Ti-1B Refiner by Melt Reaction Method
Directory of Open Access Journals (Sweden)
LI He
2017-02-01
Full Text Available Al-5Ti-1B refiner was successfully prepared by melt reaction method. Through the thermodynamics calculation, the initial reaction temperature was determined. The influence of reaction temperature on microstructure and absorption rate of the alloy was investigated. The phase and microstructure of the alloy were observed by X-ray diffraction, scanning electron microscope and energy dispersive spectrometer. The Al-5Ti-1B refiner was extruded at high temperature to wire with the diameter of 9.5mm, and then the refinement experiment was carried out on pure aluminium. The results indicate that the refiner consists of TiB2, TiAl3 and α-Al, and the microstructure prepared at 850℃ is the optimum and the absorption rate of Ti and B matches the best. The TiAl3 and TiB2 phases distribute homogeneously in the matrix after extrusion. When adding 0.2%(mass fraction of Al-5Ti-1B refiner, the grain size of pure aluminium reduces from 3.99mm to 0.45mm.
Extracellular VirB5 enhances T-DNA transfer from Agrobacterium to the host plant.
Directory of Open Access Journals (Sweden)
Benoît Lacroix
Full Text Available VirB5 is a type 4 secretion system protein of Agrobacterium located on the surface of the bacterial cell. This localization pattern suggests a function for VirB5 which is beyond its known role in biogenesis and/or stabilization of the T-pilus and which may involve early interactions between Agrobacterium and the host cell. Here, we identify VirB5 as the first Agrobacterium virulence protein that can enhance infectivity extracellularly. Specifically, we show that elevating the amounts of the extracellular VirB5--by exogenous addition of the purified protein, its overexpression in the bacterium, or transgenic expression in and secretion out of the host cell--enhances the efficiency the Agrobacterium-mediated T-DNA transfer, as measured by transient expression of genes contained on the transferred T-DNA molecule. Importantly, the exogenous VirB5 enhanced transient T-DNA expression in sugar beet, a major crop recalcitrant to genetic manipulation. Increasing the pool of the extracellular VirB5 did not complement an Agrobacterium virB5 mutant, suggesting a dual function for VirB5: in the bacterium and at the bacterium-host cell interface. Consistent with this idea, VirB5 expressed in the host cell, but not secreted, had no effect on the transformation efficiency. That the increase in T-DNA expression promoted by the exogenous VirB5 was not due to its effects on bacterial growth, virulence gene induction, bacterial attachment to plant tissue, or host cell defense response suggests that VirB5 participates in the early steps of the T-DNA transfer to the plant cell.
Extracellular VirB5 enhances T-DNA transfer from Agrobacterium to the host plant.
Lacroix, Benoît; Citovsky, Vitaly
2011-01-01
VirB5 is a type 4 secretion system protein of Agrobacterium located on the surface of the bacterial cell. This localization pattern suggests a function for VirB5 which is beyond its known role in biogenesis and/or stabilization of the T-pilus and which may involve early interactions between Agrobacterium and the host cell. Here, we identify VirB5 as the first Agrobacterium virulence protein that can enhance infectivity extracellularly. Specifically, we show that elevating the amounts of the extracellular VirB5--by exogenous addition of the purified protein, its overexpression in the bacterium, or transgenic expression in and secretion out of the host cell--enhances the efficiency the Agrobacterium-mediated T-DNA transfer, as measured by transient expression of genes contained on the transferred T-DNA molecule. Importantly, the exogenous VirB5 enhanced transient T-DNA expression in sugar beet, a major crop recalcitrant to genetic manipulation. Increasing the pool of the extracellular VirB5 did not complement an Agrobacterium virB5 mutant, suggesting a dual function for VirB5: in the bacterium and at the bacterium-host cell interface. Consistent with this idea, VirB5 expressed in the host cell, but not secreted, had no effect on the transformation efficiency. That the increase in T-DNA expression promoted by the exogenous VirB5 was not due to its effects on bacterial growth, virulence gene induction, bacterial attachment to plant tissue, or host cell defense response suggests that VirB5 participates in the early steps of the T-DNA transfer to the plant cell.
A review of radioisotope techniques in the study of vitamin B12 absorption
International Nuclear Information System (INIS)
Boddy, K.
1976-01-01
The five in vivo tests in common use for the study of vitamin B 12 absorption, namely, 1) faecal excretion method, 2) urinary excretion method, 3) plasma radioactivity method, 4) hepatic uptake method, and 5) whole-body counting method, are described. The merits, disadvantages and limitations of each method are considered in a clinical context. Whole-body counting is regarded as the method of choice where appropriate facilities are available and when the delay of about 7 days in obtaining the result is acceptable. The plasma radioactivity method can provide concurrently a rapid assessment. (author)
Correction for intrinsic and set dead-time losses in radioactivity counting
International Nuclear Information System (INIS)
Wyllie, H.A.
1992-12-01
Equations are derived for the determination of the intrinsic dead time of the components which precede the paralysis unit in a counting system for measuring radioactivity. The determination depends on the extension of the set dead time by the intrinsic dead time. Improved formulae are given for the dead-time correction of the count rate of a radioactive source in a single-channel system. A variable in the formulae is the intrinsic dead time which is determined concurrently with the counting of the source. The only extra equipment required in a conventional system is a scaler. 5 refs., 2 tabs., 21 figs
Decline of blood leukocyte counts 1947-59, Hiroshima and Nagasaki
Energy Technology Data Exchange (ETDEWEB)
Ichimaru, Michito; Ueda, Shoichi; Blaisdell, R K
1963-03-03
Earlier reports of progressive decline in leukocyte counts in Hiroshima from about 1948 to 1954 have been confirmed. A similar phenomenon has been observed in Nagasaki. Analysis indicates that this decline in white cell count with time is not related to exposure to the 1945 atomic bombs, to sex, to age, to commonly diagnosed diseases, or to the disproportionate influence of a subgroup. The principal white cells affected were neutrophils, lymphocytes and eosinophils. The precise etiologic factors accounting for the decline, and the biological significance of the present lower range of leukocyte values in Hiroshima and Nagasaki remain to be determined. 16 references, 5 figures, 5 tables.
Investigation of internal conversion electron lines by track counting technique
Islamov, T A; Kambarova, N T; Muminov, T M; Lebedev, N A; Solnyshkin, A A; Aleshin, Yu D; Kolesnikov, V V; Silaev, V I; Niipf-Tashgu, T
2001-01-01
The methodology of counting the tracks of the internal conversion electron (ICE) in the nuclear photoemulsion is described. The results on counting the ICE tracks on the photoplates for sup 1 sup 6 sup 1 Ho, sup 1 sup 6 sup 3 Tm, sup 1 sup 6 sup 6 Tm, sup 1 sup 3 sup 5 Ce is described. The above results are obtained through the MBI-9 microscope and the MAS-1 automated facility. The ICE track counting on the photoplates provides for essentially higher sensitivity as compared to the photometry method. This makes it possible to carry out measurements with the sources by 1000 times weaker as by the study into the density of blackening
Counting statistics in radioactivity measurements
International Nuclear Information System (INIS)
Martin, J.
1975-01-01
The application of statistical methods to radioactivity measurement problems is analyzed in several chapters devoted successively to: the statistical nature of radioactivity counts; the application to radioactive counting of two theoretical probability distributions, Poisson's distribution law and the Laplace-Gauss law; true counting laws; corrections related to the nature of the apparatus; statistical techniques in gamma spectrometry [fr
Comparison of oral manifestations with CD4 count in HIV-infected patients
Directory of Open Access Journals (Sweden)
Subodh Arun Sontakke
2011-01-01
Full Text Available Aim and Objective: This study was carried out with the primary aim of correlating oral changes and general changes of HIV-infected patients with their CD4 count. Materials and Methods: 124 patients were selected, and after taking their informed consent, they were subjected to detailed history taking and thorough clinical examination. Specific oral lesions and general physical changes were recorded. Every patient was subjected to laboratory investigation for CD4 count. All these findings were tabulated. The clinical observation and laboratory findings were subjected to critical analysis and correlated. Statistical test, i.e. Student′s " t" test, was applied and objective conclusions were drawn. Result: Out of 124 patients, 40 had oral candidiasis, 6 had oral hairy leukoplakia, 12 had periodontal disease, 20 had xerostomia, 30 had melanin pigmentation, while 4 had HSV2, and atypical ulceration. Out of 40 patients with oral candidiasis, 28 patients had CD4 count 500 cell/mm 3 . Oral hairy leukoplakia occurred in equal proportions in group A and B. These periodontal diseases were more commonly in group B; xerostomia and melanin pigmentation was equally seen in group A and B. Conclusion: Oral candidiasis, oral hairy leukoplakia, linear gingival erythema, necrotizing ulcerative gingivitis, and necrotizing ulcerative periodontitis are specific oral indicators which will definitely suggest to the dental surgeon that the disease is running a rapid downhill course and due to this the oral physician is in a position to raise a suspicion and alert the general physician regarding the declining immune status of patient.
Luminosity effects in the ultraviolet spectrum of B5-B6 stars
International Nuclear Information System (INIS)
Underhill, A.B.; Silversmith, E.
1976-01-01
Copernicus U2 spectral tracings of the ultraviolet spectra of eta CMa (B5 Ia) and zeta Dra (B6 III) have been compared, and four regions: 1330 to 1340 A, 1340 to 1350 A, 1390 to 1396 A, and 1398 to 1405 A: are found to contain differences due to luminosity effects. The observed profiles are interpreted using synthetic spectra predicted with LTE theory. These effects are found: (1) the C ii 1335 blend is shortward-displaced in eta CMa, (2) the P iii and Si iv resonance lines strengthen significantly in the supergiant, and (3) lines of multiplet UV7 of Si ii are strengthened by non-LTE effects in the supergiant
Emuchay, Charles Iheanyichi; Okeniyi, Shemaiah Olufemi; Okeniyi, Joshua Olusegun
2014-04-01
The expensive and technology limited setting of CD4 count testing is a major setback to the initiation of HAART in a resource limited country like Nigeria. Simple and inexpensive tools such as Hemoglobin (Hb) measurement and Total Lymphocyte Count (TLC) are recommended as substitute marker. In order to assess the correlations of these parameters with CD4 count, 100 "apparently healthy" male volunteers tested HIV positive aged ≥ 20 years but ≤ 40 years were recruited and from whom Hb, Hct, TLC and CD4 count were obtained. The correlation coefficients, R, the Nash-Sutcliffe Coefficient of Efficiency (CoE) and the p-values of the ANOVA model of Hb, Hct and TLC with CD4 count were assessed. The assessments show that there is no significant relationship of any of these parameters with CD4 count and the correlation coefficients are very weak. This study shows that Hb, Hct and TLC cannot be substitute for CD4 count as this might lead to certain individuals' deprivation of required treatment.
International Nuclear Information System (INIS)
Isusi, M.; Eguidazu, J.; Oleaga, L.; Grande, D.
2000-01-01
To describe the radiological features of pulmonary tuberculosis (TB) in patients infected with human immunodeficiency virus (HIV) and its correlation with the blood CD4 cell count. We present 44 HIV+patients, 24 with CD4 cell counts of less than 200 cells/mm''3 (group A) and 20 in whom the CD4 counts surpassed this level (group B). We also assessed the chest x-ray images to determine whether or not there was any correlation with the blood CD4 cell counts. Fisher's exact test was used for the statistical study of the differences in the radiological findings in the two groups. The incidence of atypical features was significantly greater in the patients with CD4 cell counts of less than 200 cells/mm''3 (group A) than in those with CD4 counts of over 200 cells/mm''3 (group B). Among HIV+patients, those with a more intact immune status were more likely to present lung x-ray images typical of post-primary TB, with cavitary lesions in upper lobes. The group of patients in whom the immune deficiency was more marked showed a greater incidence of atypical pulmonary findings, more characteristics of primary TB. (Author)
DEFF Research Database (Denmark)
Sunde, Peter; Jessen, Lonnie
2013-01-01
observers with respect to their ability to detect and estimate distance to realistic animal silhouettes at different distances. Detection probabilities were higher for observers experienced in spotlighting mammals than for inexperienced observers, higher for observers with a hunting background compared...... with non-hunters and decreased as function of age but were independent of sex or educational background. If observer-specific detection probabilities were applied to real counting routes, point count estimates from inexperienced observers without a hunting background would only be 43 % (95 % CI, 39...
Valadbeigi, Younes; Farrokhpour, Hossein; Tabrizchi, Mahmoud
2014-05-01
Isomerization and tautomerism of the three water soluble vitamins including B3, B5 and B7 were studied applying density functional theory using B3LYP method in gas and aqueous phases. Activation energies (Ea), Gibbs free energies of activation (ΔG#), and imaginary frequencies of the transition state structures were calculated for all the isomerization and tautomerism reactions. Activation energies of the neutral → zwitterion (amine-enamine) tautomerism in vitamin B3 were 310-360 kJ/mol where these values for the keto-enol tautomerism were 100-130 kJ/mol. It was found that water molecule catalyzes the tautomerism and decreases the activation energies about 90-160 kJ/mol.
Directory of Open Access Journals (Sweden)
Alfonsas Laučka
2011-05-01
Full Text Available THE GLOSSARY OF THE CATECHISM OF 1680SummaryThe article presents an analysis of the Lithuanian-English glossary attached to the Catechism of 1680 — of only extant copy of which is preserved in the British Museum (PRADZIA PAMOKSLA, Printed Books Department, С 38 b 47, 1680. The glossary is an important cultural document testifying to the Lithuanian-English linguistic contacts of the 17th century. The manuscript glossary contains ca.250 entries. Lithuanian words and phrases arranged in the alphabetical order are taken from the texts of the Catechism. The character of mistakes found in the glossary indicates that the compiler's command of Lithuanian was poorer than that of English. Spelling peculiarities of English words are characteristic of English spelling of the late 17th and early 18th centuries. It has not yet been possible to identify the compiler and to determine the purpose of the glossary.
Tschentscher, Nadja; Hauk, Olaf; Fischer, Martin H.; Pulvermüller, Friedemann
2012-01-01
The embodied cognition framework suggests that neural systems for perception and action are engaged during higher cognitive processes. In an event-related fMRI study, we tested this claim for the abstract domain of numerical symbol processing: is the human cortical motor system part of the representation of numbers, and is organization of numerical knowledge influenced by individual finger counting habits? Developmental studies suggest a link between numerals and finger counting habits due to the acquisition of numerical skills through finger counting in childhood. In the present study, digits 1 to 9 and the corresponding number words were presented visually to adults with different finger counting habits, i.e. left- and right-starters who reported that they usually start counting small numbers with their left and right hand, respectively. Despite the absence of overt hand movements, the hemisphere contralateral to the hand used for counting small numbers was activated when small numbers were presented. The correspondence between finger counting habits and hemispheric motor activation is consistent with an intrinsic functional link between finger counting and number processing. PMID:22133748
Soft X ray spectrometry at high count rates
International Nuclear Information System (INIS)
Blanc, P.; Brouquet, P.; Uhre, N.
