Outbreaks of Eastern equine encephalitis in northeastern Brazil.
Silva, Maria L C R; Galiza, Glauco J N; Dantas, Antônio F M; Oliveira, Rafael N; Iamamoto, Keila; Achkar, Samira M; Riet-Correa, Franklin
2011-05-01
Outbreaks of eastern equine encephalitis observed from May 2008 to August 2009 in the Brazilian states of Pernambuco, Ceará, and Paraíba are reported. The disease occurred in 93 farms affecting 229 equids with a case fatality rate of 72.92%. Main clinical signs were circling, depression or hyperexcitability, ataxia, and progressive paralysis with a clinical manifestation period of 3-15 days. Main histologic lesions were a diffuse lymphocytic encephalomyelitis with neuronal death, satellitosis, neuronophagia, and hemorrhages being more severe in the cerebral gray matter of the telencephalon, diencephalon, and mesencephalon. Some animals also had areas of malacia in the telencephalon, thalamus, and basal nuclei. From 1 case, the virus was isolated by mice inoculation, and in other 13 cases was identified as Eastern equine encephalitis virus by semi-nested reverse transcription polymerase chain reaction. After DNA sequencing, all samples were identified as eastern equine encephalitis through the BLASTn analysis, but samples from the Ceará and Paraíba states corresponded to the same cluster, while the sample from the state of Pernambuco corresponded to a different cluster. © 2011 The Author(s)
Eastern equine encephalitis cases among horses in Brazil between 2005 and 2009.
de Novaes Oliveira, Rafael; Iamamoto, Keila; Silva, Maria Luana Cristiny Rodrigues; Achkar, Samira Maria; Castilho, Juliana Galera; Ono, Ekaterina Durymanova; Lobo, Renata Spinelli Vaz; Brandão, Paulo Eduardo; Carnieli, Pedro; Carrieri, Maria Luiza; Kotait, Ivanete; Macedo, Carla Isabel
2014-10-01
Eastern equine encephalitis is a viral zoonosis that exhibits complex distribution and epidemiology, and greater importance should be given to this disease by the public-health authorities. In Brazil, although eastern equine encephalitis virus (EEEV) has been identified in vectors and antibodies are sometimes detected in horses and humans, there have been no records of equine encephalitis in horses caused by this virus during the last 24 years. This study describes eighteen cases of eastern equine encephalomyelitis that occurred in six Brazilian states between 2005 and 2009. Viral RNA was identified using semi-nested RT-PCR to detect members of the genus Alphavirus, and by genetic sequencing. The gene encoding NSP1 was partially amplified, and after genetic sequencing, eighteen sequences were generated. All eighteen strains were classified as belonging to lineage III of American EEEV. These findings could be an indication of the importance of this virus in animal and human public health.
Jarvis, Jodie A; Franke, Mary A; Davis, April D
2016-08-01
An examination using the routine rabies direct fluorescent antibody test was performed on rabies or Eastern equine encephalitis positive mammalian brain tissue to assess inactivation of the virus. Neither virus was inactivated with acetone fixation nor the routine test, thus laboratory employees should treat all samples as rabies and when appropriate Eastern equine encephalitis positive throughout the whole procedure. Copyright © 2016 Elsevier B.V. All rights reserved.
Spatial epidemiology of eastern equine encephalitis in Florida.
Vander Kelen, Patrick T; Downs, Joni A; Stark, Lillian M; Loraamm, Rebecca W; Anderson, James H; Unnasch, Thomas R
2012-11-05
Eastern Equine Encephalitis virus (EEEV) is an alphavirus with high pathogenicity in both humans and horses. Florida continues to have the highest occurrence of human cases in the USA, with four fatalities recorded in 2010. Unlike other states, Florida supports year-round EEEV transmission. This research uses GIS to examine spatial patterns of documented horse cases during 2005-2010 in order to understand the relationships between habitat and transmission intensity of EEEV in Florida. Cumulative incidence rates of EEE in horses were calculated for each county. Two cluster analyses were performed using density-based spatial clustering of applications with noise (DBSCAN). The first analysis was based on regional clustering while the second focused on local clustering. Ecological associations of EEEV were examined using compositional analysis and Euclidean distance analysis to determine if the proportion or proximity of certain habitats played a role in transmission. The DBSCAN algorithm identified five distinct regional spatial clusters that contained 360 of the 438 horse cases. The local clustering resulted in 18 separate clusters containing 105 of the 438 cases. Both the compositional analysis and Euclidean distance analysis indicated that the top five habitats positively associated with horse cases were rural residential areas, crop and pastureland, upland hardwood forests, vegetated non-forested wetlands, and tree plantations. This study demonstrates that in Florida tree plantations are a focus for epizootic transmission of EEEV. It appears both the abundance and proximity of tree plantations are factors associated with increased risk of EEE in horses and therefore humans. This association helps to explain why there is are spatially distinct differences in the amount of EEE horse cases across Florida.
Eastern Equine Encephalitis Virus
Energy Technology Data Exchange (ETDEWEB)
Borucki, M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)
2010-08-05
Eastern equine encephalitis virus (EEEV) is a mosquito-borne virus capable of causing large outbreaks of encephalitis in humans and horses. In North America, EEEV infection has a very high mortality rate in humans, and survivors often suffer severe neurological sequelae. Interestingly, EEEV infections from South American isolates are generally subclinical. Although EEEV is divided into two antigenic varieties and four lineages, only eleven isolates have been sequenced and eight of these are from the North American variety (Lineage I). Most sequenced strains were collected from mosquitoes and only one human isolate has been sequenced. EEEV isolates exist from a variety of hosts, vectors, years, and geographical locations and efforts should focus on sequencing strains that represent this diversity.
2016-08-10
provides greater amounts of test material for research than traditional rodent models. 72 The ease of breeding in captivity coupled with the fact that...A., Guevara, 528 C., Rios, Z., Tesh, R.B., Watts, D.M., Olson, J., Weaver, S.C. 2007. Endemic eastern equine 529 encephalitis in the Amazon region...of Peru . Am. J. Trop. Med. Hyg. 76, 293-298. 530 Arechiga-Ceballos, N., Aguilar-Setien, A. 2015. Alphaviral equine encephalomyelitis (Eastern, 531
Efficacy of eastern equine encephalitis immunization in whooping cranes.
Olsen, G H; Turell, M J; Pagac, B B
1997-04-01
An epizootic of eastern equine encephalitis (EEE) at the Patuxent Wildlife Research Center (PWRC), Laurel, Maryland (USA), in 1989 provided an opportunity to determine if EEE immunization protected whooping cranes (Grus americana). Based on seroconversion of 31% of sympatric hatch-year sandhill cranes, Grus canadensis, and a previous 35% case fatality rate in whooping cranes, 17 (37%) of the 46 susceptible whooping cranes should have been exposed to virus and six should have died. As there were no deaths in these birds, the EEE vaccination program appeared to be efficacious in this whooping crane population.
Spatial epidemiology of eastern equine encephalitis in Florida
Directory of Open Access Journals (Sweden)
Vander Kelen Patrick T
2012-11-01
Full Text Available Abstract Background Eastern Equine Encephalitis virus (EEEV is an alphavirus with high pathogenicity in both humans and horses. Florida continues to have the highest occurrence of human cases in the USA, with four fatalities recorded in 2010. Unlike other states, Florida supports year-round EEEV transmission. This research uses GIS to examine spatial patterns of documented horse cases during 2005–2010 in order to understand the relationships between habitat and transmission intensity of EEEV in Florida. Methods Cumulative incidence rates of EEE in horses were calculated for each county. Two cluster analyses were performed using density-based spatial clustering of applications with noise (DBSCAN. The first analysis was based on regional clustering while the second focused on local clustering. Ecological associations of EEEV were examined using compositional analysis and Euclidean distance analysis to determine if the proportion or proximity of certain habitats played a role in transmission. Results The DBSCAN algorithm identified five distinct regional spatial clusters that contained 360 of the 438 horse cases. The local clustering resulted in 18 separate clusters containing 105 of the 438 cases. Both the compositional analysis and Euclidean distance analysis indicated that the top five habitats positively associated with horse cases were rural residential areas, crop and pastureland, upland hardwood forests, vegetated non-forested wetlands, and tree plantations. Conclusions This study demonstrates that in Florida tree plantations are a focus for epizootic transmission of EEEV. It appears both the abundance and proximity of tree plantations are factors associated with increased risk of EEE in horses and therefore humans. This association helps to explain why there is are spatially distinct differences in the amount of EEE horse cases across Florida.
Holmes, Mark A; Townsend, Hugh G G; Kohler, Andrea K; Hussey, Steve; Breathnach, Cormac; Barnett, Craig; Holland, Robert; Lunn, D P
2006-05-15
Horses are commonly vaccinated to protect against pathogens which are responsible for diseases which are endemic within the general horse population, such as equine influenza virus (EIV) and equine herpesvirus-1 (EHV-1), and against a variety of diseases which are less common but which lead to greater morbidity and mortality, such as eastern equine encephalomyelitis virus (EEE) and tetanus. This study consisted of two trials which investigated the antigenicity of commercially available vaccines licensed in the USA to protect against EIV, EHV-1 respiratory disease, EHV-1 abortion, EEE and tetanus in horses. Trial I was conducted to compare serological responses to vaccines produced by three manufacturers against EIV, EHV-1 (respiratory disease), EEE, and tetanus given as multivalent preparations or as multiple vaccine courses. Trial II compared vaccines from two manufacturers licensed to protect against EHV-1 abortion, and measured EHV-1-specific interferon-gamma (IFN-gamma) mRNA production in addition to serological evidence of antigenicity. In Trial I significant differences were found between the antigenicity of different commercial vaccines that should be considered in product selection. It was difficult to identify vaccines that generate significant immune responses to respiratory viruses. The most dramatic differences in vaccine performance occurred in the case of the tetanus antigen. In Trial II both vaccines generated significant antibody responses and showed evidence of EHV-1-specific IFN-gamma mRNA responses. Overall there were wide variations in vaccine response, and the vaccines with the best responses were not produced by a single manufacturer. Differences in vaccine performance may have resulted from differences in antigen load and adjuvant formulation.
MRI findings in eastern equine encephalitis: the "parenthesis" sign.
Nickerson, Joshua P; Kannabiran, Suma; Burbank, Heather N
2016-01-01
Two patients with eastern equine encephalitis (EEE) presented to a tertiary referral center. Both subjects' brain magnetic resonance imaging showed T2/FLAIR (fluid-attenuated inversion recovery) hyperintensities including linear areas of hyperintensity in the external and internal capsules with sparing of the lentiform nuclei. Single case reports of imaging findings in EEE exist with nonspecific patterns of abnormality. We propose that this "( ) parentheses sign" on T2 or FLAIR imaging may distinguish EEE from other processes. Copyright © 2015 Elsevier Inc. All rights reserved.
Notgrass, Clayton G.; Pettinelli, J. Douglas
2015-01-01
This article describes the Equine Assisted Growth and Learning Association's (EAGALA) experiential model called "Equine Assisted Psychotherapy" (EAP). EAGALA's model is based on the Association for Experiential Education's (AEE) tenets and is focused on the learner's experience with horses. Drawing on the historical use of equines in the…
Competency of reptiles and amphibians for eastern equine encephalitis virus.