1978-06-01
Two modifications of the classical method of X-ray spectrometry by a semi-conductor diode permit a count rate of 10 5 c/s with an energy resolution of 350 eV. With a specially constructed pulse height analyzer, this detector can measure four spectra of 5 ms each, in the range of 1-30 keV, during a plasma shot
Directory of Open Access Journals (Sweden)
Ai-Hsiang Chou
Full Text Available Enterovirus 71 (EV71 has caused several epidemics of hand, foot and mouth diseases (HFMD in Asia. No effective EV71 vaccine is available. A randomized and open-label phase I clinical study registered with ClinicalTrials.gov #NCT01268787, aims to evaluate the safety, reactogenicity and immunogenicity of a formalin-inactivated EV71 vaccine candidate (EV71vac at 5- and 10-µg doses. In this study we report the cross-neutralizing antibody responses from each volunteer against different subgenotypes of EV71 and CVA16.Sixty eligible healthy adults were recruited and vaccinated. Blood samples were obtained on day 0, 21 and 42 and tested against B1, B4, B5, C2, C4A, C4B and CVA16 for cross-neutralizing antibody responses.The immunogenicity of both 5- and 10- µg doses were found to be very similar. Approximately 45% of the participants had 4-fold increase in Nt, but there was no further increase in Nt after the second dose. EV71vac induced very strong cross-neutralizing antibody responses in >85% of volunteers without pre-existing Nt against subgenotype B1, B5 and C4A. EV71vac elicited weak cross-neutralizing antibody responses (∼20% of participants against a C4B and Coxsackie virus A16. Over 90% of vaccinated volunteers did not develop cross-neutralizing antibody responses (Nt<8 against a C2 strain. EV71vac can boost and significantly enhance the neutralizing antibody responses in volunteers who already had pre-vaccination antibodies against EV71 and/or CVA16.EV71vac is efficient in eliciting cross-neutralizing antibody responses against EV71 subgenotypes B1, B4, B5, and C4A, and provides the rationale for its evaluation in phase II clinical trials.ClinicalTrials.gov NCT01268787.
Grzegorzewska, Alicja E; Leander, Magdalena
2005-01-01
Dietary deficiency causes abnormalities in circulating lymphocyte counts. For the present paper, we evaluated correlations between total and subpopulation lymphocyte counts (TLC, SLCs) and parameters of nutrition in peritoneal dialysis (PD) patients. Studies were carried out in 55 patients treated with PD for 22.2 +/- 11.4 months. Parameters of nutritional status included total body mass, lean body mass (LBM), body mass index (BMI), and laboratory indices [total protein, albumin, iron, ferritin, and total iron binding capacity (TIBC)]. The SLCs were evaluated using flow cytometry. Positive correlations were seen between TLC and dietary intake of niacin; TLC and CD8 and CD16+56 counts and energy delivered from protein; CD4 count and beta-carotene and monounsaturated fatty acids 17:1 intake; and CD19 count and potassium, copper, vitamin A, and beta-carotene intake. Anorexia negatively influenced CD19 count. Serum albumin showed correlations with CD4 and CD19 counts, and LBM with CD19 count. A higher CD19 count was connected with a higher red blood cell count, hemoglobin, and hematocrit. Correlations were observed between TIBC and TLC and CD3 and CD8 counts, and between serum Fe and TLC and CD3 and CD4 counts. Patients with a higher CD19 count showed a better clinical-laboratory score, especially less weakness. Patients with a higher CD4 count had less expressed insomnia. Quantities of ingested vitamins and minerals influence lymphocyte counts in the peripheral blood of PD patients. Evaluation of TLC and SLCs is helpful in monitoring the effectiveness of nutrition in these patients.
An Economical Fast Discriminator for Nuclear Pulse Counting
International Nuclear Information System (INIS)
Issarachai, Opas; Punnachaiya, Suvit
2009-07-01
Full text: This research work was aimed to develop a fast discriminator at low cost but high capability for discrimination a nanosecond nuclear pulse. The fast discriminator can be used in association with fast photon counting system. The designed structure consisted of the ultra-fast voltage comparator using ADCMP601 integrated circuit, the monostable multivibrator with controllable pulse width output by propagation delay of logic gate, and the fast response buffer amplifier. The tested results of pulse height discrimination of 0-5 V nuclear pulse with 20 ns (FWHM) pulse width showed the correlation coefficient (R 2 ) between discrimination level and pulse height was 0.998, while the pulse rate more than 10 MHz could be counted. The 30 ns logic pulse width output revealed high stable and could be smoothly driven to low impedance load at 50 Ω. For pulse signal transmission to the counter, it was also found that the termination of reflected signal must be considered because it may cause pulse counting error
International Nuclear Information System (INIS)
Ahmad, M. S.; Waheed, A.
2014-01-01
Objective: To determine frequency of thrombocytopenia and thrombocytosis, the MPV (mean platelet volume) and PDW (platelet distribution width) in patients with probable and culture proven neonatal sepsis and determine any association between platelet counts and mortality rate. Study Design: Descriptive analytical study. Place and Duration of Study: NICU, Fazle Omar Hospital, from January 2011 to December 2012. Methodology: Cases of culture proven and probable neonatal sepsis, admitted in Fazle Omar Hospital, Rabwah, were included in the study. Platelet counts, MPV and PDW of the cases were recorded. Mortality was documented. Frequencies of thrombocytopenia ( 450000/mm3) were ascertained. Mortality rates in different groups according to platelet counts were calculated and compared by chi-square test to check association. Results: Four hundred and sixty nine patients were included; 68 (14.5%) of them died. One hundred and thirty six (29%) had culture proven sepsis, and 333 (71%) were categorized as probable sepsis. Thrombocytopenia was present in 116 (24.7%), and thrombocytosis was present in 36 (7.7%) cases. Median platelet count was 213.0/mm3. Twenty eight (27.7%) patients with thrombocytopenia, and 40 (12.1%) cases with normal or raised platelet counts died (p < 0.001). Median MPV was 9.30, and median PDW was 12.30. MPV and PDW of the patients who died and who were discharged were not significantly different from each other. Conclusion: Thrombocytopenia is a common complication of neonatal sepsis. Those with thrombocytopenia have higher mortality rate. No significant difference was present between PDW and MPV of the cases who survived and died. (author)
Medina, Alvin Leroy
This document presents English-Spanish/Spanish-English equivalent translations of scientific and management terms commonly used in the field of natural resource management. The glossary is composed of two sections. Section 1 contains the English to Spanish translations, while Section 2 provides the Spanish to English translations. Each section is…
Study on the behaviour of timing photomultipliers at a high counting rate
International Nuclear Information System (INIS)
Gladyshev, D.A.; Li, B.N.; Yunusov, Kh.R.
1978-01-01
Variations in the amplification factor K of a photomultiplier (PMU) with the accuracy of 1% in a pulse mode are studied. Measurements were performed by means of a light pulse generator based on a light diode which generates pulses at the repetition rate of 250-10 5 pulse/s. Relative variations in K were determined by the position of the peak gravity centre from the light diode using a pulse analyzer and a frequency meter. Results of PM testing show that, at a sudden counting rate increase, the amplification increases during the time period less than, the measurement time (less than 1 s) and returns to the stationary value. When the counting rate returns from 10 5 pulse/s to the initial value of 250 pulse/s, the amplification decreases and than increases to stationary value. The total time of K stabilization after counting rate applying constitutes 10-70 min. Restoration of K after counting rate removal occurs to be much slower, during 3 hr. 40 min. K values varied from 1 to 12%
DEFF Research Database (Denmark)
Pandian, Ramesh; Naushad, Edayadulla; Vijayakumar, Vinodhkumar
2014-01-01
pyridine derivatives through oxidation. Consequently, the interest in this aromatization reaction, investigation of a wide range of 1, 4-DHPs continues to attract the attention of researchers. Herein, we report the preparation of pyridine derivatives and the crystal structures determined by X......-ray crystallographic methods.Results: The crystal structures and conformational studies of two organic compounds, namely ethyl 2-methyl-4-phenyl-5-oxo-5H-indeno [1,2-b] pyridine-3-carboxylate (I) and ethyl 2-methyl-4-(4 chlorophenyl)-5-oxo-5H-indeno [1,2-b] pyridine-3-carboxylate (II) are reported. The terminal ethyl......) dimer running along 011 direction.Conclusion: The crystal structures ethyl 2-methyl-4-phenyl-5-oxo-5H-indeno [1,2-b] pyridine-3-carboxylate and ethyl 2-methyl-4-(4 chlorophenyl)-5-oxo-5H-indeno [1,2-b] pyridine-3-carboxylate have been investigated in detail. The terminal ethyl group of compound I...
Draft Genome Sequence of Lactobacillus delbrueckii subsp. bulgaricus LBB.B5.
Urshev, Zoltan; Hajo, Karima; Lenoci, Leonardo; Bron, Peter A; Dijkstra, Annereinou; Alkema, Wynand; Wels, Michiel; Siezen, Roland J; Minkova, Svetlana; van Hijum, Sacha A F T
2016-10-06
Lactobacillus delbrueckii subsp. bulgaricus LBB.B5 originates from homemade Bulgarian yogurt and was selected for its ability to form a strong association with Streptococcus thermophilus The genome sequence will facilitate elucidating the genetic background behind the contribution of LBB.B5 to the taste and aroma of yogurt and its exceptional protocooperation with S. thermophilus. Copyright © 2016 Urshev et al.
CASMO5 JENDL-4.0 and ENDF/B-VII.1beta4 libraries
International Nuclear Information System (INIS)
Rhodes, J.; Gheorghiu, N.; Ferrer, R.
2012-01-01
This paper details the generation of neutron data libraries for the CASMO5 lattice physics code based on the recently released JENDL-4.0 and ENDF/B-VII.1beta4 nuclear data evaluations. This data represents state-of-the-art nuclear data for late-2011. The key features of the new evaluations are briefly described along with the procedure for processing of this data into CASMO5, 586-energy group neutron data libraries. Finally some CASMO5 results for standard UO 2 and MOX critical experiments for the two new libraries and the current ENDF/B-VII.0 CASMO5 library are presented including the B and W 1810 series, DIMPLE S06A, S06B, TCA reflector criticals with iron plates and the PNL-30-35 MOX criticals. The results show that CASMO5 with the new libraries is performing well for these criticals with a very slight edge in results to the JENDL-4.0 nuclear data evaluation over the ENDF/B-VII.1beta4 evaluation. Work is currently underway to generate a CASMO5 library based on the final ENDF/B-VII.R1 evaluation released Dec. 22, 2011. (authors)
Directory of Open Access Journals (Sweden)
Takuji Oyama
Full Text Available CpMan5B is a glycoside hydrolase (GH family 5 enzyme exhibiting both β-1,4-mannosidic and β-1,4-glucosidic cleavage activities. To provide insight into the amino acid residues that contribute to catalysis and substrate specificity, we solved the structure of CpMan5B at 1.6 Å resolution. The structure revealed several active site residues (Y12, N92 and R196 in CpMan5B that are not present in the active sites of other structurally resolved GH5 enzymes. Residue R196 in GH5 enzymes is thought to be strictly conserved as a histidine that participates in an electron relay network with the catalytic glutamates, but we show that an arginine fulfills a functionally equivalent role and is found at this position in every enzyme in subfamily GH5_36, which includes CpMan5B. Residue N92 is required for full enzymatic activity and forms a novel bridge over the active site that is absent in other family 5 structures. Our data also reveal a role of Y12 in establishing the substrate preference for CpMan5B. Using these molecular determinants as a probe allowed us to identify Man5D from Caldicellulosiruptor bescii as a mannanase with minor endo-glucanase activity.
Oyama, Takuji; Schmitz, George E; Dodd, Dylan; Han, Yejun; Burnett, Alanna; Nagasawa, Naoko; Mackie, Roderick I; Nakamura, Haruki; Morikawa, Kosuke; Cann, Isaac
2013-01-01
CpMan5B is a glycoside hydrolase (GH) family 5 enzyme exhibiting both β-1,4-mannosidic and β-1,4-glucosidic cleavage activities. To provide insight into the amino acid residues that contribute to catalysis and substrate specificity, we solved the structure of CpMan5B at 1.6 Å resolution. The structure revealed several active site residues (Y12, N92 and R196) in CpMan5B that are not present in the active sites of other structurally resolved GH5 enzymes. Residue R196 in GH5 enzymes is thought to be strictly conserved as a histidine that participates in an electron relay network with the catalytic glutamates, but we show that an arginine fulfills a functionally equivalent role and is found at this position in every enzyme in subfamily GH5_36, which includes CpMan5B. Residue N92 is required for full enzymatic activity and forms a novel bridge over the active site that is absent in other family 5 structures. Our data also reveal a role of Y12 in establishing the substrate preference for CpMan5B. Using these molecular determinants as a probe allowed us to identify Man5D from Caldicellulosiruptor bescii as a mannanase with minor endo-glucanase activity.
International Nuclear Information System (INIS)
Sadi, B.K.; Chunsheng Li; Kramer, G.H.; Johnson, C.L.; Queenie Ko; Lai, E.P.C.
2011-01-01
A new radioanalytical method was developed for rapid determination of 226 Ra in drinking water samples. The method is based on extraction and preconcentration of 226 Ra from a water sample to an organic solvent using a dispersive liquid-liquid microextraction (DLLME) technique followed by radiometric measurement using liquid scintillation counting. In DLLME for 226 Ra, a mixture of an organic extractant (toluene doped with dibenzo-21-crown-7 and 2-theonyltrifluoroacetone) and a disperser solvent (acetonitrile) is rapidly injected into the water sample resulting in the formation of an emulsion. Within the emulsion, 226 Ra reacts with dibenzo-21-crown-7 and 2-theonyltrifluoroacetone and partitions into the fine droplets of toluene. The water/toluene phases were separated by addition of acetonitrile as a de-emulsifier solvent. The toluene phase containing 226 Ra was then measured by liquid scintillation counting. Several parameters were studied to optimize the extraction efficiency of 226 Ra, including water immiscible organic solvent, disperser and de-emulsifier solvent type and their volume, chelating ligands for 226 Ra and their concentrations, inorganic salt additive and its concentration, and equilibrium pH. With the optimized DLLME conditions, the accuracy (expressed as relative bias, B r ) and method repeatability (expressed as relative precision, S B ) were determined by spiking 226 Ra at the maximum acceptable concentration level (0.5 Bq L -1 ) according to the Guidelines for Canadian Drinking Water Quality. Accuracy and repeatability were found to be less than -5% (B r ) and less than 6% (S B ), respectively, for both tap water and bottled natural spring water samples. The minimum detectable activity and sample turnaround time for determination of 226 Ra was 33 mBq L -1 and less than 3 h, respectively. The DLLME technique is selective for extraction of 226 Ra from its decay progenies. (author)
B2.5-Eunomia simulations of Pilot-PSI plasmas
International Nuclear Information System (INIS)
Wieggers, R.C.; Coster, D.P.; Groen, P.W.C.; Blank, H.J. de; Goedheer, W.J.
2013-01-01
The B2.5-Eunomia code is used to simulate the plasma and neutral species in and around a Pilot-PSI plasma beam. B2.5, part of the SOLPS5.0 code package, is a multi-fluid plasma code for the scrape-off layer. Eunomia is a newly developed non-linear Monte Carlo transport code that solves the neutral equilibrium, given a background plasma. Eunomia is developed to simulate the relevant neutral species in Pilot-PSI and Magnum-PSI, linear devices that study plasma surface interactions in conditions expected in the ITER divertor. Results show the influence of the neutral species on the Pilot-PSI plasma beam. We show that a fluid description for the neutrals is not sufficient and Eunomia is needed to describe Pilot-PSI. The treatment of individual vibrational states of molecular hydrogen as separate species is crucial to match the experiment
LAWRENCE RADIATION LABORATORY COUNTING HANDBOOK
Energy Technology Data Exchange (ETDEWEB)
Group, Nuclear Instrumentation
1966-10-01
The Counting Handbook is a compilation of operational techniques and performance specifications on counting equipment in use at the Lawrence Radiation Laboratory, Berkeley. Counting notes have been written from the viewpoint of the user rather than that of the designer or maintenance man. The only maintenance instructions that have been included are those that can easily be performed by the experimenter to assure that the equipment is operating properly.
Fission/milligram of 235U in BIG-10 Tests A, C, E, and B
International Nuclear Information System (INIS)
Gilliam, D.M.; Grundl, J.A.; Hansen, G.E.
1976-01-01
The entire series of dosimetry foil tests at BIG-10 (including the preliminary Test A, five fission foil set irradiations--Tests C, five non-fission foil set irradiations--Tests E, and five track-etch detector irradiations--Tests B) were monitored continuously by the NBS double fission chamber PP5 in the central test cavity. The accuracy of the absolute fission counting data (fissions/milligram of 235 U) is estimated to be 1.4% for Tests A, C, and E and 1.5% for Test B. Deposit mass assay uncertainties remain the dominant error
Directory of Open Access Journals (Sweden)
Youn Hee Joung
Full Text Available Methylsulfonylmethane (MSM is a naturally occurring sulfur compound with well-known anti-oxidant properties and anti-inflammatory activities. But, its effects on bone are unknown. Growth hormone (GH is regulator of bone growth and bone metabolism. GH activates several signaling pathways such as the Janus kinase (Jak/signal transducers and activators of transcription (STAT pathway, thereby regulating expression of genes including insulin-like growth factor (IGF-1. GH exerts effects both directly and via IGF-1, which signals by activating the IGF-1 receptor (IGF-1R. In this study, we investigated the effects of MSM on the GH signaling via the Jak/STAT pathway in osteoblasts and the differentiation of primary bone marrow mesenchymal stem cells (MSCs. MSM was not toxic to osteoblastic cells and MSCs. MSM increased the expression of GH-related proteins including IGF-1R, p-IGF-1R, STAT5b, p-STAT5b, and Jak2 in osteoblastic cells and MSCs. MSM increased IGF-1R and GHR mRNA expression in osteoblastic cells. The expression of MSM-induced IGF-1R and GHR was inhibited by AG490, a Jak2 kinase inhibitor. MSM induced binding of STAT5 to the IGF-1R and increased IGF-1 and IGF-1R promoter activities. Analysis of cell extracts by immunoprecipitation and Western blot showed that MSM enhanced GH-induced activation of Jak2/STAT5b. We found that MSM and GH, separately or in combination, activated GH signaling via the Jak2/STAT5b pathway in UMR-106 cells. Using siRNA analysis, we found that STAT5b plays an essential role in GH signaling activation in C3H10T1/2 cells. Osteogenic marker genes (ALP, ON, OCN, BSP, OSX, and Runx2 were activated by MSM, and siRNA-mediated STAT5b knockdown inhibited MSM-induced expression of osteogenic markers. Furthermore, MSM increased ALP activity and the mineralization of MSCs. Taken together, these results indicated that MSM can promote osteogenic differentiation of MSCs through activation of STAT5b.
Musculoskeletal imaging with a prototype photon-counting detector.
Gruber, M; Homolka, P; Chmeissani, M; Uffmann, M; Pretterklieber, M; Kainberger, F
2012-01-01
To test a digital imaging X-ray device based on the direct capture of X-ray photons with pixel detectors, which are coupled with photon-counting readout electronics. The chip consists of a matrix of 256 × 256 pixels with a pixel pitch of 55 μm. A monolithic image of 11.2 cm × 7 cm was obtained by the consecutive displacement approach. Images of embalmed anatomical specimens of eight human hands were obtained at four different dose levels (skin dose 2.4, 6, 12, 25 μGy) with the new detector, as well as with a flat-panel detector. The overall rating scores for the evaluated anatomical regions ranged from 5.23 at the lowest dose level, 6.32 at approximately 6 μGy, 6.70 at 12 μGy, to 6.99 at the highest dose level with the photon-counting system. The corresponding rating scores for the flat-panel detector were 3.84, 5.39, 6.64, and 7.34. When images obtained at the same dose were compared, the new system outperformed the conventional DR system at the two lowest dose levels. At the higher dose levels, there were no significant differences between the two systems. The photon-counting detector has great potential to obtain musculoskeletal images of excellent quality at very low dose levels.
Scintillation characteristics of LiB3O5 and β-BaB2O4 single crystals
International Nuclear Information System (INIS)
Nazarenko, B.P.; Pedash, V.Yu.; Shekhovtsov, A.N.; Tarasov, V.A.; Zelenskaya, O.V.
2006-01-01
LiB 3 O 5 and β-BaB 2 O 4 single crystals have been grown by the top seeded solution growth technique. The optical characteristics and scintillation parameters of the grown single crystals have been tested and discussed
Is total lymphocyte count related to nutritional markers in hospitalized older adults?
Directory of Open Access Journals (Sweden)
Vânia Aparecida LEANDRO-MERHI
Full Text Available ABSTRACT BACKGROUND Older patients are commonly malnourished during hospital stay, and a high prevalence of malnutrition is found in hospitalized patients aged more than 65 years. OBJECTIVE To investigate whether total lymphocyte count is related to other nutritional markers in hospitalized older adults. METHODS Hospitalized older adults (N=131 were recruited for a cross-sectional study. Their nutritional status was assessed by the Nutritional Risk Screening (NRS, anthropometry, and total lymphocyte count. The statistical analyses included the chi-square test, Fisher's exact test, and Mann-Whitney test. Spearman's linear correlation coefficient determined whether total lymphocyte count was correlated with the nutritional markers. Multiple linear regression determined the parameters associated with lymphocyte count. The significance level was set at 5%. RESULTS According to the NRS, 41.2% of the patients were at nutritional risk, and 36% had mild or moderate depletion according to total lymphocyte count. Total lymphocyte count was weakly correlated with mid-upper arm circumference (r=0.20507; triceps skinfold thickness (r=0.29036, and length of hospital stay (r= -0.21518. Total lymphocyte count in different NRS categories differed significantly: older adults who were not at nutritional risk had higher mean and median total lymphocyte count ( P =0.0245. Multiple regression analysis showed that higher lymphocyte counts were associated with higher triceps skinfold thicknesses and no nutritional risk according to the NRS. CONCLUSION Total lymphocyte count was correlated with mid-upper arm circumference, triceps skinfold thickness, and nutritional risk according to the NRS. In multiple regression the combined factors that remained associated with lymphocyte count were NRS and triceps skinfold thickness. Therefore, total lymphocyte count may be considered a nutritional marker. Other studies should confirm these findings.
Energy Technology Data Exchange (ETDEWEB)
Kosuda, Shigeru; Arai, Shinji; Hohshito, Yoshio; Tokumitsu, Hideyuki; Kusano, Shoichi; Ishihara, Shoichiro; Shima, Katsuji [National Defence Medical College, Tokorozawa, Saitama (Japan)
1998-07-01
A combination study of cerebrospinal fluid scintigraphy and nasal pledget counts was performed using 37 MBq of {sup 111}In-DTPA in 12 patients with suspected rhinorrhea. A pledget was inserted and dwelled in each nasal cavity for 6 hours, with the patient prone during at least 30 minutes. A total of 18 studies was implemented and nasal pledget counting method successfully diagnosed all of CSF rhinorrhea. Diagnosis was possible when pledget counts were greater than 1 kcpm. In patients with persistent, intermittent and occult/no nasal discharge, rhinorrhea was found in 100% (5/5), 60% (3/5), 25% (2/8), respectively. Two cases only exhibited positive scintigraphy. MRI or CT cisternography should be first performed in patients with persistent discharge, but in patients with intermittent/occult discharge pledget counting method might take priority of other diagnostic modalities. In conclusion, nasal pledget counting method is a simple and useful tool for detecting rhinorrhea. (author)
Lagarias, Jeffrey C.; Rains, Eric; Vanderbei, Robert J.
2001-01-01
The Kruskal Count is a card trick invented by Martin J. Kruskal in which a magician "guesses" a card selected by a subject according to a certain counting procedure. With high probability the magician can correctly "guess" the card. The success of the trick is based on a mathematical principle related to coupling methods for Markov chains. This paper analyzes in detail two simplified variants of the trick and estimates the probability of success. The model predictions are compared with simula...
Thermodynamics of interactions between mammalian cytochromes P450 and b5.
Yablokov, Evgeny; Florinskaya, Anna; Medvedev, Alexei; Sergeev, Gennady; Strushkevich, Natallia; Luschik, Alexander; Shkel, Tatsiana; Haidukevich, Irina; Gilep, Andrei; Usanov, Sergey; Ivanov, Alexis
2017-04-01
Cytochromes P450 (CYPs) play an important role in the metabolism of xenobiotics and various endogenous substrates. Being a crucial component of the microsomal monooxygenase system, CYPs are involved in numerous protein-protein interactions. However, mechanisms underlying molecular interactions between components of the monooxygenase system still need better characterization. In this study thermodynamic parameters of paired interactions between mammalian CYPs and cytochromes b5 (CYB5) have been evaluated using a Surface Plasmon Resonance (SPR) based biosensor Biacore 3000. Analysis of 18 pairs of CYB5-CYP complexes formed by nine different isoforms of mammalian CYPs and two isoforms of human CYB5 has shown that thermodynamically these complexes can be subdivided into enthalpy-driven and entropy-driven groups. Formation of the enthalpy-driven complexes was observed in the case of microsomal CYPs allosterically regulated by CYB5 (CYB5A-CYP3A4, CYB5A-CYP3A5, CYB5A-CYP17A1). The entropy-driven complexes were formed when CYB5 had no effect on the CYP activity (CYB5A-CYP51A1, CYB5A-CYP1B1, CYB5B-CYP11A1). Results of this study suggest that such interactions determining protein clustering are indirectly linked to the monooxygenase functioning. Positive ΔH values typical for such interactions may be associated with displacement of the solvation shells of proteins upon clustering. CYB5-CYP complex formation accompanied by allosteric regulation of CYP activity by CYB5 is enthalpy-dependent. Copyright © 2017 Elsevier Inc. All rights reserved.
SPERM COUNT DISTRIBUTIONS IN FERTILE MEN
Sperm concentration and count are often used as indicators of environmental impacts on male reproductive health. Existing clinical databases may be biased towards subfertile men with low sperm counts and less is known about expected sperm count distributions in cohorts of fertil...
Lower white blood cell counts in elite athletes training for highly aerobic sports.
Horn, P L; Pyne, D B; Hopkins, W G; Barnes, C J
2010-11-01
White cell counts at rest might be lower in athletes participating in selected endurance-type sports. Here, we analysed blood tests of elite athletes collected over a 10-year period. Reference ranges were established for 14 female and 14 male sports involving 3,679 samples from 937 females and 4,654 samples from 1,310 males. Total white blood cell counts and counts of neutrophils, lymphocytes and monocytes were quantified. Each sport was scaled (1-5) for its perceived metabolic stress (aerobic-anaerobic) and mechanical stress (concentric-eccentric) by 13 sports physiologists. Substantially lower total white cell and neutrophil counts were observed in aerobic sports of cycling and triathlon (~16% of test results below the normal reference range) compared with team or skill-based sports such as water polo, cricket and volleyball. Mechanical stress of sports had less effect on the distribution of cell counts. The lower white cell counts in athletes in aerobic sports probably represent an adaptive response, not underlying pathology.
Permeability and giant magnetoimpedance in Co69Fe4.5X1.5Si10B15 (X=Cr, Mn, Ni) amorphous ribbons
International Nuclear Information System (INIS)
Byon, Kwang Seok; Yu, Seong-Cho; Kim, Cheol Gi
2001-01-01
The magnetoimpedance (MI) has been measured in the amorphous ribbons of the soft ferromagnetic alloy Co 69 Fe 4.5 X 1.5 Si 10 B 15 (X=Cr, Mn, Ni) as functions of frequency (f). For all of the three samples, at low frequency, f≤5MHz, the MI ratio increases with increasing frequency, but the MI ratio decreases at high frequency, f≥5MHz. The MI profiles are not changed at low frequency regions of f≤1MHz in the amorphous ribbons. The MI ratio at high frequency of f=5MHz becomes 57% in Co 69 Fe 4.5 Cr 1.5 Si 10 B 15 , but the MI ratio becomes 30% in Co 69 Fe 4.5 Mn 1.5 Si 10 B 15 and Co 69 Fe 4.5 Ni 1.5 Si 10 B 15 . The MI ratio at f=10MHz becomes 45% in Co 69 Fe 4.5 Cr 1.5 Si 10 B 15 and the MI ratio becomes 23% in Co 69 Fe 4.5 Mn 1.5 Si 10 B 15 and Co 69 Fe 4.5 Ni 1.5 Si 10 B 15 , respectively. The maximum values of field sensitivity are 2.7(X=Cr), 2.5(X=Mn), 2.2(X=Ni)%/Oe for f=5MHz. [copyright] 2001 American Institute of Physics
Validation of an automated colony counting system for group A Streptococcus.
Frost, H R; Tsoi, S K; Baker, C A; Laho, D; Sanderson-Smith, M L; Steer, A C; Smeesters, P R
2016-02-08
The practice of counting bacterial colony forming units on agar plates has long been used as a method to estimate the concentration of live bacteria in culture. However, due to the laborious and potentially error prone nature of this measurement technique, an alternative method is desirable. Recent technologic advancements have facilitated the development of automated colony counting systems, which reduce errors introduced during the manual counting process and recording of information. An additional benefit is the significant reduction in time taken to analyse colony counting data. Whilst automated counting procedures have been validated for a number of microorganisms, the process has not been successful for all bacteria due to the requirement for a relatively high contrast between bacterial colonies and growth medium. The purpose of this study was to validate an automated counting system for use with group A Streptococcus (GAS). Twenty-one different GAS strains, representative of major emm-types, were selected for assessment. In order to introduce the required contrast for automated counting, 2,3,5-triphenyl-2H-tetrazolium chloride (TTC) dye was added to Todd-Hewitt broth with yeast extract (THY) agar. Growth on THY agar with TTC was compared with growth on blood agar and THY agar to ensure the dye was not detrimental to bacterial growth. Automated colony counts using a ProtoCOL 3 instrument were compared with manual counting to confirm accuracy over the stages of the growth cycle (latent, mid-log and stationary phases) and in a number of different assays. The average percentage differences between plating and counting methods were analysed using the Bland-Altman method. A percentage difference of ±10 % was determined as the cut-off for a critical difference between plating and counting methods. All strains measured had an average difference of less than 10 % when plated on THY agar with TTC. This consistency was also observed over all phases of the growth
Identification and expression analysis of miR-144-5p and miR-130b-5p in dairy cattle
Directory of Open Access Journals (Sweden)
Z. Li
2017-07-01
Full Text Available MicroRNAs (miRNAs can coordinate the main pathways involved in innate and adaptive immune responses by regulating gene expression. To explore the resistance to mastitis in cows, miR-144-5p and miR-130b-5p were identified in bovine mammary gland tissue and 14 potential target genes belonging to the chemokine signaling pathway, the arginine and proline metabolism pathway and the mRNA surveillance pathway were predicted. Subsequently, we estimated the relative expression of miR-144-5p and miR-130b-5p in cow mammary tissues by using stem-loop quantitative real-time polymerase chain reaction. The results showed that the relative expression of miR-144-5p and miR-130b-5p in the mastitis-infected mammary tissues (n = 5 was significantly downregulated 0.14-fold (p < 0. 01 and upregulated 3.34-fold (p < 0. 01, respectively, compared to healthy tissues (n = 5. Our findings reveal that miR-144-5p and miR-130b-5p may have important roles in resistance to mastitis in dairy cattle.
Unprecedentedly mild direct Pd-catalyzed arylation of oxazolo[4,5-b]pyridine
DEFF Research Database (Denmark)
Zhuravlev, Fedor
2006-01-01
Pd-catalyzed C-2 arylation of oxazolo[4,5-b]pyridine proceeds efficiently at 30 degrees C and tolerates a variety of aryl halides, including derivatized amino acids for which no racemization was observed during the reaction. Experimental evidence for facile deprotonation of oxazolo[4,5-b...
Effect of fractionated regional external beam radiotherapy on peripheral blood cell count
International Nuclear Information System (INIS)
Zachariah, B.; Jacob, S.S.; Gwede, C.; Cantor, A.; Patil, J.; Casey, L.; Zachariah, A.B.