White, Gregory; Ottendorfer, Christy; Graham, Sean; Unnasch, Thomas R
2011-09-01
Eastern equine encephalitis virus (EEEV) is endemic throughout most of the eastern United States. Although it is transmitted year round in Florida, transmission elsewhere is seasonal. The mechanism that enables EEEV to overwinter in seasonal foci remains obscure. In previous field studies, early season EEEV activity was detected in mosquito species that feed primarily upon ectothermic hosts, suggesting that reptiles and amphibians might represent overwintering reservoir hosts for EEEV. To determine if this might be possible, two commonly fed upon amphibian and reptile species were evaluated as hosts for the North American subtype I strain of EEEV. Neither amphibian species was a competent host. However, circulating viremias were detected in both reptile species examined. Hibernating infected garter snakes remained viremic after exiting hibernation. These data suggest that snakes may represent an overwintering host for North American EEEV.
Porter, Aimee I.; Erwin-Cohen, Rebecca A.; Twenhafel, Nancy; Chance, Taylor; Yee, Steven B.; Kern, Steven J.; Norwood, David; Hartman, Laurie J.; Parker, Michael D.; Glass, Pamela J.; DaSilva, Luis
2017-01-01
Background Licensed antiviral therapeutics and vaccines to protect against eastern equine encephalitis virus (EEEV) in humans currently do not exist. Animal models that faithfully recapitulate the clinical characteristics of human EEEV encephalitic disease, including fever, drowsiness, anorexia, and neurological signs such as seizures, are needed to satisfy requirements of the Food and Drug Administration (FDA) for clinical product licensing under the Animal Rule. Methods In an effort to meet...
WATGIS: A GIS-Based Lumped Parameter Water Quality Model
Glenn P. Fernandez; George M. Chescheir; R. Wayne Skaggs; Devendra M. Amatya
2002-01-01
A Geographic Information System (GIS)Âbased, lumped parameter water quality model was developed to estimate the spatial and temporal nitrogenÂloading patterns for lower coastal plain watersheds in eastern North Carolina. The model uses a spatially distributed delivery ratio (DR) parameter to account for nitrogen retention or loss along a drainage network. Delivery...
Eastern equine encephalitis virus: high seroprevalence in horses from Southern Quebec, Canada, 2012.
Rocheleau, Jean-Philippe; Arsenault, Julie; Lindsay, L Robbin; DiBernardo, Antonia; Kulkarni, Manisha A; Côté, Nathalie; Michel, Pascal
2013-10-01
Eastern equine encephalitis virus (EEEV) is a highly pathogenic arbovirus that infects humans, horses, and other animals. There has been a significant increase in EEEV activity in southeastern Canada since 2008. Few data are available regarding nonlethal EEEV infections in mammals, and consequently the distribution and pathogenicity spectrum of EEEV infections in these hosts is poorly understood. This cross-sectional study focuses on the evaluation of viral activity in southern Quebec's horses by seroprevalence estimation. A total of 196 horses, 18 months and older, which had never been vaccinated against EEEV and have never traveled outside Canada, were sampled from 92 barns distributed throughout three administrative regions of southern Quebec. Blood samples were taken from each horse and titrated for EEEV antibodies by plaque reduction neutralization test (PRNT). Equine population vaccination coverage was estimated by surveying horse owners and equine practitioners. PRNT results revealed an EEEV seroprevalence up to 8.7%, with 95% confidence limits ranging from 4.4% to 13.0%. Vaccination coverage was estimated to be at least 79%. Our study reveals for the first time in Canada a measure of EEEV seroprevalence in horses. High seroprevalence in unvaccinated animals challenges the perception that EEEV is a highly lethal pathogen in horses. Monitoring high-risk vector-borne infections such as EEEV in animal populations can be an important element of a public health surveillance strategy, population risk assessment and early detection of epidemics.
Molaei, Goudarz; Armstrong, Philip M; Abadam, Charles F; Akaratovic, Karen I; Kiser, Jay P; Andreadis, Theodore G
2015-01-01
Eastern equine encephalitis virus (EEEV) causes a highly pathogenic mosquito-borne zoonosis that is responsible for sporadic outbreaks of severe illness in humans and equines in the eastern USA. Culiseta (Cs.) melanura is the primary vector of EEEV in most geographic regions but its feeding patterns on specific avian and mammalian hosts are largely unknown in the mid-Atlantic region. The objectives of our study were to: 1) identify avian hosts of Cs. melanura and evaluate their potential role in enzootic amplification of EEEV, 2) assess spatial and temporal patterns of virus activity during a season of intense virus transmission, and 3) investigate the potential role of Cs. melanura in epidemic/epizootic transmission of EEEV to humans and equines. Accordingly, we collected mosquitoes at 55 sites in Suffolk, Virginia in 2013, and identified the source of blood meals in engorged mosquitoes by nucleotide sequencing PCR products of the mitochondrial cytochrome b gene. We also examined field-collected mosquitoes for evidence of infection with EEEV using Vector Test, cell culture, and PCR. Analysis of 188 engorged Cs. melanura sampled from April through October 2013 indicated that 95.2%, 4.3%, and 0.5% obtained blood meals from avian, mammalian, and reptilian hosts, respectively. American Robin was the most frequently identified host for Cs. melanura (42.6% of blood meals) followed by Northern Cardinal (16.0%), European Starling (11.2%), Carolina Wren (4.3%), and Common Grackle (4.3%). EEEV was detected in 106 mosquito pools of Cs. melanura, and the number of virus positive pools peaked in late July with 22 positive pools and a Maximum Likelihood Estimation (MLE) infection rate of 4.46 per 1,000 mosquitoes. Our findings highlight the importance of Cs. melanura as a regional EEEV vector based on frequent feeding on virus-competent bird species. A small proportion of blood meals acquired from mammalian hosts suggests the possibility that this species may occasionally
Serosurveillance of Eastern Equine Encephalitis Virus in Amphibians and Reptiles from Alabama, USA
Graham, Sean P.; Hassan, Hassan K.; Chapman, Taryn; White, Gregory; Guyer, Craig; Unnasch, Thomas R.