2001-01-01
Purpose: The purpose of this study was to assess the need for obtaining weekly complete blood count (CBC) values and to identify the pattern of changes in CBC during regional conventional fractionated radiotherapy. Methods and Materials: A retrospective analysis of CBC data on 299 adult cancer patients who received definitive conventional radiotherapy to head and neck (n=95), chest (n=96), and pelvis (n=108) was performed. Temporal patterns and magnitude of change in white blood cells, neutrophils, lymphocytes, and platelets during radiotherapy were examined. Results: There were statistically significant declines in all counts, albeit not clinically significant. Notable differences between disease sites were found. The greatest weekly interval change in counts occurred during the first week of radiotherapy for all groups of patients. The mean WBC nadir values during treatment were 5.8 for head and neck, 6.8 for chest, and 5.4 for pelvis. The nadirs for all counts occurred toward the middle-to-end of radiotherapy. Lymphocytes were found to be more sensitive to radiotherapy than other leukocyte subcomponents. Conclusion: Our study suggests that weekly CBC monitoring is not necessary for all patients undergoing standard fractionated radiotherapy. Baseline blood counts may be used to determine an optimal schedule for monitoring CBCs in patients receiving conventional radiation alone. Reduced monitoring of CBC may result in significant financial savings
Evaluation of bias and variance in low-count OSEM list mode reconstruction
International Nuclear Information System (INIS)
Jian, Y; Carson, R E; Planeta, B
2015-01-01
Statistical algorithms have been widely used in PET image reconstruction. The maximum likelihood expectation maximization reconstruction has been shown to produce bias in applications where images are reconstructed from a relatively small number of counts. In this study, image bias and variability in low-count OSEM reconstruction are investigated on images reconstructed with MOLAR (motion-compensation OSEM list-mode algorithm for resolution-recovery reconstruction) platform. A human brain ([ 11 C]AFM) and a NEMA phantom are used in the simulation and real experiments respectively, for the HRRT and Biograph mCT. Image reconstructions were repeated with different combinations of subsets and iterations. Regions of interest were defined on low-activity and high-activity regions to evaluate the bias and noise at matched effective iteration numbers (iterations × subsets). Minimal negative biases and no positive biases were found at moderate count levels and less than 5% negative bias was found using extremely low levels of counts (0.2 M NEC). At any given count level, other factors, such as subset numbers and frame-based scatter correction may introduce small biases (1–5%) in the reconstructed images. The observed bias was substantially lower than that reported in the literature, perhaps due to the use of point spread function and/or other implementation methods in MOLAR. (paper)
The distinct role of strand-specific miR-514b-3p and miR-514b-5p in colorectal cancer metastasis.
Ren, Lin-Lin; Yan, Ting-Ting; Shen, Chao-Qin; Tang, Jia-Yin; Kong, Xuan; Wang, Ying-Chao; Chen, Jinxian; Liu, Qiang; He, Jie; Zhong, Ming; Chen, Hao-Yan; Hong, Jie; Fang, Jing-Yuan
2018-06-07
The abnormal expression of microRNAs (miRNAs) in colorectal cancer (CRC) progression has been widely investigated. It was reported that the same hairpin RNA structure could generate mature products from each strand, termed 5p and 3p, which binds different target mRNAs. Here, we explored the expression, functions, and mechanisms of miR-514b-3p and miR-514b-5p in CRC cells and tissues. We found that miR-514b-3p was significantly down-regulated in CRC samples, and the ratio of miR-514b-3p/miR-514b-5p increased from advanced CRC, early CRC to matched normal colorectal tissues. Follow-up functional experiments illustrated that miR-514b-3p and miR-514b-5p had distinct effects through interacting with different target genes: MiR-514b-3p reduced CRC cell migration, invasion and drug resistance through increasing epithelial marker and decreasing mesenchymal marker expressions, conversely, miR-514b-5p exerted its pro-metastatic properties in CRC by promoting EMT progression. MiR-514b-3p overexpressing CRC cells developed tumors more slowly in mice compared with control cells, however, miR-514b-5p accelerated tumor metastasis. Overall, our data indicated that though miR-514b-3p and miR-514b-5p were transcribed from the same RNA hairpin, each microRNA has distinct effect on CRC metastasis.
[Reactivation of parvovirus B19 infection in an HIV-infected woman].
Sterpu, R; Ichou, H; Mahé, I; Mortier, E
2014-06-01
Infection by human parvovirus B19 (erythrovirus B19) is common and usually asymptomatic during childhood conferring lasting protection against a new infection. Parvovirus B19 infection may cause erythema infectiosum (5th disease) and aplastic crisis. Secondary symptomatic parvovirus B19 infection in the same patient is rare and its physiopathology is not always clear. A 48-year-old HIV-infected female patient presented within 5 years two acute episodes of parvovirus B19 infection although her CD4 cells count was above 500/mm(3). Absence of specific antibodies production after the first episode and persisting parvovirus viremia suggested viral reactivation rather than re-infection. During the second episode, specific antibodies were produced. Similarly to most DNA viruses, parvovirus B19 reactivation is possible in HIV-infected patients while effectively treated by antiretroviral therapy. Copyright © 2013 Société nationale française de médecine interne (SNFMI). Published by Elsevier SAS. All rights reserved.
Bayesian analysis of energy and count rate data for detection of low count rate radioactive sources.
Klumpp, John; Brandl, Alexander
2015-03-01
A particle counting and detection system is proposed that searches for elevated count rates in multiple energy regions simultaneously. The system analyzes time-interval data (e.g., time between counts), as this was shown to be a more sensitive technique for detecting low count rate sources compared to analyzing counts per unit interval (Luo et al. 2013). Two distinct versions of the detection system are developed. The first is intended for situations in which the sample is fixed and can be measured for an unlimited amount of time. The second version is intended to detect sources that are physically moving relative to the detector, such as a truck moving past a fixed roadside detector or a waste storage facility under an airplane. In both cases, the detection system is expected to be active indefinitely; i.e., it is an online detection system. Both versions of the multi-energy detection systems are compared to their respective gross count rate detection systems in terms of Type I and Type II error rates and sensitivity.
Conceptual design of the 7 megawatt Mod-5B wind turbine generator
Douglas, R. R.
1982-01-01
Similar to MOD-2, the MOD-5B wind turbine generator system is designed for the sole purpose of providing electrical power for distribution by a major utility network. The objectives of the MOD-2 and MOD-5B programs are essentially identical with one important exception; the cost-of-electricity (COE) target is reduced from 4 cent/Kwhr on MOD-2 to 3 cent/Kwhr on MOD-5B, based on mid 1977 dollars and large quantity production. The MOD-5B concept studies and eventual concept selection confirmed that the program COE targets could not only be achieved but substantially bettered. Starting from the established MOD-2 technology as a base, this achievement resulted from a combination of concept changes, size changes, and design refinements. The result of this effort is a wind turbine system that can compete with conventional power generation over significant geographical areas, increasing commercial market potential by an order of magnitude.
A counting silicon microstrip detector for precision compton polarimetry
Doll, D W; Hillert, W; Krüger, H; Stammschroer, K; Wermes, N
2002-01-01
A detector for the detection of laser photons backscattered off an incident high-energy electron beam for precision Compton polarimetry in the 3.5 GeV electron stretcher ring ELSA at Bonn University has been developed using individual photon counting. The photon counting detector is based on a silicon microstrip detector system using dedicated ASIC chips. The produced hits by the pair converted Compton photons are accumulated rather than individually read out. A transverse profile displacement can be measured with mu m accuracy rendering a polarization measurement of the order of 1% on the time scale of 10-15 min possible.
Directory of Open Access Journals (Sweden)
I. I. Arief
2013-08-01
Full Text Available Bacteriocins produced by Indonesian lactic acid bacteria Lactobacillus plantarum IIA-1A5, IIA-1B1, IIA-2B2 were purified and characterized. Plantaricin W gene had been successfully amplified from all strains. This amplicon showed the expected 200 bp size of plantaricin W gene. This bacteriocins purified from L. plantarum IIA-1A5, IIA-1B1, and IIA-2B2 were named plantaricin IIA-1A5, IIA-1B1, and IIA-2B2. Purification by cation exchange chromatography increased the purity (fold and activity of plantaricins. Purity of plantaricin IIA-1A5 was increased by 3.13 fold with specific activity 13.40 AU/mg. Plantaricin IIA-1B1 had 2.98 fold purity with specific activity 5.12 AU/mg, while purity of plantaricin IIA-2B2 was 1.37 fold with specific activity 7.70 AU/mg. All plantaricins could inhibit the growth of pathogenic bacteria, such as Escherichia coli, Salmonella typhimurium, Bacillus cereus, and Staphylococcus aureus. Plantaricins could be digested by trypsin. Stability of plantaricins at 80 oC for 30 min and at 121 oC for 15 min were affected by type of plantaricin and species of pathogenic bacteria. Generally, plantaricin IIA-1A5 was better as antimicrobial agent than plantaricin IIA-1B1 and plantaricin IIA-2B2.
The impact of finger counting habits on arithmetic in adults and children.
Newman, Sharlene D; Soylu, Firat
2014-07-01
Here, we explored the impact of finger counting habits on arithmetic in both adults and children. Two groups of participants were examined, those that begin counting with their left hand (left-starters) and those that begin counting with their right hand (right-starters). For the adults, performance on an addition task in which participants added 2 two-digit numbers was compared. The results revealed that left-starters were slower than right-starters when adding and they had lower forward and backward digit-span scores. The children (aged 5-12) showed similar results on a single-digit timed addition task-right-starters outperformed left-starters. However, the children did not reveal differences in working memory or verbal and non-verbal intelligence as a function of finger counting habit. We argue that the motor act of finger counting influences how number is represented and suggest that left-starters may have a more bilateral representation that accounts for the slower processing.
Data of evolutionary structure change: 1CG5B-2QU0C [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 0 C 2QU0C DLHAHKLRVDPence>...0 C 2QU0C FPHFD--LSHGSence...1CG5B-2QU0C 1CG5 2QU0 B C VKLSEDQEHYIKGVWKDVD--HKQITAKALERVFVVYPW... 1CG5 B 1CG5B ence>WKDVD--HKQIT... 384 THR CA 441 2QU0 C 2QU
Data of evolutionary structure change: 1CG5B-2QU0A [Confc[Archive
Lifescience Database Archive (English)
Full Text Available Chain>A 2QU0A ence>AWGKVGGNAGAYence> 2QU0 A 2QU0A ence>DLHAHKLRVDP...0 A 2QU0A ence>YFPHF--DLSHG...1CG5B-2QU0A 1CG5 2QU0 B A VKLSEDQEHYIKGVWKDV--DHKQITAKALERVFVVYPW...dex>0 1CG5 B 1CG5B
Minásbate Equivalents of Mathematical Concepts: Their Socio-Cultural Undertones
Balbuena, Sherwin E.; Cantoria, Uranus E.; Cantoria, Amancio L., Jr.; Ferriol, Eny B.
2015-01-01
This paper presents the collection and analysis of Minásbate equivalents of some concepts used in the study of arithmetic, counting, and geometry as provided by the elderly residents of the province of Masbate. The glossary of mathematical terms derived from interviews would serve as an authoritative reference for mother tongue teachers in the…
Characterization of spectrometric photon-counting X-ray detectors at different pitches
Jurdit, M.; Brambilla, A.; Moulin, V.; Ouvrier-Buffet, P.; Radisson, P.; Verger, L.
2017-09-01
There is growing interest in energy-sensitive photon-counting detectors based on high flux X-ray imaging. Their potential applications include medical imaging, non-destructive testing and security. Innovative detectors of this type will need to count individual photons and sort them into selected energy bins, at several million counts per second and per mm2. Cd(Zn)Te detector grade materials with a thickness of 1.5 to 3 mm and pitches from 800 μm down to 200 μm were assembled onto interposer boards. These devices were tested using in-house-developed full-digital fast readout electronics. The 16-channel demonstrators, with 256 energy bins, were experimentally characterized by determining spectral resolution, count rate, and charge sharing, which becomes challenging at low pitch. Charge sharing correction was found to efficiently correct X-ray spectra up to 40 × 106 incident photons.s-1.mm-2.
Energy Technology Data Exchange (ETDEWEB)
Soeker, H [Deutsches Windenergie-Institut (Germany)
1996-09-01
As state of the art method the rainflow counting technique is presently applied everywhere in fatigue analysis. However, the author feels that the potential of the technique is not fully recognized in wind energy industries as it is used, most of the times, as a mere data reduction technique disregarding some of the inherent information of the rainflow counting results. The ideas described in the following aim at exploitation of this information and making it available for use in the design and verification process. (au)
Energy Technology Data Exchange (ETDEWEB)
Schuetz, Helmut; Bringezu, Stefan [Wuppertal Institut fuer Klima, Umwelt, Energie GmbH, Wuppertal (Germany). Forschungsgruppe 3: Stoffstroeme und Ressourcenmanagement
2008-02-15
The goals of the reported study are: - to prepare a glossary on the term ''Resources'' in order to support communication based on a harmonised resource term and associated terms and - to provide key data on resource use in Germany in time series since 1991 up to the most recent year for which data were available (2004 in general), and to attribute results to the resource terms. Results achieved are presented and discussed below by the following sections: Provision of a glossary on the term ''resource'', use of the term ''resource'' at different levels, and provision of data and derived indicators for resource consumption in time series. First, a list of the relevant publications in the topic field ''resources'' was provided and co-ordinated with the client. This publication list is given in the annex to this report. On basis of national and international sources a glossary was provided which clearly describes and comments the resource term, its sub-terms and associated terms. This glossary is in the annex to this report. (orig.)
Radon counting statistics - a Monte Carlo investigation
International Nuclear Information System (INIS)
Scott, A.G.
1996-01-01
Radioactive decay is a Poisson process, and so the Coefficient of Variation (COV) of open-quotes nclose quotes counts of a single nuclide is usually estimated as 1/√n. This is only true if the count duration is much shorter than the half-life of the nuclide. At longer count durations, the COV is smaller than the Poisson estimate. Most radon measurement methods count the alpha decays of 222 Rn, plus the progeny 218 Po and 214 Po, and estimate the 222 Rn activity from the sum of the counts. At long count durations, the chain decay of these nuclides means that every 222 Rn decay must be followed by two other alpha decays. The total number of decays is open-quotes 3Nclose quotes, where N is the number of radon decays, and the true COV of the radon concentration estimate is 1/√(N), √3 larger than the Poisson total count estimate of 1/√3N. Most count periods are comparable to the half lives of the progeny, so the relationship between COV and count time is complex. A Monte-Carlo estimate of the ratio of true COV to Poisson estimate was carried out for a range of count periods from 1 min to 16 h and three common radon measurement methods: liquid scintillation, scintillation cell, and electrostatic precipitation of progeny. The Poisson approximation underestimates COV by less than 20% for count durations of less than 60 min
Hanford whole body counting manual
International Nuclear Information System (INIS)
Palmer, H.E.; Rieksts, G.A.; Lynch, T.P.
1990-06-01
This document describes the Hanford Whole Body Counting Program as it is administered by Pacific Northwest Laboratory (PNL) in support of the US Department of Energy--Richland Operations Office (DOE-RL) and its Hanford contractors. Program services include providing in vivo measurements of internally deposited radioactivity in Hanford employees (or visitors). Specific chapters of this manual deal with the following subjects: program operational charter, authority, administration, and practices, including interpreting applicable DOE Orders, regulations, and guidance into criteria for in vivo measurement frequency, etc., for the plant-wide whole body counting services; state-of-the-art facilities and equipment used to provide the best in vivo measurement results possible for the approximately 11,000 measurements made annually; procedures for performing the various in vivo measurements at the Whole Body Counter (WBC) and related facilities including whole body counts; operation and maintenance of counting equipment, quality assurance provisions of the program, WBC data processing functions, statistical aspects of in vivo measurements, and whole body counting records and associated guidance documents. 16 refs., 48 figs., 22 tabs
Quality control methods in accelerometer data processing: identifying extreme counts.
Directory of Open Access Journals (Sweden)
Carly Rich
Full Text Available Accelerometers are designed to measure plausible human activity, however extremely high count values (EHCV have been recorded in large-scale studies. Using population data, we develop methodological principles for establishing an EHCV threshold, propose a threshold to define EHCV in the ActiGraph GT1M, determine occurrences of EHCV in a large-scale study, identify device-specific error values, and investigate the influence of varying EHCV thresholds on daily vigorous PA (VPA.We estimated quantiles to analyse the distribution of all accelerometer positive count values obtained from 9005 seven-year old children participating in the UK Millennium Cohort Study. A threshold to identify EHCV was derived by differentiating the quantile function. Data were screened for device-specific error count values and EHCV, and a sensitivity analysis conducted to compare daily VPA estimates using three approaches to accounting for EHCV.Using our proposed threshold of ≥ 11,715 counts/minute to identify EHCV, we found that only 0.7% of all non-zero counts measured in MCS children were EHCV; in 99.7% of these children, EHCV comprised < 1% of total non-zero counts. Only 11 MCS children (0.12% of sample returned accelerometers that contained negative counts; out of 237 such values, 211 counts were equal to -32,768 in one child. The medians of daily minutes spent in VPA obtained without excluding EHCV, and when using a higher threshold (≥19,442 counts/minute were, respectively, 6.2% and 4.6% higher than when using our threshold (6.5 minutes; p<0.0001.Quality control processes should be undertaken during accelerometer fieldwork and prior to analysing data to identify monitors recording error values and EHCV. The proposed threshold will improve the validity of VPA estimates in children's studies using the ActiGraph GT1M by ensuring only plausible data are analysed. These methods can be applied to define appropriate EHCV thresholds for different accelerometer models.
Energy Technology Data Exchange (ETDEWEB)
Aziz, N H; Shahin, A A.M.; Mahrous, S R [National Centre for Radiation Research and Technology, Nasr City, Cairo (Egypt); El-Far, F M [Animal Health Research Institute, Dokki, Giza (Egypt)
2007-07-01
The distribution of naturally occurring Fusarium moulds producing fumonisin B1 in seeds was determined. Fusarium infection of grain samples ranged from 10 to 60% and F.moniliforme was the predominant species. Fusarium counts in wheat grains were 8.1 x 10{sup 4} cfu/g, 6.3 x 10{sup 6} cfu/g in maize and 4.8 x 10{sup 3} cfu/g in barley. Wheat, maize and barley grains naturally contaminated with varying levels of fumonisin B1 (1.4 - 5.8, 8.0 - 13.8 and 0.1 - 0.5 {mu}g/g, respectively). Fusarium moniliforme and F. proliferatum were the major Fusarium contaminants producing fumonisin B1 . The effect of gamma irradiation on Fusarium moulds and levels of fumonisin B1 were also determined. The viable counts of Fusarium in grains was decreased by increasing the radiation dose levels, and the growth of Fusarium spp was inhibited at 4.0 KGy for barley and 6.0 KGy for wheat and maize. Application of gamma radiation dose at 5 KGy inactivated fumonisin B1 by 96.6, 87.1 and 100% for wheat, maize and barley, respectively, and a dose of 7 KGy was sufficient for complete destruction of fumonisin B1 in wheat and maize.
International Nuclear Information System (INIS)
Aziz, N.H.; Shahin, A.A.M.; Mahrous, S.R.; El-Far, F.M.
2007-01-01
The distribution of naturally occurring Fusarium moulds producing fumonisin B1 in seeds was determined. Fusarium infection of grain samples ranged from 10 to 60% and F.moniliforme was the predominant species. Fusarium counts in wheat grains were 8.1 x 10 4 cfu/g, 6.3 x 10 6 cfu/g in maize and 4.8 x 10 3 cfu/g in barley. Wheat, maize and barley grains naturally contaminated with varying levels of fumonisin B1 (1.4 - 5.8, 8.0 - 13.8 and 0.1 - 0.5 μg/g, respectively). Fusarium moniliforme and F. proliferatum were the major Fusarium contaminants producing fumonisin B1 . The effect of gamma irradiation on Fusarium moulds and levels of fumonisin B1 were also determined. The viable counts of Fusarium in grains was decreased by increasing the radiation dose levels, and the growth of Fusarium spp was inhibited at 4.0 KGy for barley and 6.0 KGy for wheat and maize. Application of gamma radiation dose at 5 KGy inactivated fumonisin B1 by 96.6, 87.1 and 100% for wheat, maize and barley, respectively, and a dose of 7 KGy was sufficient for complete destruction of fumonisin B1 in wheat and maize
Platelet Count and Plateletcrit
African Journals Online (AJOL)
strated that neonates with late onset sepsis (bacteremia after 3 days of age) had a dramatic increase in MPV and. PDW18. We hypothesize that as the MPV and PDW increase and platelet count and PCT decrease in sick children, intui- tively, the ratio of MPV to PCT; MPV to Platelet count,. PDW to PCT, PDW to platelet ...
Leiva, Josue Nahun; Robbins, James; Saraswat, Dharmendra; She, Ying; Ehsani, Reza
2017-07-01
This study evaluated the effect of flight altitude and canopy separation of container-grown Fire Chief™ arborvitae (Thuja occidentalis L.) on counting accuracy. Images were taken at 6, 12, and 22 m above the ground using unmanned aircraft systems. Plants were spaced to achieve three canopy separation treatments: 5 cm between canopy edges, canopy edges touching, and 5 cm of canopy edge overlap. Plants were placed on two different ground covers: black fabric and gravel. A counting algorithm was trained using Feature Analyst®. Total counting error, false positives, and unidentified plants were reported for images analyzed. In general, total counting error was smaller when plants were fully separated. The effect of ground cover on counting accuracy varied with the counting algorithm. Total counting error for plants placed on gravel (-8) was larger than for those on a black fabric (-2), however, false positive counts were similar for black fabric (6) and gravel (6). Nevertheless, output images of plants placed on gravel did not show a negative effect due to the ground cover but was impacted by differences in image spatial resolution.
Directory of Open Access Journals (Sweden)
Rahul J Hegde
2017-01-01
Full Text Available Background: Compounds present in green tea have been shown to inhibit the growth and activity of bacteria associated with oral infections. The purpose of this study was to compare the efficacy of chlorhexidine (0.12% mouth rinse and combination (chlorhexidine and sodium fluoride mouth rinse to that of green tea extract (0.5% mouth rinse in reducing the salivary count of Streptococcus mutans and Lactobacillus in children. Materials and Methods: The sample for the study consisted of 75 school children aged 8–12 years with four or more (decay component of decayed, missing, and filled teeth index. Children were divided randomly into three equal groups and were asked to rinse with the prescribed mouth rinse once daily for 2 weeks after breakfast under supervision. Nonstimulated whole salivary sample (2 ml was collected at baseline and postrinsing and tested for the colony forming units of S. mutans and Lactobacillus. Results: The results of the study indicate that there was a statistically significant reduction in S. mutans and lactobacilli count in all the three study groups. The statistically significant reduction in the mean S. mutans and lactobacilli counts were more in 0.12% chlorhexidine group than in the combination mouth rinse and 0.5% green tea mouth rinse group. There was no statistically significant difference in the reduction of S. mutans and lactobacilli count between combination mouth rinse group and 0.5% green tea mouth rinse group. Conclusion: Green tea mouth rinse can be a promising preventive therapy worldwide for the prevention of dental caries.
An Adaptive Smoother for Counting Measurements
International Nuclear Information System (INIS)
Kondrasovs Vladimir; Coulon Romain; Normand Stephane
2013-06-01
Counting measurements associated with nuclear instruments are tricky to carry out due to the stochastic process of the radioactivity. Indeed events counting have to be processed and filtered in order to display a stable count rate value and to allow variations monitoring in the measured activity. Smoothers (as the moving average) are adjusted by a time constant defined as a compromise between stability and response time. A new approach has been developed and consists in improving the response time while maintaining count rate stability. It uses the combination of a smoother together with a detection filter. A memory of counting data is processed to calculate several count rate estimates using several integration times. These estimates are then sorted into the memory from short to long integration times. A measurement position, in terms of integration time, is then chosen into this memory after a detection test. An inhomogeneity into the Poisson counting process is detected by comparison between current position estimate and the other estimates contained into the memory in respect with the associated statistical variance calculated with homogeneous assumption. The measurement position (historical time) and the ability to forget an obsolete data or to keep in memory a useful data are managed using the detection test result. The proposed smoother is then an adaptive and a learning algorithm allowing an optimization of the response time while maintaining measurement counting stability and converging efficiently to the best counting estimate after an effective change in activity. This algorithm has also the specificity to be low recursive and thus easily embedded into DSP electronics based on FPGA or micro-controllers meeting 'real life' time requirements. (authors)
Energy Technology Data Exchange (ETDEWEB)
Yuan, Fang; Forbes, Scott [Department of Chemistry and Chemical Biology, McMaster University, 1280 Main Street West, Hamilton, Ontario L8S 4M1 (Canada); Ramachandran, Krishna Kumar [Department of Chemistry, University of Alberta, Edmonton, Alberta T6G 2G2 (Canada); Mozharivskyj, Yurij, E-mail: mozhar@mcmaster.ca [Department of Chemistry and Chemical Biology, McMaster University, 1280 Main Street West, Hamilton, Ontario L8S 4M1 (Canada)
2015-11-25
The Cr{sub 5}B{sub 3}-type Ta{sub 5}Si{sub 3} phase was prepared by arc-melting, while the Cr{sub 5}B{sub 3}-type Ta{sub 5}Ge{sub 3} one was synthesized through sintering at 1000 °C. X-ray single crystal diffraction was employed to elucidate their structure. According to the magnetization measurements, both Ta{sub 5}Si{sub 3} and Ta{sub 5}Ge{sub 3} are Pauli paramagnets, with Ta{sub 5}Ge{sub 3} showing a Curie-Weiss-like paramagnetic behavior at low temperatures likely due to presence of paramagnetic impurity. Both Ta{sub 5}Si{sub 3} and Ta{sub 5}Ge{sub 3} display a very low electrical resistivity from 2 to 300 K. The resistivity is constant below 20 K, but displays a positive temperature coefficient above 20 K. Electronic structure calculations with the TB-LMTO-ASA method support the metallic character of the two phases and suggest that the bonding is optimized in both phases. - Highlights: • Synthesis of Cr{sub 5}B{sub 3}-type Ta{sub 5}Si{sub 3} and Ta{sub 5}Ge{sub 3} phases with high purity by arc-melting and sintering, respectively. • Magnetization data and electrical resistivity of the Cr{sub 5}B{sub 3}-type Ta{sub 5}Si{sub 3} and Ta{sub 5}Ge{sub 3} phases. • Crystal and electronic structure analysis for Ta{sub 5}Si{sub 3} and Ta{sub 5}Ge{sub 3} phase by X-ray diffraction and TB-LMTO-ASA calculations.
Neiner, Doinita; Sevryugina, Yulia V; Schubert, David M
2016-09-06
The compound known since the 19th century as ammonium octaborate was structurally characterized revealing the ammonium salt of the ribbon isomer of the heptaborate anion, [B7O9(OH)5](2-), with boric acid and water molecules. Of composition (NH4)2B7.75O12.63·4.88H2O, it approximates the classical ammonium octaborate composition (NH4)2B8O13·6H2O and has the structural formula {(NH4)2[B7O9(OH)5]}4·3B(OH)3·5H2O. It spontaneously forms at room temperature in solid-state mixtures of ammonium tetraborate and ammonium pentaborate. It crystallizes in the monoclinic space group P21/c with a = 11.4137(2) Å, b = 11.8877(2) Å, c = 23.4459(3) Å, β = 90.092(1)°, V = 3181.19(8) Å(3), and Z = 2 and contains well-ordered ammonium cations and [B7O9(OH)5](2-) anions and disordered B(OH)3 and H2O molecules linked by extensive H bonding. Expeditious solid-state formation of the heptaborate anion under ambient conditions has important implications for development of practical syntheses of industrially useful borates.
The new silver borate Ag{sub 3}B{sub 5}O{sub 9}
Energy Technology Data Exchange (ETDEWEB)
Sohr, Gerhard; Falkowski, Viktoria; Huppertz, Hubert, E-mail: hubert.huppertz@uibk.ac.at
2015-05-15
Single crystals of Ag{sub 3}B{sub 5}O{sub 9} were obtained via high-pressure synthesis at 3 GPa and 600 °C, using a Walker-type multianvil high-pressure device. Ag{sub 3}B{sub 5}O{sub 9} crystalizes with a=674.7(2), b=943.5(2), c=1103.5(2) pm, V=0.7025(2) nm{sup 3}, and Z=4 in the noncentrosymmetric space group P2{sub 1}2{sub 1}2{sub 1} (no. 19). The orthorhombic structure was refined from 3740 independent reflections with R1=0.0496 and wR2=0.587 (all data). It is built up from infinite corner-sharing chains of BO{sub 4} tetrahedra along the a axis, which are interconnected by BO{sub 3} groups to form a network. In the structure, three crystallographically independent sites are occupied with Ag{sup +} cations exhibiting argentophillic interactions. The synthetic conditions as well as the results of the single crystal structure analysis are presented. - Graphical abstract: Noncentrosymmetric silver borate: During investigations in the system Ag–B–O, a new noncentrosymmetric silver borate Ag{sub 3}B{sub 5}O{sub 9} was discovered. The new structure type is built up from corner-sharing BO{sub 3} and BO{sub 4} groups, forming a network. Argentophillic interactions are clearly indicated by the Ag{sup +}⋯Ag{sup +} distances present in the structure. - Highlights: • A noncentrosymmetric borate Ag{sub 3}B{sub 5}O{sub 9} is accessible via high-pressure synthesis. • Ag{sub 3}B{sub 5}O{sub 9} is the second high-pressure silver borate. • Ag{sup +}⋯Ag{sup +} distances in Ag3B5O9 clearly indicate the presence of argentophillic interactions.
International Nuclear Information System (INIS)
Matsumoto, Haruya; Kaya, Nobuyuki; Yuasa, Kazuhiro; Hayashi, Tomoaki
1976-01-01
Electron counting method has been devised and experimented for the purpose of measuring electron temperature and density, the most fundamental quantities to represent plasma conditions. Electron counting is a method to count the electrons in plasma directly by equipping a probe with the secondary electron multiplier. It has three advantages of adjustable sensitivity, high sensitivity of the secondary electron multiplier, and directional property. Sensitivity adjustment is performed by changing the size of collecting hole (pin hole) on the incident front of the multiplier. The probe is usable as a direct reading thermometer of electron temperature because it requires to collect very small amount of electrons, thus it doesn't disturb the surrounding plasma, and the narrow sweep width of the probe voltage is enough. Therefore it can measure anisotropy more sensitively than a Langmuir probe, and it can be used for very low density plasma. Though many problems remain on anisotropy, computer simulation has been carried out. Also it is planned to provide a Helmholtz coil in the vacuum chamber to eliminate the effect of earth magnetic field. In practical experiments, the measurement with a Langmuir probe and an emission probe mounted to the movable structure, the comparison with the results obtained in reverse magnetic field by using a Helmholtz coil, and the measurement of ionic sound wave are scheduled. (Wakatsuki, Y.)
A mind you can count on: validating breath counting as a behavioral measure of mindfulness
Directory of Open Access Journals (Sweden)
Daniel B Levinson
2014-10-01
Full Text Available Mindfulness practice of present moment awareness promises many benefits, but has eluded rigorous behavioral measurement. To date, research has relied on self-reported mindfulness or heterogeneous mindfulness trainings to infer skillful mindfulness practice and its effects. In four independent studies with over 400 total participants, we present the first construct validation of a behavioral measure of mindfulness, breath counting. We found it was reliable, correlated with self-reported mindfulness, differentiated long-term meditators from age-matched controls, and was distinct from sustained attention and working memory measures. In addition, we employed breath counting to test the nomological network of mindfulness. As theorized, we found skill in breath counting associated with more meta-awareness, less mind wandering, better mood, and greater nonattachment (i.e. less attentional capture by distractors formerly paired with reward. We also found in a randomized online training study that 4 weeks of breath counting training improved mindfulness and decreased mind wandering relative to working memory training and no training controls. Together, these findings provide the first evidence for breath counting as a behavioral measure of mindfulness.