2012-01-01
Eastern equine encephalitis virus (EEEV) is among the most medically important arboviruses in North America, and studies suggest a role for amphibians and reptiles in its transmission cycle. Serum samples collected from 351 amphibians and reptiles (27 species) from Alabama, USA, were tested for the presence of antibodies against EEEV. Frogs, turtles, and lizards showed little or no seropositivity, and snakes had high seropositivity rates. Most seropositive species were preferred or abundant hosts of Culex spp. mosquitoes at Tuskegee National Forest, that target ectothermic hosts. The cottonmouth, the most abundant ectotherm sampled, displayed a high prevalence of seropositivity, indicating its possible role as an amplification and/or over-wintering reservoir for EEEV. PMID:22403333
Serosurveillance of eastern equine encephalitis virus in amphibians and reptiles from Alabama, USA.
Graham, Sean P; Hassan, Hassan K; Chapman, Taryn; White, Gregory; Guyer, Craig; Unnasch, Thomas R
2012-03-01
Eastern equine encephalitis virus (EEEV) is among the most medically important arboviruses in North America, and studies suggest a role for amphibians and reptiles in its transmission cycle. Serum samples collected from 351 amphibians and reptiles (27 species) from Alabama, USA, were tested for the presence of antibodies against EEEV. Frogs, turtles, and lizards showed little or no seropositivity, and snakes had high seropositivity rates. Most seropositive species were preferred or abundant hosts of Culex spp. mosquitoes at Tuskegee National Forest, that target ectothermic hosts. The cottonmouth, the most abundant ectotherm sampled, displayed a high prevalence of seropositivity, indicating its possible role as an amplification and/or over-wintering reservoir for EEEV.
Fisher, Rohan P; Myers, Bronwyn A
2011-02-25
Despite the demonstrated utility of GIS for health applications, there are perceived problems in low resource settings: GIS software can be expensive and complex; input data are often of low quality. This study aimed to test the appropriateness of new, inexpensive and simple GIS tools in poorly resourced areas of a developing country. GIS applications were trialled in pilot studies based on mapping of health resources and health indicators at the clinic and district level in the predominantly rural province of Nusa Tenggara Timur in eastern Indonesia. The pilot applications were (i) rapid field collection of health infrastructure data using a GPS enabled PDA, (ii) mapping health indicator data using open source GIS software, and (iii) service availability mapping using a free modelling tool. Through contextualised training, district and clinic staff acquired skills in spatial analysis and visualisation and, six months after the pilot studies, they were using these skills for advocacy in the planning process, to inform the allocation of some health resources, and to evaluate some public health initiatives. We demonstrated that GIS can be a useful and inexpensive tool for the decentralisation of health data analysis to low resource settings through the use of free and simple software, locally relevant training materials and by providing data collection tools to ensure data reliability.
Detection of eastern equine encephalomyelitis virus RNA in North American snakes.
Bingham, Andrea M; Graham, Sean P; Burkett-Cadena, Nathan D; White, Gregory S; Hassan, Hassan K; Unnasch, Thomas R
2012-12-01
The role of non-avian vertebrates in the ecology of eastern equine encephalomyelitis virus (EEEV) is unresolved, but mounting evidence supports a potential role for snakes in the EEEV transmission cycle, especially as over-wintering hosts. To determine rates of exposure and infection, we examined serum samples from wild snakes at a focus of EEEV in Alabama for viral RNA using quantitative reverse transcription polymerase chain reaction. Two species of vipers, the copperhead (Agkistrodon contortrix) and the cottonmouth (Agkistrodon piscivorus), were found to be positive for EEEV RNA using this assay. Prevalence of EEEV RNA was more frequent in seropositive snakes than seronegative snakes. Positivity for the quantitative reverse transcription polymerase chain reaction in cottonmouths peaked in April and September. Body size and sex ratios were not significantly different between infected and uninfected snakes. These results support the hypothesis that snakes are involved in the ecology of EEEV in North America, possibly as over-wintering hosts for the virus.
Pagac, B B; Turell, M J; Olsen, G H
1992-09-01
Mosquito population densities, virus isolations and seroconversion in sentinel quail were used to monitor eastern equine encephalomyelitis virus (EEE) activity at the Patuxent Wildlife Research Center, Laurel, Maryland, from 1985 through 1990. A dramatic increase in the number of Culiseta melanura collected in 1989, as compared with the 3 previous years, was associated with virus isolations from this species (5/75 pools; n = 542 mosquitoes) and with seroconversion in sentinel quail (4/22 birds positive). This was the first detection of EEE virus activity in this area since a 1984 EEE outbreak killed 7 whooping cranes.
GIS-based hazard and risk maps of the Douro river basin (north-eastern Portugal
Directory of Open Access Journals (Sweden)
José Gomes Santos
2015-02-01
Full Text Available The Douro river basin, in north-eastern Portugal, is a very complex region in terms of its geomorphological structure and morphodynamics. More specifically, the region – the Port Wine-growing region, a UNESCO heritage site – is a landslide-prone area resulting from several factors intrinsic to the bedrock and its detritic cover, combined with factors capable of triggering slope instability mechanisms, such as intense rainfall and human activities. Recently, due to intense rainfall and human activities, frequent rock and mud slides occurred, some of them catastrophic, killing people and damaging property. In the last decade (2000–2010, an accurate inventory of these catastrophic events was made, showing that these events occurred near local small towns, Peso da Régua (2001, Armamar (2003 and Carrazeda de Ansiães (2007. In this paper, we present a case study using field data and Geographic Information Systems (GIS tools to evaluate landslide hazard and risk assessment following multicriteria evaluation techniques.