Crystal structures of the solid solutions Na3Zn0.912Cd0.088B5O10 and Na3Zn0.845Mg0.155B5O10
Directory of Open Access Journals (Sweden)
Xue-An Chen
2017-11-01
Full Text Available Two new pentaborates, trisodium zinc cadmium pentaborate, Na3Zn0.912Cd0.088B5O10, and trisodium zinc magnesium pentaborate, Na3Zn0.845Mg0.155B5O10, have been synthesized by high-temperature solution reactions at 1023 K. Their crystal structures were determined by single-crystal X-ray diffraction. Both solid solutions crystallize in the orthorhombic form of the parent compound Na3ZnB5O10 (space group type Pbca, Z = 8 and contain the double ring [B5O10]5− anion composed of one BO4 tetrahedron and four BO3 triangles as the basic structural motif. The anions are bridged by tetrahedrally coordinated and occupationally disordered M2+ (M = Zn/Cd, Zn/Mg cations via common O atoms to form [MB5O10]n3n− layers. The intralayer intersecting channels and the interlayer voids are occupied by Na+ cations to balance the charge.
Coatings synthesised by the pulsed laser ablation of a B{sub 4}C/W{sub 2}B{sub 5} ceramic composite
Energy Technology Data Exchange (ETDEWEB)
Tadadjeu Sokeng, I., E-mail: ifriky@tlabs.ac.za [Department of Electrical, Electronics and Computer Engineering, French South African Institute of Technology/Cape Peninsula University of Technology, Bellville campus, PO Box 1906, Bellville, 7530 (South Africa); Nanosciences African Network (NANOAFNET), iThemba LABS-National Research Foundation, 1 Old Faure Road, 7129, PO Box 722, Somerset West, Western Cape Province (South Africa); UNESCO-UNISA Africa Chair in Nanosciences/Nanotechnology, College of Graduate Studies, University of South Africa (UNISA), Muckleneuk Ridge, PO Box 392, Pretoria (South Africa); Ngom, B.D. [Nanosciences African Network (NANOAFNET), iThemba LABS-National Research Foundation, 1 Old Faure Road, 7129, PO Box 722, Somerset West, Western Cape Province (South Africa); UNESCO-UNISA Africa Chair in Nanosciences/Nanotechnology, College of Graduate Studies, University of South Africa (UNISA), Muckleneuk Ridge, PO Box 392, Pretoria (South Africa); Laboratoire de Photonique et de Nanofrabrication, Groupes de physique du Solide et Sciences des Matriaux (GPSSM), Facult des sciences et Techniques Universit Cheikh Anta Diop de Dakar (UCAD), B.P. 25114 Dakar, Fann Dakar (Senegal); Msimanga, M. [iThemba LABS Gauten, Private Bag 11, WITS 2050 Johannesburg (South Africa); Nuru, Z.Y.; Kotsedi, L.; Maaza, M. [Nanosciences African Network (NANOAFNET), iThemba LABS-National Research Foundation, 1 Old Faure Road, 7129, PO Box 722, Somerset West, Western Cape Province (South Africa); UNESCO-UNISA Africa Chair in Nanosciences/Nanotechnology, College of Graduate Studies, University of South Africa (UNISA), Muckleneuk Ridge, PO Box 392, Pretoria (South Africa); Van Zyl, R.R. [Department of Electrical, Electronics and Computer Engineering, French South African Institute of Technology/Cape Peninsula University of Technology, Bellville campus, PO Box 1906, Bellville, 7530 (South Africa)
2015-10-30
A pellet of B{sub 4}C/W{sub 2}B{sub 5} ceramic composite was characterised and subjected to pulsed laser ablation for the deposition of coatings on corning glass substrates. We reports an attempt to produce coatings from B{sub 4}C/W{sub 2}B{sub 5} by pulsed laser deposition (PLD). The thermal, electric and mechanical properties of B{sub 4}C/W{sub 2}B{sub 5} suggest that coatings synthesised from this composite can be used for space applications. The samples were characterised using X-ray Diffraction, Atomic Force Microscopy and Heavy Ion Elastic Recoil Detection Analysis. The characterisation of the samples deposited on soda lime corning glass showed that the laser energy used in this PLD was enough to obtain non amorphous coatings formed by some alteration of the tungsten carbide crystal lattice at room temperature, and that there was no stoichiometry transfer as would be expected from PLD. The coating also showed space applicable features worth investigating. - Highlights: • B{sub 4}C/W{sub 2}B{sub 5} ceramic composite was ablated for deposition on corning glass subtrates. • Non-amorphous coating was obtained at room temperature. • There was no stoichiometry transfer as would be expected from Pulsed Laser Deposition.
Khatri, Bhupendra O; Garland, Jeffery; Berger, Joseph; Kramer, John; Sershon, Lisa; Olapo, Tayo; Sesing, Jean; Dukic, Mary; Rehn, Eileen
2015-07-01
Dimethyl fumarate (Tecfidera™) is an effective therapy for relapsing forms of multiple sclerosis (MS). Our study suggests that this drug may have immunosuppressive properties evidenced by significant sustained reduction in CD8 lymphocyte counts and, to a lesser extent, CD4 lymphocyte counts. This observation is relevant in light of the recent case of progressive multifocal leukoencephalopathy in a patient receiving this drug. Copyright © 2015. Published by Elsevier B.V.
Counting graphene layers with very slow electrons
Czech Academy of Sciences Publication Activity Database
Frank, Luděk; Mikmeková, Eliška; Müllerová, Ilona; Lejeune, M.
2015-01-01
Roč. 106, 09 JAN (2015), 013117:1-5 ISSN 0003-6951 R&D Projects: GA TA ČR(CZ) TE01020118; GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : graphene * ultralow energy STEM * counting graphene layers * clean ing of graphene * 2D crystals Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 3.142, year: 2015
Principles of correlation counting
International Nuclear Information System (INIS)
Mueller, J.W.
1975-01-01
A review is given of the various applications which have been made of correlation techniques in the field of nuclear physics, in particular for absolute counting. Whereas in most cases the usual coincidence method will be preferable for its simplicity, correlation counting may be the only possible approach in such cases where the two radiations of the cascade cannot be well separated or when there is a longliving intermediate state. The measurement of half-lives and of count rates of spurious pulses is also briefly discussed. The various experimental situations lead to different ways the correlation method is best applied (covariance technique with one or with two detectors, application of correlation functions, etc.). Formulae are given for some simple model cases, neglecting dead-time corrections
5-Methyl-4-oxo-4,6-dihydro-3H-pyridazino[4,5-b]carbazole-1-carbonitrile
Directory of Open Access Journals (Sweden)
Norbert Haider
2010-02-01
Full Text Available The title compound was prepared in excellent yield from 5-methyl-4-oxo-4,6-dihydro-3H-pyridazino[4,5-b]carbazole-1-carbaldehyde by treatment with hydroxylamine hydrochloride in formic acid without isolation of the intermediate oxime.
Data of evolutionary structure change: 1CG5B-2ZLWD [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 1CG5B-2ZLWD 1CG5 2ZLW B D VKLSEDQEHYIKGVWKDVDHKQITAKALERVFVVYPWTT.../seq1> VQLSGEEKAAVLALWDKVNEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSELHCDK...224 GLY CA 259 2ZLW D 2ZLWD...W D 2ZLWD ELHCDKLHVDP
17 CFR 240.10b-5 - Employment of manipulative and deceptive devices.
2010-04-01
... fraud or deceit upon any person, in connection with the purchase or sale of any security. (Sec. 10; 48... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Employment of manipulative and deceptive devices. 240.10b-5 Section 240.10b-5 Commodity and Securities Exchanges SECURITIES AND EXCHANGE...
Characterization of spectrometric photon-counting X-ray detectors at different pitches
International Nuclear Information System (INIS)
Jurdit, M.; Moulin, V.; Ouvrier-Buffet, P.; Verger, L.; Brambilla, A.; Radisson, P.
2017-01-01
There is growing interest in energy-sensitive photon-counting detectors based on high flux X-ray imaging. Their potential applications include medical imaging, non-destructive testing and security. Innovative detectors of this type will need to count individual photons and sort them into selected energy bins, at several million counts per second and per mm 2 . Cd(Zn)Te detector grade materials with a thickness of 1.5 to 3 mm and pitches from 800 μm down to 200 μm were assembled onto interposer boards. These devices were tested using in-house-developed full-digital fast readout electronics. The 16-channel demonstrators, with 256 energy bins, were experimentally characterized by determining spectral resolution, count rate, and charge sharing, which becomes challenging at low pitch. Charge sharing correction was found to efficiently correct X-ray spectra up to 40 × 10 6 incident photons.s −1 .mm −2 .
Energy Technology Data Exchange (ETDEWEB)
Ding, H; Molloi, S [University of California, Irvine, CA (United States)
2016-06-15
Purpose: To investigate the feasibility of optimizing the imaging parameters for contrast-enhanced spectral mammography based on Si strip photon-counting detectors. Methods: A computer simulation model using polyenergetic spectra from a tungsten anode x-ray tube and a Si-based photon-counting detector was evaluated for contrast-enhanced spectral mammography. The simulation traces the emission of photons from the x-ray source, attenuation through the breast and subsequent absorption in the detector. The breast was modeled as a mixture of adipose and mammary gland tissues with a breast density of 30%. A 4 mm iodine signal with a concentration of 4 mg/ml was used to simulate the enhancement of a lesion. Quantum efficiency of the detector was calculated based on the effective attenuation length in the Si strips. The figure-of-merit (FOM), which was defined as the decomposed iodine signal-to-noise ratio (SNR) with respect to the square root of the mean glandular dose (MGD), was chosen to optimize the imaging parameters, in terms of beam energy, splitting energy, and pre-filtrations for breast of various thicknesses and densities. Results: The optimal imaging parameters, which lead to the highest FOM, were found at a beam energy of 45 kVp with a splitting energy at 34 keV for an averaged breast thickness of 4 cm with a standard 0.75 mm Al pre-filtration. The optimal tube voltage varied slightly from 46 to 44 kVp as the breast thickness increases from 2 to 8 cm. The optimal tube voltage decreased to 42 kVp when the Al pre-filtration was increased to 3 mm. Conclusion: This simulation study predicted the optimal imaging parameters for application of photon-counting spectral mammography to contrast-enhanced imaging. The simulation results laid the ground work for future phantom and clinical studies. Grant funding from Philips Medical Systems.
Recommended data for capture cross sections in B5+ + H collisions
International Nuclear Information System (INIS)
Errea, L F; Guzman, F; Illescas, Clara; Mendez, L; Pons, B; Riera, A; Suarez, J
2006-01-01
Recommended values for state selective capture cross sections are presented for the collision B 5+ + H(1s) in the energy range from 0.05 to 1000 keV amu -1 . Special attention is focused on capture processes to n = 7 states of B 4+ , which play an important role in spectral diagnostics in fusion plasmas. In order to completely cover the intermediate impact energy domain, quantal, semi-classical and classical treatments have been employed for low, low-intermediate and intermediate-high energies, respectively. We also give some guidelines about the domain of accuracy of the methodologies employed. Additionally, preliminary cross sections of the B 5+ + H(2s) collision are also provided
C5 Extract Induces Apoptosis in B16F10 Murine Melanoma Cells ...
African Journals Online (AJOL)
Purpose: To investigate the anti-cancer activities of C5 extract (C5E), a new herbal preparation from Korea, on B16F10 cells. Methods: The anti-proliferative effects of C5E were assessed by culturing B16F10 cells in the presence or absence of C5E. Cell cycle progression was analyzed by PI staining using flow cytometry.
2012-01-01
orientation microscopy studies on a boron containing version of the commercial Ti- 5Al-5Mo-5V-3Cr-0.5Fe ( Ti5553 ) alloy. 15. SUBJECT TERMS Ti5553 ...of the commercial Ti-5Al-5Mo-5V-3Cr-0.5Fe ( Ti5553 ) alloy. Keywords: Ti5553 , TiB, EBSD, crystallography, orientation relationship. Paper There has...absence of orientation relationships between the α, β and TiB phases, on the morphology of α nucleating from TiB in the Ti5553 alloy.. The base
Fluctuations and dark count rates in superconducting NbN single-photon detectors
International Nuclear Information System (INIS)
Engel, Andreas; Semenov, Alexei; Huebers, Heinz-Wilhelm; Il'in, Kostya; Siegel, Michael
2005-01-01
We measured the temperature- and current-dependence of dark count rates of a superconducting singlephoton detector. The detector's key element is a 84 nm wide meander strip line fabricated from a 5 nm thick NbN film. Due to its reduced dimensions various types of fluctuations can cause temporal and localized transitions into a resistive state leading to dark count events. Adopting a recent refinement of the hotspot model we achieve a satisfying description of the experimental dark count rates taking into account fluctuations of the Cooper-pair density and current-assisted unbinding of vortex-antivortex pairs. (copyright 2005 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)
DC KIDS COUNT e-Databook Indicators
DC Action for Children, 2012
2012-01-01
This report presents indicators that are included in DC Action for Children's 2012 KIDS COUNT e-databook, their definitions and sources and the rationale for their selection. The indicators for DC KIDS COUNT represent a mix of traditional KIDS COUNT indicators of child well-being, such as the number of children living in poverty, and indicators of…
International Nuclear Information System (INIS)
Palmer, H.E.
1985-03-01
A state-of-the-art radiation detector system consisting of six individually mounted intrinsic germanium planar detectors, each 20 cm 2 by 13 mm thick, mounted together such that the angle of the whole system can be changed to match the slope of the chest of the person being counted, is described. The sensitivity of the system for counting uranium and plutonium in vivo and the precedures used in calibrating the system are also described. Some results of counts done on uranium mill workers are presented. 15 figs., 2 tabs
International Nuclear Information System (INIS)
Yusa, Toshikazu; Yasukawa, Tomohisa; Shioda, Hironobu; Hirai, Fumiko; Hiroshima, Kenzo; Kishimoto, Takumi
2011-01-01
This study was designed to examine the significance of pleural plaques and pulmonary fibrosis in the evaluation of asbestos exposure level. The subjects were patients who had undergone surgery for lung cancer. There were 64 patients who had pleural plaques based on surgical findings (pleural plaque group) and 9 patients who had neither a history of asbestos exposure nor pleural plaque (control group). An examination was performed regarding the extent of pleural plaques and the presence or absence of pulmonary fibrosis. The relationships between these findings and the asbestos body count in the resected lung were investigated. If chest CT showed no pleural plaque, the case was classified as class 0. If chest CT showed pleural plaques, the CT slice with the most extensive pleural plaque in either side was selected. If the plaque extended to less than one quarter of the inner chest wall, the case was classified as class 1. If the extent was one quarter or more, the case was classified as class 2. The cases were considered to have pulmonary fibrosis if the fibrotic findings were equivalent to those of asbestosis of type 1 or more by chest X-ray photography (XP) and if fibrosis was observed in CT. All other cases were considered not to have pulmonary fibrosis. The median asbestos body counts were 1,018 bodies per gram of dried lung in the pleural plaque group and 263 per gram of dried lung in the control group. There was a statistically significant difference between these groups (p=0.0034). There were 25 patients with class 0 pleural plaque, 17 patients with class 1, and 22 patients with class 2. Their median asbestos body counts were 612, 439, and 5,626 bodies, respectively. All class 0 or 1 patients had an asbestos body count of less than 5,000 bodies. There was no significant difference in the counts between patients with class 0 and 1. All class 2 patients had an asbestos body count of 1,000 bodies or more. The count of class 2 patients was significantly higher
Synthesis of Al-5Ti-1B Refiner by Melt Reaction Method
LI He; CHAI Li-hua; MA Teng-fei; CHEN Zi-yong
2017-01-01
Al-5Ti-1B refiner was successfully prepared by melt reaction method. Through the thermodynamics calculation, the initial reaction temperature was determined. The influence of reaction temperature on microstructure and absorption rate of the alloy was investigated. The phase and microstructure of the alloy were observed by X-ray diffraction, scanning electron microscope and energy dispersive spectrometer. The Al-5Ti-1B refiner was extruded at high temperature to wire with the diameter of 9.5mm...
Synthesis of Mo5SiB2 based nanocomposites by mechanical alloying and subsequent heat treatment
International Nuclear Information System (INIS)
Abbasi, A.R.; Shamanian, M.
2011-01-01
Research highlights: → α-Mo-Mo 5 SiB 2 nanocomposite was produced after 20 h milling of Mo-Si-B powders. → Heat treatment of 5 h MAed powders led to the formation of boride phases. → Heat treatment of 10 h MAed powders led to the formation of Mo 5 SiB 2 phase. → By increasing heat treatment time, quantity of Mo 5 SiB 2 phase increased. → 5 h heat treatment of 20 h MAed powders led to the formation of Mo 5 SiB 2 -based composite. - Abstract: In this study, systematic investigations were conducted on the synthesis of Mo 5 SiB 2 -based alloy by mechanical alloying and subsequent heat treatment. In this regard, Mo-12.5 mol% Si-25 mol% B powder mixture was milled for different times. Then, the mechanically alloyed powders were heat treated at 1373 K for 1 h. The phase transitions and microstructural evolutions of powder particles during mechanical alloying and heat treatment were studied by X-ray diffractometry and scanning electron microscopy. The results showed that the phase evolutions during mechanical alloying and subsequent heat treatment are strongly dependent on milling time. After 10 h of milling, a Mo solid solution was formed, but, no intermetallic phases were detected at this stage. However, an α-Mo-Mo 5 SiB 2 nanocomposite was formed after 20 h of milling. After heat treatment of 5 h mechanically alloyed powders, small amounts of MoB and Mo 2 B were detected and α-Mo-MoB-Mo 2 B composite was produced. On the other hand, heat treatment of 10 h and 20 h mechanically alloyed powders led to the formation of an α-Mo-Mo 5 SiB 2 -MoSi 2 -Mo 3 Si composite. At this point, there is a critical milling time (10 h) for the formation of Mo 5 SiB 2 phase after heat treatment wherein below that time, boride phase and after that time, Mo 5 SiB 2 phase are formed. In the case of 20 h mechanically alloyed powders, by increasing heat treatment time, not only the quantity of α-Mo was reduced and the quantity of Mo 5 SiB 2 was increased, but also new boride
The RAB2B-GARIL5 Complex Promotes Cytosolic DNA-Induced Innate Immune Responses.
Takahama, Michihiro; Fukuda, Mitsunori; Ohbayashi, Norihiko; Kozaki, Tatsuya; Misawa, Takuma; Okamoto, Toru; Matsuura, Yoshiharu; Akira, Shizuo; Saitoh, Tatsuya
2017-09-19
Cyclic GMP-AMP synthase (cGAS) is a cytosolic DNA sensor that induces the IFN antiviral response. However, the regulatory mechanisms that mediate cGAS-triggered signaling have not been fully explored. Here, we show the involvement of a small GTPase, RAB2B, and its effector protein, Golgi-associated RAB2B interactor-like 5 (GARIL5), in the cGAS-mediated IFN response. RAB2B-deficiency affects the IFN response induced by cytosolic DNA. Consistent with this, RAB2B deficiency enhances replication of vaccinia virus, a DNA virus. After DNA stimulation, RAB2B colocalizes with stimulator of interferon genes (STING), the downstream signal mediator of cGAS, on the Golgi apparatus. The GTP-binding activity of RAB2B is required for its localization on the Golgi apparatus and for recruitment of GARIL5. GARIL5 deficiency also affects the IFN response induced by cytosolic DNA and enhances replication of vaccinia virus. These findings indicate that the RAB2B-GARIL5 complex promotes IFN responses against DNA viruses by regulating the cGAS-STING signaling axis. Copyright © 2017 The Author(s). Published by Elsevier Inc. All rights reserved.
The RAB2B-GARIL5 Complex Promotes Cytosolic DNA-Induced Innate Immune Responses
Directory of Open Access Journals (Sweden)
Michihiro Takahama
2017-09-01
Full Text Available Cyclic GMP-AMP synthase (cGAS is a cytosolic DNA sensor that induces the IFN antiviral response. However, the regulatory mechanisms that mediate cGAS-triggered signaling have not been fully explored. Here, we show the involvement of a small GTPase, RAB2B, and its effector protein, Golgi-associated RAB2B interactor-like 5 (GARIL5, in the cGAS-mediated IFN response. RAB2B-deficiency affects the IFN response induced by cytosolic DNA. Consistent with this, RAB2B deficiency enhances replication of vaccinia virus, a DNA virus. After DNA stimulation, RAB2B colocalizes with stimulator of interferon genes (STING, the downstream signal mediator of cGAS, on the Golgi apparatus. The GTP-binding activity of RAB2B is required for its localization on the Golgi apparatus and for recruitment of GARIL5. GARIL5 deficiency also affects the IFN response induced by cytosolic DNA and enhances replication of vaccinia virus. These findings indicate that the RAB2B-GARIL5 complex promotes IFN responses against DNA viruses by regulating the cGAS-STING signaling axis.
Sugai, Elaine E.; Sugano, Miyoko
This document comprises the teacher's guide and lessons for teaching standard English to kindergarten through third grade children in Hilo, Hawaii. Sections are (1) Teacher's Guide, (2) Audio-Visual Aids, (3) Phonemic Symbol List, (4) Phonology Lesson Section, and (5) Structure Lesson Section. Appended are a short glossary of terms,…
Directory of Open Access Journals (Sweden)
Lopamudra Haldar
2016-07-01
Full Text Available Aim: To investigate the effect of oral administration of two Bacillus strains on fecal coliforms, Lactobacillus and Bacillus spp. in rat animal model. Materials and Methods: An in vivo experiment was conducted for 49-day period on 36 adult male albino Wister rats divided equally into to four groups. After 7-day adaptation period, one group (T1 was fed on sterile skim milk along with basal diet for the next 28 days. Second (T2 and (T3 groups received spore biomass of Bacillus coagulans B37 and Bacillus pumilus B9, respectively, suspended in sterilized skim milk at 8-9 log colony-forming units/ml plus basal diet for 28 days, while control group (T4 was supplied with clean water along with basal diet. There was a 14-day post-treatment period. A total of 288 fecal samples (8 fecal collections per rat were collected at every 7-day interval starting from 0 to 49 days and subjected to the enumeration of the counts of coliforms and lactobacilli and Bacillus spores using respective agar media. In vitro acid and bile tolerance tests on both the strains were performed. Results: The rats those (T2 and T3 received either B. coagulans B37 or B. pumilus B9 spore along with non-fermented skim milk showed decrease (p<0.01 in fecal coliform counts and increase (p<0.05 in both fecal lactobacilli and Bacillus spore counts as compared to the control group (T4 and the group fed only skim milk (T1. In vitro study indicated that both the strains were found to survive at pH 2.0 and 3.0 even up to 3 h and tolerate bile up to 2.0% concentration even after 12 h of exposure. Conclusions: This study revealed that oral administration of either B. coagulans B37 or B. pumilus B9 strains might be useful in reducing coliform counts accompanied by concurrent increase in lactobacilli counts in the intestinal flora in rats.
SrBeB{sub 2}O{sub 5}: Growth, crystal structure and optical properties
Energy Technology Data Exchange (ETDEWEB)
Yao, Wenjiao; Wang, Xiaoshan [Center for Crystal Research and Development, Technical Institute of Physics and Chemistry, Chinese Academy of Sciences, Beijing 100190 (China); University of the Chinese Academy of Sciences, Beijing 100049 (China); Huang, Hongwei [National Laboratory of Mineral Materials, School of Materials Science and Technology, China University of Geosciences, Beijing 100083 (China); Xu, Tao; Jiang, Xingxing [Center for Crystal Research and Development, Technical Institute of Physics and Chemistry, Chinese Academy of Sciences, Beijing 100190 (China); University of the Chinese Academy of Sciences, Beijing 100049 (China); Wang, Xiaoyang [Center for Crystal Research and Development, Technical Institute of Physics and Chemistry, Chinese Academy of Sciences, Beijing 100190 (China); Lin, Zheshuai, E-mail: zslin@mail.ipc.ac.cn [Center for Crystal Research and Development, Technical Institute of Physics and Chemistry, Chinese Academy of Sciences, Beijing 100190 (China); Chen, Chuangtian [Center for Crystal Research and Development, Technical Institute of Physics and Chemistry, Chinese Academy of Sciences, Beijing 100190 (China)
2014-04-01
Graphical abstract: The crystal displays a layered configuration along c axis with the wrinkled infinite (BeB{sub 2}O{sub 5}){sub ∞} layers. Display Omitted - Highlights: • A new beryllium borate SrBeB{sub 2}O{sub 5} was synthesized. • A layered structure (BeB{sub 2}O{sub 5}){sub ∞} was formed by BO{sub 3} triangles and B/BeO{sub 4} tetrahedrons. • SrBeB{sub 2}O{sub 5} has a very wide transparency range of wavelengths from 200 nm to 1800 nm. • A-site ions impact greatly on the structures of beryllium borates. - Abstract: A novel beryllium borate SrBeB{sub 2}O{sub 5} is discovered for the first time through traditional solid state reaction and high temperature solution method. The framework of the structure is composed by two-dimensional [BeB{sub 2}O{sub 5}] layers determined from single-crystal X-ray diffraction data. The further structural analysis of beryllium borates reveals that the arrangement of anionic groups attributes to the structural stability. Moreover, the influences of the A-site cations on the structural features of fundamental building blocks in the alkaline or alkaline earth beryllium borates are discussed. The UV–Vis–NIR diffuse-reflectance pattern reveals that this compound has a very wide transparency range of wavelengths down to 200 nm. In addition, the properties of SrBeB{sub 2}O{sub 5} were also characterized by powder X-ray diffraction, differential scanning calorimetry, and IR spectroscopy.
Alpha scintillation radon counting
International Nuclear Information System (INIS)
Lucas, H.F. Jr.
1977-01-01
Radon counting chambers which utilize the alpha-scintillation properties of silver activated zinc sulfide are simple to construct, have a high efficiency, and, with proper design, may be relatively insensitive to variations in the pressure or purity of the counter filling. Chambers which were constructed from glass, metal, or plastic in a wide variety of shapes and sizes were evaluated for the accuracy and the precision of the radon counting. The principles affecting the alpha-scintillation radon counting chamber design and an analytic system suitable for a large scale study of the 222 Rn and 226 Ra content of either air or other environmental samples are described. Particular note is taken of those factors which affect the accuracy and the precision of the method for monitoring radioactivity around uranium mines
Equivalence of truncated count mixture distributions and mixtures of truncated count distributions.
Böhning, Dankmar; Kuhnert, Ronny
2006-12-01
This article is about modeling count data with zero truncation. A parametric count density family is considered. The truncated mixture of densities from this family is different from the mixture of truncated densities from the same family. Whereas the former model is more natural to formulate and to interpret, the latter model is theoretically easier to treat. It is shown that for any mixing distribution leading to a truncated mixture, a (usually different) mixing distribution can be found so that the associated mixture of truncated densities equals the truncated mixture, and vice versa. This implies that the likelihood surfaces for both situations agree, and in this sense both models are equivalent. Zero-truncated count data models are used frequently in the capture-recapture setting to estimate population size, and it can be shown that the two Horvitz-Thompson estimators, associated with the two models, agree. In particular, it is possible to achieve strong results for mixtures of truncated Poisson densities, including reliable, global construction of the unique NPMLE (nonparametric maximum likelihood estimator) of the mixing distribution, implying a unique estimator for the population size. The benefit of these results lies in the fact that it is valid to work with the mixture of truncated count densities, which is less appealing for the practitioner but theoretically easier. Mixtures of truncated count densities form a convex linear model, for which a developed theory exists, including global maximum likelihood theory as well as algorithmic approaches. Once the problem has been solved in this class, it might readily be transformed back to the original problem by means of an explicitly given mapping. Applications of these ideas are given, particularly in the case of the truncated Poisson family.
Clustering method for counting passengers getting in a bus with single camera
Yang, Tao; Zhang, Yanning; Shao, Dapei; Li, Ying
2010-03-01
Automatic counting of passengers is very important for both business and security applications. We present a single-camera-based vision system that is able to count passengers in a highly crowded situation at the entrance of a traffic bus. The unique characteristics of the proposed system include, First, a novel feature-point-tracking- and online clustering-based passenger counting framework, which performs much better than those of background-modeling-and foreground-blob-tracking-based methods. Second, a simple and highly accurate clustering algorithm is developed that projects the high-dimensional feature point trajectories into a 2-D feature space by their appearance and disappearance times and counts the number of people through online clustering. Finally, all test video sequences in the experiment are captured from a real traffic bus in Shanghai, China. The results show that the system can process two 320×240 video sequences at a frame rate of 25 fps simultaneously, and can count passengers reliably in various difficult scenarios with complex interaction and occlusion among people. The method achieves high accuracy rates up to 96.5%.
Fast counting electronics for neutron coincidence counting
International Nuclear Information System (INIS)
Swansen, J.E.
1987-01-01
This patent describes a high speed circuit for accurate neutron coincidence counting comprising: neutron detecting means for providing an above-threshold signal upon neutron detection; amplifying means inputted by the neutron detecting means for providing a pulse output having a pulse width of about 0.5 microseconds upon the input of each above threshold signal; digital processing means inputted by the pulse output of the amplifying means for generating a pulse responsive to each input pulse from the amplifying means and having a pulse width of about 50 nanoseconds effective for processing an expected neutron event rate of about 1 Mpps: pulse stretching means inputted by the digital processing means for producing a pulse having a pulse width of several milliseconds for each pulse received form the digital processing means; visual indicating means inputted by the pulse stretching means for producing a visual output for each pulse received from the digital processing means; and derandomizing means effective to receive the 50 ns neutron event pulses from the digital processing means for storage at a rate up to the neutron event rate of 1 Mpps and having first counter means for storing the input neutron event pulses
Evangelopoulos, Angelos A; Dalamaga, Maria; Panoutsopoulos, Konstantinos; Dima, Kleanthi
2013-01-01
In the early 80s, the word automation was used in the clinical laboratory setting referring only to analyzers. But in late 80s and afterwards, automation found its way into all aspects of the diagnostic process, embracing not only the analytical but also the pre- and post-analytical phase. While laboratories in the eastern world, mainly Japan, paved the way for laboratory automation, US and European laboratories soon realized the benefits and were quick to follow. Clearly, automation and robotics will be a key survival tool in a very competitive and cost-concious healthcare market. What sets automation technology apart from so many other efficiency solutions are the dramatic savings that it brings to the clinical laboratory. Further standardization will assure the success of this revolutionary new technology. One of the main difficulties laboratory managers and personnel must deal with when studying solutions to reengineer a laboratory is familiarizing themselves with the multidisciplinary and technical terminology of this new and exciting field. The present review/glossary aims at giving an overview of the most frequently used terms within the scope of laboratory automation and to put laboratory automation on a sounder linguistic basis.
Atom-counting in High Resolution Electron Microscopy:TEM or STEM - That's the question.
Gonnissen, J; De Backer, A; den Dekker, A J; Sijbers, J; Van Aert, S
2017-03-01
In this work, a recently developed quantitative approach based on the principles of detection theory is used in order to determine the possibilities and limitations of High Resolution Scanning Transmission Electron Microscopy (HR STEM) and HR TEM for atom-counting. So far, HR STEM has been shown to be an appropriate imaging mode to count the number of atoms in a projected atomic column. Recently, it has been demonstrated that HR TEM, when using negative spherical aberration imaging, is suitable for atom-counting as well. The capabilities of both imaging techniques are investigated and compared using the probability of error as a criterion. It is shown that for the same incoming electron dose, HR STEM outperforms HR TEM under common practice standards, i.e. when the decision is based on the probability function of the peak intensities in HR TEM and of the scattering cross-sections in HR STEM. If the atom-counting decision is based on the joint probability function of the image pixel values, the dependence of all image pixel intensities as a function of thickness should be known accurately. Under this assumption, the probability of error may decrease significantly for atom-counting in HR TEM and may, in theory, become lower as compared to HR STEM under the predicted optimal experimental settings. However, the commonly used standard for atom-counting in HR STEM leads to a high performance and has been shown to work in practice. Copyright © 2017 Elsevier B.V. All rights reserved.