Cloud GIS Based Watershed Management
Bediroğlu, G.; Colak, H. E.
2017-11-01
In this study, we generated a Cloud GIS based watershed management system with using Cloud Computing architecture. Cloud GIS is used as SAAS (Software as a Service) and DAAS (Data as a Service). We applied GIS analysis on cloud in terms of testing SAAS and deployed GIS datasets on cloud in terms of DAAS. We used Hybrid cloud computing model in manner of using ready web based mapping services hosted on cloud (World Topology, Satellite Imageries). We uploaded to system after creating geodatabases including Hydrology (Rivers, Lakes), Soil Maps, Climate Maps, Rain Maps, Geology and Land Use. Watershed of study area has been determined on cloud using ready-hosted topology maps. After uploading all the datasets to systems, we have applied various GIS analysis and queries. Results shown that Cloud GIS technology brings velocity and efficiency for watershed management studies. Besides this, system can be easily implemented for similar land analysis and management studies.
Teaching Thousands with Cloud-based GIS
Gould, Michael; DiBiase, David; Beale, Linda
2016-04-01
Teaching Thousands with Cloud-based GIS Educators often draw a distinction between "teaching about GIS" and "teaching with GIS." Teaching about GIS involves helping students learn what GIS is, what it does, and how it works. On the other hand, teaching with GIS involves using the technology as a means to achieve education objectives in the sciences, social sciences, professional disciplines like engineering and planning, and even the humanities. The same distinction applies to CyberGIS. Understandably, early efforts to develop CyberGIS curricula and educational resources tend to be concerned primarily with CyberGIS itself. However, if CyberGIS becomes as functional, usable and scalable as it aspires to be, teaching with CyberGIS has the potential to enable large and diverse global audiences to perform spatial analysis using hosted data, mapping and analysis services all running in the cloud. Early examples of teaching tens of thousands of students across the globe with cloud-based GIS include the massive open online courses (MOOCs) offered by Penn State University and others, as well as the series of MOOCs more recently developed and offered by Esri. In each case, ArcGIS Online was used to help students achieve educational objectives in subjects like business, geodesign, geospatial intelligence, and spatial analysis, as well as mapping. Feedback from the more than 100,000 total student participants to date, as well as from the educators and staff who supported these offerings, suggest that online education with cloud-based GIS is scalable to very large audiences. Lessons learned from the course design, development, and delivery of these early examples may be useful in informing the continuing development of CyberGIS education. While MOOCs may have passed the peak of their "hype cycle" in higher education, the phenomenon they revealed persists: namely, a global mass market of educated young adults who turn to free online education to expand their horizons. The
Directory of Open Access Journals (Sweden)
Dongmei Chen
2015-01-01
Full Text Available Lyme borreliosis, caused by the bacterium, Borrelia burgdorferi, is an emerging vector-borne infectious disease in Canada. According to the Public Health Agency of Canada (PHAC, by the year 2020, 80% of Canadians will live in Lyme endemic areas. An understanding of the association of Ixodes scapularis, the main vector of Lyme disease, with it hosts is a fundamental component in assessing changes in the spatial distribution of human risk for Lyme disease. Through the application of Geographic Information System (GIS mapping methods and spatial analysis techniques, this study examines the population dynamics of the black-legged Lyme tick and its primary host, the white-tailed deer, in eastern Ontario, Canada. By developing a habitat suitability model through a GIS-based multi-criteria decision making (MCDM analysis, the relationship of the deer habitat suitability map was generated and the results were compared with deer harvest data. Tick submission data collected from two public health units between 2006 and 2012 were used to explore the relationship between endemic ticks and deer habitat suitability in eastern Ontario. The positive correlation demonstrated between the deer habitat suitability model and deer harvest data allows us to further analyze the association between deer habitat and black-legged ticks in our study area. Our results revealed that the high tick submission number corresponds with the high suitability. These results are useful for developing management strategies that aim to prevent Lyme from becoming a threat to public health in Canada. Further studies are required to investigate how tick survival, behaviour and seasonal activity may change with projected climate change.
Practical aspects of equine parasite control: a review based upon a workshop discussion consensus.
Nielsen, M K; Fritzen, B; Duncan, J L; Guillot, J; Eysker, M; Dorchies, P; Laugier, C; Beugnet, F; Meana, A; Lussot-Kervern, I; von Samson-Himmelstjerna, G
2010-07-01
Development of resistance of several important equine parasites to most of the available anthelmintic drug classes has led to a reconsideration of parasite control strategies in many equine establishments. Routine prophylactic treatments based on simple calendar-based schemes are no longer reliable and veterinary equine clinicians are increasingly seeking advice and guidance on more sustainable approaches to equine parasite control. Most techniques for the detection of equine helminth parasites are based on faecal analysis and very few tests have been developed as diagnostic tests for resistance. Recently, some molecular and in vitro based diagnostic assays have been developed and have shown promise, but none of these are currently available for veterinary practice. Presently, the only reliable method for the detection of anthelmintic resistance is a simple faecal egg count reduction test, and clinicians are urged to perform such tests on a regular basis. The key to managing anthelmintic resistance is maintaining parasite refugia and this concept is discussed in relation to treatment strategies, drug rotations and pasture management. It is concluded that treatment strategies need to change and more reliance should now be placed on surveillance of parasite burdens and regular drug efficacy tests are also recommended to ensure continuing drug efficacy. The present review is based upon discussions held at an equine parasite workshop arranged by the French Equine Veterinary Association (Association Vétérinaire Equine Française, AVEF) in Reims, France, in October 2008.
IMPLEMENTATION OF GIS-BASED MULTICRITERIA DECISION ANALYSIS WITH VB IN ArcGIS
DERYA OZTURK; FATMAGUL BATUK
2011-01-01
This article focuses on the integration of multicriteria decision analysis (MCDA) and geographical information systems (GIS) and introduces a tool, GIS–MCDA, written in visual basic in ArcGIS for GIS-based MCDA. The GIS–MCDA deals with raster-based data sets and includes standardization, weighting and decision analysis methods, and sensitivity analysis. Simple additive weighting, weighted product method, technique for order preference by similarity to ideal solution, compromise programming, a...
Structural protein relationships among eastern equine encephalitis viruses.
Strizki, J M; Repik, P M
1994-11-01
We have re-evaluated the relationships among the polypeptides of eastern equine encephalitis (EEE) viruses using SDS-PAGE and peptide mapping of individual virion proteins. Four to five distinct polypeptide bands were detected upon SDS-PAGE analysis of viruses: the E1, E2 and C proteins normally associated with alphavirus virions, as well as an additional more rapidly-migrating E2-associated protein and a high M(r) (HMW) protein. In contrast with previous findings by others, the electrophoretic profiles of the virion proteins of EEE viruses displayed a marked correlation with serotype. The protein profiles of the 33 North American (NA)-serotype viruses examined were remarkably homogeneous, with variation detected only in the E1 protein of two isolates. In contrast, considerable heterogeneity was observed in the migration profiles of both the E1 and E2 glycoproteins of the 13 South American (SA)-type viruses examined. Peptide mapping of individual virion proteins using limited proteolysis with Staphylococcus aureus V8 protease confirmed that, in addition to the homogeneity evident among NA-type viruses and relative heterogeneity among SA-type viruses, the E1 and E2 proteins of NA- and SA-serotype viruses exhibited serotype-specific structural variation. The C protein was highly conserved among isolates of both virus serotypes. Endoglycosidase analyses of intact virions did not reveal substantial glycosylation differences between the glycoproteins of NA- and SA-serotype viruses. Both the HMW protein and the E2 protein (doublet) of EEE virus appeared to contain, at least in part, high-mannose type N-linked oligosaccharides. No evidence of O-linked glycans was found on either the E1 or the E2 glycoprotein. Despite the observed structural differences between proteins of NA- and SA-type viruses, Western blot analyses utilizing polyclonal antibodies indicated that immunoreactive epitopes appeared to be conserved.
Boori, Mukesh S.; Choudhary, Komal; Kupriyanov, Alexander; Sugimoto, Atsuko; Evers, Mariele
2016-10-01
The aim of this research work is to understand natural and environmental vulnerability situation and its cause such as intensity, distribution and socio-economic effect in the Indigirka River basin, Eastern Siberia, Russia. This paper identifies, assess and classify natural and environmental vulnerability using landscape pattern from multidisciplinary approach, based on remote sensing and Geographical Information System (GIS) techniques. A model was developed by following thematic layers: land use/cover, vegetation, wetland, geology, geomorphology and soil in ArcGIS 10.2 software. According to numerical results vulnerability classified into five levels: low, sensible, moderate, high and extreme vulnerability by mean of cluster principal. Results are shows that in natural vulnerability maximum area covered by moderate (29.84%) and sensible (38.61%) vulnerability and environmental vulnerability concentrated by moderate (49.30%) vulnerability. So study area has at medial level vulnerability. The results found that the methodology applied was effective enough in the understanding of the current conservation circumstances of the river basin in relation to their environment with the help of remote sensing and GIS. This study is helpful for decision making for eco-environmental recovering and rebuilding as well as predicting the future development.
Directory of Open Access Journals (Sweden)
Nikolova Valentina
2010-01-01
Full Text Available The article presents the morpholithology types in the Kamchia River basin (Eastern Bulgaria - the catchment area of the largest Bulgarian river which flows into the Black Sea. These types are determined on the base of information about the relief and lithological substrate. The rocks in the investigated area are divided into groups according to their physical-mechanical and chemical composition, and the relief types are determined in regards to the morphographic features of the catchment area. The research is done on the base of geological and topographic maps in scale 1:200 000 and also terrain observations are taken into account. As a result of the research a map of morpholithological types (1:200 000 is made. The map shows a considerable variety of the morpholithological types in the Kamchia River basin. This variety determines the appearance of the territory and also influences on the landscape differentiation. The analyses and composition of the morpholithology map are done in GIS environment. For that purpose a GIS database of lithology and relief (topography of the Kamchia River basin is built as spatial 'overlay' analysis is done.
Using Web-Based GIS in Introductory Human Geography
Songer, Lynn C.
2010-01-01
Advocates for using a geographic information system (GIS) in education assert that GIS improves student learning. However, studies to clarify the relationship between learning and using GIS are still needed. This study examines the effects of using Web-based GIS maps in place of paper maps on students' geography content knowledge and motivation…
Format conversion between CAD data and GIS data based on ArcGIS
Xie, Qingqing; Wei, Bo; Zhang, Kailin; Wang, Zhichao
2015-12-01
To make full use of the data resources and realize a sharing for the different types of data in different industries, a method of format conversion between CAD data and GIS data based on ArcGIS was proposed. To keep the integrity of the converted data, some key steps to process CAD data before conversion were made in AutoCAD. For examples, deleting unnecessary elements such as title, border and legend avoided the appearance of unnecessary elements after conversion, as layering data again by a national standard avoided the different types of elements to appear in a same layer after conversion. In ArcGIS, converting CAD data to GIS data was executed by the correspondence of graphic element classification between AutoCAD and ArcGIS. In addition, an empty geographic database and feature set was required to create in ArcGIS for storing the text data of CAD data. The experimental results show that the proposed method avoids a large amount of editing work in data conversion and maintains the integrity of spatial data and attribute data between before and after conversion.