Acute and subacute toxicity of 10B-paraboronophenylalanine
International Nuclear Information System (INIS)
Taniyama, K.; Fujiwara, H.; Kuno, T.; Saito, N.; Shuntoh, H.; Sakaue, M.; Tanaka, C.
1989-01-01
The acute and subacute toxicities of 10B-paraboronophenylalanine (10B-BPA) were investigated in the rat, according to the Good Laboratory Practice Standard for safety studies on drugs in Japan. In the acute toxicity test of 10B-BPA, LD50 values of acidic 10B-BPA for intraperitoneal and subcutaneous injections were 640 mg/kg for male and 710 mg/kg for female rats, and more than 1,000 mg/kg for male and female rats, respectively. The LD50 values of neutral 10B-BPA for intraperitoneal and subcutaneous injections were more than 3,000 mg/kg for male and female rats. The difference in LD50 values between acidic and neutral 10B-BPA may be attributed to the acidity of material. From the subacute toxicity test, in which the rats were injected daily subcutaneously for 28 days, the following toxic effects of 10B-BPA were observed. Increase in ketone level in the urine was induced in all rats treated with 10B-BPA. High dose of 10B-BPA (1,500 mg/kg) induced increase in spleen weight and reticulocyte count, and decrease in hemoglobin count, thereby suggesting that 10B-BPA causes hemolysis. Increases in the leukocyte count and the ratio of neutrophils and lymphocytes were also observed in rats treated with a high dose of 10B-BPA. This may be attributed to local reactions at the injection site. There were no significant differences in the findings between control rats and rats treated with a low dose of 10B-BPA (300 mg/kg). Thus, low doses of neutral 10B-BPA may be available for use as a drug
DEFF Research Database (Denmark)
Hansen, S; Grabau, D A; Sørensen, Flemming Brandt
2000-01-01
This study addresses the prognostic value of estimating angiogenesis by Chalkley counting in breast cancer. A population-based group consisting of 836 patients with operated primary, unilateral invasive breast carcinomas was included from a predefined region and period of time. The median follow...... with counts or =7 compared with counts between 5-7. The study confirmed that estimation of angiogenesis by Chalkley counting had independent prognostic value in breast cancer patients. The Chalkley count could be useful to stratify node-negative patients...
Blood Count Tests: MedlinePlus Health Topic
... Spanish WBC count (Medical Encyclopedia) Also in Spanish Topic Image MedlinePlus Email Updates Get Blood Count Tests ... WBC count Show More Show Less Related Health Topics Bleeding Disorders Blood Laboratory Tests National Institutes of ...
Karon, Brad S; Tolan, Nicole V; Wockenfus, Amy M; Block, Darci R; Baumann, Nikola A; Bryant, Sandra C; Clements, Casey M
2017-11-01
Lactate, white blood cell (WBC) and neutrophil count, procalcitonin and immature granulocyte (IG) count were compared for the prediction of sepsis, and severe sepsis or septic shock, in patients presenting to the emergency department (ED). We prospectively enrolled 501 ED patients with a sepsis panel ordered for suspicion of sepsis. WBC, neutrophil, and IG counts were measured on a Sysmex XT-2000i analyzer. Lactate was measured by i-STAT, and procalcitonin by Brahms Kryptor. We classified patients as having sepsis using a simplification of the 1992 consensus conference sepsis definitions. Patients with sepsis were further classified as having severe sepsis or septic shock using established criteria. Univariate receiver operating characteristic (ROC) analysis was performed to determine odds ratio (OR), area under the ROC curve (AUC), and sensitivity/specificity at optimal cut-off for prediction of sepsis (vs. no sepsis), and prediction of severe sepsis or septic shock (vs. no sepsis). There were 267 patients without sepsis; and 234 with sepsis, including 35 patients with severe sepsis or septic shock. Lactate had the highest OR (1.44, 95th% CI 1.20-1.73) for the prediction of sepsis; while WBC, neutrophil count and percent (neutrophil/WBC) had OR>1.00 (psepsis or septic shock, with an odds ratio (95th% CI) of 2.70 (2.02-3.61) and AUC 0.89 (0.82-0.96). Traditional biomarkers (lactate, WBC, neutrophil count, procalcitonin, IG) have limited utility in the prediction of sepsis. Copyright © 2017 The Canadian Society of Clinical Chemists. Published by Elsevier Inc. All rights reserved.
Kohelet, D; Arbel, E; Ballin, A; Goldberg, M
2000-01-01
Neutrophil counts were studied in 62 preterm infants receiving mechanical ventilation for neonatal respiratory distress syndrome (NRDS). Exploratory analysis indicated that the severity of NRDS, as demonstrated by fractional inspired oxygen (FiO2), mean airway pressure (MAP), arterial-alveolar PO2 ratio (a/APO2) and oxygenation index (OI), was correlated with percentage change of neutrophil counts during the first 5 days of life. Further analysis demonstrated that infants with NRDS who subsequently developed chronic lung disease (CLD) (n = 21) had statistically significant differences in variation of neutrophil counts when compared with the remainder (n = 41) without CLD (-35.0% +/- 4.3 vs. -16.9% +/- 5.8, p variations in neutrophil counts during the first 5 days of life may be found in infants with NRDS who subsequently develop CLD and that these changes may have predictive value regarding the development of CLD.
Directory of Open Access Journals (Sweden)
Okocha Chide
2015-12-01
Full Text Available Background Changes in serum micro nutrients levels affect a number of critically important metabolic processes; these could potentially influence blood counts and ultimately disease presentation in patients with sickle cell anemia (SCA. Objectives To evaluate the influence of serum micro-nutrients levels; zinc, copper, selenium and magnesium on blood counts in steady state SCA patients. Methods A cross sectional study that involved 28 steady state adult SCA subjects. Seven milliliters (mls of blood was collected; 3 mls was for hemoglobin electrophoresis and full blood count determination while 4 mls was for measurement of serum micro nutrients levels, by the atomic absorption spectrophotometry. Correlation between serum micro-nutrient levels and blood counts was done by the Pearson’s linear regression. Ethical approval was obtained from the institutional review board and each participant gave informed consent. All data was analyzed by SPSS software version 20. Results There was a significant correlation between serum copper levels and mean cell hemoglobin (MCH, platelet and lymphocyte counts (r = 0.418; P = 0.02, r = -0.376; P = 0.04 and r = -0.383; P = 0.04, respectively. There were no significant correlations between serum levels of other micro nutrients (selenium, zinc and magnesium and blood counts. Conclusions Copper influences blood count in SCA patients probably by inducing red cell haemolysis, oxidant tissue damage and stimulating the immune system.
Effects of serotonin (5-HT)1B receptor ligands on amphetamine-seeking behavior in rats.
Miszkiel, Joanna; Przegaliński, Edmund
2013-01-01
Numerous studies have indicated that serotonin (5-HT)1B receptor ligands affect the behavioral effects of psychostimulants (cocaine, amphetamine), including the reinforcing activities of these drugs. To substantiate a role for those receptors in incentive motivation for amphetamine, we used the extinction/reinstatement model to examine the effects of the 5-HT1B receptor ligands on the reinstatement of extinguished amphetamine-seeking behavior. Rats trained to self-administer amphetamine (0.06 mg/kg/infusion) subsequently underwent the extinction procedure. These rats were then tested for the amphetamine-primed or amphetamine-associated cue-induced reinstatement of extinguished amphetamine-seeking behavior. The 5-HT1B receptor antagonist SB 216641 (5-7.5 mg/kg) attenuated the amphetamine (1.5 mg/kg)- and the amphetamine-associated cue combined with the threshold dose of amphetamine (0.5 mg/kg)-induced reinstatement of amphetamine-seeking behavior. The 5-HT1B receptor agonist CP 94253 (1.25-5 mg/kg) also inhibited the amphetamine-seeking behavior induced by amphetamine (1.5 mg/kg) but not by the cue combined with the threshold dose of amphetamine. The inhibitory effect of CP94253 on amphetamine-seeking behavior remained unaffected by the 5-HT1B receptor antagonist. Our results indicate that tonic activation of 5-HT1B receptors is involved in amphetamine- and cue-induced reinstatement of amphetamine-seeking behavior and that the inhibitory effects of 5-HT1B receptor antagonists on these phenomena are directly related to the motivational aspects of amphetamine abuse. The inhibitory effect of CP 94253 on amphetamine-seeking behavior seems to be unrelated to 5-HT1B receptor activation and may result from a general reduction of motivation.
Data of evolutionary structure change: 1CF5B-1RTCA [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 1CF5B-1RTCA 1CF5 1RTC B A --------DVNFDLSTATAKTYTKFIEDFRATL-PFSHK...A 211 1RTC A 1RTCA...ain> 1RTC A 1RTCA SALYYYSTGGTQLPT...pdbChain> 1RTCA MRTRIRYNRRSA HHHHHH 1RTCA AYFFH-PDNQE
Robo4 maintains vessel integrity and inhibits angiogenesis by interacting with UNC5B.
Koch, Alexander W; Mathivet, Thomas; Larrivée, Bruno; Tong, Raymond K; Kowalski, Joe; Pibouin-Fragner, Laurence; Bouvrée, Karine; Stawicki, Scott; Nicholes, Katrina; Rathore, Nisha; Scales, Suzie J; Luis, Elizabeth; del Toro, Raquel; Freitas, Catarina; Bréant, Christiane; Michaud, Annie; Corvol, Pierre; Thomas, Jean-Léon; Wu, Yan; Peale, Franklin; Watts, Ryan J; Tessier-Lavigne, Marc; Bagri, Anil; Eichmann, Anne
2011-01-18
Robo4 is an endothelial cell-specific member of the Roundabout axon guidance receptor family. To identify Robo4 binding partners, we performed a protein-protein interaction screen with the Robo4 extracellular domain. We find that Robo4 specifically binds to UNC5B, a vascular Netrin receptor, revealing unexpected interactions between two endothelial guidance receptors. We show that Robo4 maintains vessel integrity by activating UNC5B, which inhibits signaling downstream of vascular endothelial growth factor (VEGF). Function-blocking monoclonal antibodies against Robo4 and UNC5B increase angiogenesis and disrupt vessel integrity. Soluble Robo4 protein inhibits VEGF-induced vessel permeability and rescues barrier defects in Robo4(-/-) mice, but not in mice treated with anti-UNC5B. Thus, Robo4-UNC5B signaling maintains vascular integrity by counteracting VEGF signaling in endothelial cells, identifying a novel function of guidance receptor interactions in the vasculature. Copyright © 2011 Elsevier Inc. All rights reserved.
ENDF/B-V 7 Standards Data File (EN5-ST Library)
International Nuclear Information System (INIS)
DayDay, N.; Lemmel, H.D.
1980-10-01
This document summarizes the contents and documentation of the ENDF/B-V 7 Standards Data File (EN5-ST Library) released in September 1979. The library contains complete evaluations for all significant neutron reactions in the energy range 10 -5 eV to 20 MeV for H-1, He-3, Li-6, B-10, C-12, Au-197 and U-235 isotopes. The entire library or selective retrievals from it can be obtained free of charge from the IAEA Nuclear Data Section. (author)
Yoshimura, Aya; Ohnishi, Shunsuke; Orito, Chieko; Kawahara, Yukako; Takasaki, Hiroyo; Takeda, Hiroshi; Sakamoto, Naoya; Hashino, Satoshi
2015-01-01
Obesity has been demonstrated to be associated with elevated leukocytes in adults and children. This study assessed the associations between peripheral total and differential leukocyte counts and obesity-related complications in young adults. 12 obese (median age 21.5 (range 19-28) years, median BMI 35.7 (range 32.0-44.9) kg/m(2)) and 11 normal (median age 23 (range 18-27) years, median BMI 19.5 (range 18.1-21.7) kg/m(2)) adults were enrolled. Complete blood count and serum levels of liver enzymes, fasting blood glucose, insulin and lipids were measured, and the homeostasis model assessment of insulin resistance was calculated. Fat mass was calculated using a bioimpedance analysis device, and ultrasonography was performed to measure fat thickness and to detect fatty change of the liver. Total leukocyte and monocyte counts were significantly increased in obese young adults. Total leukocyte count was associated with liver enzyme levels, insulin resistance as well as visceral and subcutaneous fat thickness. Neutrophil count was associated with insulin resistance. Lymphocyte count was associated with serum liver enzymes, insulin resistance, and dyslipidemia. Monocyte count was associated with serum liver enzyme, insulin resistance, visceral and subcutaneous fat thickness, body fat mass, and percentage body fat. The results of this study suggest that chronic low-grade systemic inflammation is associated with obesity-related complications such as nonalcoholic fatty liver disease, insulin resistance, and dyslipidemia in young adults. © 2015 S. Karger GmbH, Freiburg.
International Nuclear Information System (INIS)
Foucherot, Claudine; Grimault, Julia; Morel, Romain
2014-01-01
The development of voluntary offsetting projects in Annex B countries is hampered by one difficulty: in some cases, voluntary certification schemes require the cancellation of Kyoto units in the country hosting the project, equal to the emission reductions produced. Joint Implementation (JI) requires the cancellation of units in order to prevent the same reduction in emissions from being counted twice as part of meeting the Kyoto requirements: firstly and directly, in the form of joint implementation units (ERUs) and, secondly and indirectly, in the form of the Kyoto units resulting from a reduction in the host country's emissions which are listed in their UNFCCC inventory. However, under certain conditions, AAUs do not need to be cancelled to ensure the environmental integrity of international agreements. This is the case when carbon credits result from projects certified by voluntary schemes because these credits have no value in terms of Kyoto compliance. Above and beyond the problem of environmental integrity, the issue of double monetization of the same emission reduction is often raised. To address this dilemma, we must identify whether the aim of voluntary offsetting is to increase the country's efforts to reduce emissions or rather help it achieve its Kyoto targets
Energy Technology Data Exchange (ETDEWEB)
Adib, M.; Eid, Y.; Abdel Kawy, A.; Maayouf, R.M.A.; Shuriet, G.M.; Hamouda, I.
1981-01-01
The behaviour of the dead time of He-3 detector, operating at both the proportional and the corona discharge regions, is investigated as a function of the neutron reaction rate inside the detector. The applied experimental method makes use of the fluctuations, due to the detector dead time in the observed counting rates from Poisson's distribution. In order to check the validity of the experimental method used in the present work, the dead time of BF/sub 3/ neutron detectors with different efficiencies (due to different enrichement in B-10) were determined. It is shown that the observed counting rate from the He-3 detector operating at the proportional region for neutron reaction rates ranging from 8 x 10/sup 3/ to 2.5 x 10/sup 4/ reaction/sec decreases with the increase of the neutron reaction rate. Such behaviour was not observed when operating the He-3 detector at the corona discharge region.
International Nuclear Information System (INIS)
Adib, M.; Eid, Y.; Abdel Kawy, A.; Maayouf, R.M.A.; Shuriet, G.M.; Hamouda, I.
1981-01-01
The behaviour of the dead time of He-3 detector, operating at both the proportional and the corona discharge regions, is investigated as a function of the neutron reaction rate inside the detector. The applied experimental method makes use of the fluctuations, due to the detector dead time in the observed counting rates from Poisson's distribution. In order to check the validity of the experimental method used in the present work, the dead time of BF 3 neutron detectors with different efficiencies (due to different enrichement in B-10) were determined. It is shown that the observed counting rate from the He-3 detector operating at the proportional region for neutron reaction rates ranging from 8 x 10 3 to 2.5 x 10 4 reaction/sec decreases with the increase of the neutron reaction rate. Such behaviour was not observed when operating the He-3 detector at the corona discharge region. (orig.) [de