Directory of Open Access Journals (Sweden)
Wayra G Navia-Gine
Full Text Available Mosquito blood meals provide information about the feeding habits and host preference of potential arthropod-borne disease vectors. Although mosquito-borne diseases are ubiquitous in the Neotropics, few studies in this region have assessed patterns of mosquito-host interactions, especially during actual disease outbreaks. Based on collections made during and after an outbreak of equine viral encephalitis, we identified the source of 338 blood meals from 10 species of mosquitoes from Aruza Abajo, a location in Darien province in eastern Panama. A PCR based method targeting three distinct mitochondrial targets and subsequent DNA sequencing was used in an effort to delineate vector-host relationships. At Aruza Abajo, large domesticated mammals dominated the assemblage of mosquito blood meals while wild bird and mammal species represented only a small portion of the blood meal pool. Most mosquito species fed on a variety of hosts; foraging index analysis indicates that eight of nine mosquito species utilize hosts at similar proportions while a stochastic model suggests dietary overlap among species was greater than would be expected by chance. The results from our null-model analysis of mosquito diet overlap are consistent with the hypothesis that in landscapes where large domestic animals dominate the local biomass, many mosquito species show little host specificity, and feed upon hosts in proportion to their biomass, which may have implications for the role of livestocking patterns in vector-borne disease ecology.
GIS In-Service Teacher Training Based on TPACK
Hong, Jung Eun; Stonier, Francis
2015-01-01
This article introduces the geographic information systems (GIS) in-service teacher training, focusing on the intersection of technological, pedagogical, and content knowledge (TPACK) for successful implementation of GIS in the classroom. Eleven social studies teachers in Georgia learned GIS technologies, inquiry-based learning, and social studies…
Pennick, Kate E; McKnight, Christy A; Patterson, Jon S; Latimer, Kenneth S; Maes, Roger K; Wise, Annabel G; Kiupel, Matti
2012-03-01
Immunohistochemistry (IHC) and in situ hybridization (ISH) can be used either to detect or to differentiate between Eastern equine encephalitis virus (EEEV) and West Nile virus (WNV) within formalin-fixed, paraffin-embedded (FFPE) brain tissue of horses. To compare the diagnostic sensitivity and specificity of ISH and IHC, FFPE brain tissue from 20 EEEV-positive horses and 16 WNV-positive horses were tested with both EEEV and WNV oligoprobes and EEEV- and WNV-specific antibodies. Reverse transcription polymerase chain reaction (RT-PCR) for detection of EEEV and WNV was used as the gold standard to confirm infection. All horses that tested positive for EEEV by RT-PCR also tested positive by IHC and ISH, except for 1 case that was false-negative by ISH. In contrast, all horses that tested positive for WNV by RT-PCR tested negative by IHC and only 2 horses tested positive by ISH. No false-positives were detected with either method for both viruses. Both IHC and ISH are highly specific and sensitive diagnostic methods to detect EEEV in equine FFPE brain tissues, although neither appear effective for the diagnosis of WNV in equine neurologic cases.
Rocheleau, J-P; Arsenault, J; Ogden, N H; Lindsay, L R; Drebot, M; Michel, P
2017-03-01
Eastern equine encephalitis (EEE) is a rare but severe emerging vector-borne disease affecting human and animal populations in the northeastern United States where it is endemic. Key knowledge gaps remain about the epidemiology of EEE virus (EEEV) in areas where its emergence has more recently been reported. In Eastern Canada, viral activity has been recorded in mosquitoes and horses throughout the 2000s but cases of EEEV in humans have not been reported so far. This study was designed to provide an assessment of possible EEEV human exposure by modelling environmental risk factors for EEEV in horses, identifying high-risk environments and mapping risk in the province of Quebec, Canada. According to logistic models, being located near wooded swamps was a risk factor for seropositivity or disease in horses [odds ratio (OR) 4·15, 95% confidence interval (CI) 1·16-14·8) whereas being located on agricultural lands was identified as protective (OR 0·75, 95% CI 0·62-0·92). A better understanding of the environmental risk of exposure to EEEV in Canada provides veterinary and public health officials with enhanced means to more effectively monitor the emergence of this public health risk and design targeted surveillance and preventive measures.
Computer-based instrumentation for partial discharge detection in GIS
International Nuclear Information System (INIS)
Md Enamul Haque; Ahmad Darus; Yaacob, M.M.; Halil Hussain; Feroz Ahmed
2000-01-01
Partial discharge is one of the prominent indicators of defects and insulation degradation in a Gas Insulated Switchgear (GIS). Partial discharges (PD) have a harmful effect on the life of insulation of high voltage equipment. The PD detection using acoustic technique and subsequent analysis is currently an efficient method of performing non-destructive testing of GIS apparatus. A low cost PC-based acoustic PD detection instrument has been developed for the non-destructive diagnosis of GIS. This paper describes the development of a PC-based instrumentation system for partial discharge detection in GIS and some experimental results have also presented. (Author)
Phillips, Aaron T; Schountz, Tony; Toth, Ann M; Rico, Amber B; Jarvis, Donald L; Powers, Ann M; Olson, Ken E
2014-02-01
Alphaviruses are mosquito-borne viruses that cause significant disease in animals and humans. Western equine encephalitis virus (WEEV) and eastern equine encephalitis virus (EEEV), two New World alphaviruses, can cause fatal encephalitis, and EEEV is a select agent of concern in biodefense. However, we have no antiviral therapies against alphaviral disease, and current vaccine strategies target only a single alphavirus species. In an effort to develop new tools for a broader response to outbreaks, we designed and tested a novel alphavirus vaccine comprised of cationic lipid nucleic acid complexes (CLNCs) and the ectodomain of WEEV E1 protein (E1ecto). Interestingly, we found that the CLNC component, alone, had therapeutic efficacy, as it increased survival of CD-1 mice following lethal WEEV infection. Immunization with the CLNC-WEEV E1ecto mixture (lipid-antigen-nucleic acid complexes [LANACs]) using a prime-boost regimen provided 100% protection in mice challenged with WEEV subcutaneously, intranasally, or via mosquito. Mice immunized with LANACs mounted a strong humoral immune response but did not produce neutralizing antibodies. Passive transfer of serum from LANAC E1ecto-immunized mice to nonimmune CD-1 mice conferred protection against WEEV challenge, indicating that antibody is sufficient for protection. In addition, the LANAC E1ecto immunization protocol significantly increased survival of mice following intranasal or subcutaneous challenge with EEEV. In summary, our LANAC formulation has therapeutic potential and is an effective vaccine strategy that offers protection against two distinct species of alphavirus irrespective of the route of infection. We discuss plausible mechanisms as well the potential utility of our LANAC formulation as a pan-alphavirus vaccine.
DEFF Research Database (Denmark)
Bundgaard, Louise; Jacobsen, Stine; Sørensen, Mette Aamand
2014-01-01
Progress in MS-based methods for veterinary research and diagnostics is lagging behind compared to the human research, and proteome data of domestic animals is still not well represented in open source data repositories. This is particularly true for the equine species. Here we present a first...... Equine PeptideAtlas encompassing high-resolution tandem MS analyses of 51 samples representing a selection of equine tissues and body fluids from healthy and diseased animals. The raw data were processed through the Trans-Proteomic Pipeline to yield high quality identification of proteins and peptides....... The current release comprises 24 131 distinct peptides representing 2636 canonical proteins observed at false discovery rates of 0.2% at the peptide level and 1.4% at the protein level. Data from the Equine PeptideAtlas are available for experimental planning, validation of new datasets, and as a proteomic...
Preston, Todd M; Chesley-Preston, Tara L; Thamke, Joanna N
2014-02-15
Water (brine) co-produced with oil in the Williston Basin is some of the most saline in the nation. The Prairie Pothole Region (PPR), characterized by glacial sediments and numerous wetlands, covers the northern and eastern portion of the Williston Basin. Sheridan County, Montana, lies within the PPR and has a documented history of brine contamination. Surface water and shallow groundwater in the PPR are saline and sulfate dominated while the deeper brines are much more saline and chloride dominated. A Contamination Index (CI), defined as the ratio of chloride concentration to specific conductance in a water sample, was developed by the Montana Bureau of Mines and Geology to delineate the magnitude of brine contamination in Sheridan County. Values >0.035 indicate contamination. Recently, the U.S. Geological Survey completed a county level geographic information system (GIS)-based vulnerability assessment of brine contamination to aquatic resources in the PPR of the Williston Basin based on the age and density of oil wells, number of wetlands, and stream length per county. To validate and better define this assessment, a similar approach was applied in eastern Sheridan County at a greater level of detail (the 2.59 km(2) Public Land Survey System section grid) and included surficial geology. Vulnerability assessment scores were calculated for the 780 modeled sections and these scores were divided into ten equal interval bins representing similar probabilities of contamination. Two surface water and two groundwater samples were collected from the section with the greatest acreage of Federal land in each bin. Nineteen of the forty water samples, and at least one water sample from seven of the ten selected sections, had CI values indicating contamination. Additionally, CI values generally increased with increasing vulnerability assessment score, with a stronger correlation for groundwater samples (R(2)=0.78) than surface water samples (R(2)=0.53). Copyright © 2013
SOFTWARE ARCHITECTURE DESIGN OF GIS WEB SERVICE AGGREGATION BASED ON SERVICE GROUP
Directory of Open Access Journals (Sweden)
J.-C. Liu
2012-08-01
Full Text Available Based on the analysis of research status of domestic and international GIS web service aggregation and development tendency of public platform of GIS web service, the paper designed software architecture of GIS web service aggregation based on GIS web service group. Firstly, using heterogeneous GIS services model, the software architecture converted a variety of heterogeneous services to a unified interface of GIS services, and divided different types of GIS services into different service groups referring to description of GIS services. Secondly, a service aggregation process model was designed. This model completed the task of specific service aggregation instance, by automatically selecting member GIS Web services in the same service group. Dynamic capabilities and automatic adaptation of GIS Web services aggregation process were achieved. Thirdly, this paper designed a service evaluation model of GIS web service aggregation based on service group from three aspects, i.e. GIS Web Service itself, networking conditions and service consumer. This model implemented effective quality evaluation and performance monitoring of GIS web service aggregation. It could be used to guide the execution, monitor and service selection of aggregation process. Therefore, robustness of aggregated GIS web service was improved. Finally, the software architecture has been widely used in public platform of GIS web service and a number of geo-spatial framework constructions for digital city in Sichuan Province, and aggregated various GIS web services such as World Map(National Public Platform of Geo-spatial Service, ArcGIS, SuperMap, MapGIS, NewMap etc. Applications of items showed that this software architecture was practicability.
Quantification of equine immunoglobulin A in serum and secretions by a fluorescent bead-based assay.
Schnabel, Christiane L; Babasyan, Susanna; Freer, Heather; Wagner, Bettina
2017-06-01
Only few quantitative reports exist about the concentrations and induction of immunoglobulin A (IgA) in mucosal secretions of horses. Despite this, it is widely assumed that IgA is the predominant immunoglobulin on mucosal surfaces in the horse. Here, two new monoclonal antibodies (mAbs) against equine IgA, clones 84-1 and 161-1, were developed and characterized in detail. Both IgA mAbs specifically bound monomeric and dimeric equine IgA in different applications, such as Western blots and fluorescent bead-based assays. Cross-reactivity with other equine immunoglobulin isotypes was not observed. The new IgA mAb 84-1 was used in combination with the previously characterized anti-equine IgA mAb BVS2 for the development and validation of a fluorescent bead-based assay to quantify total IgA in equine serum and various secretions. The IgA assay's linear detection ranged from 64pg/ml to 1000ng/ml. For the quantification of IgA in serum or in secretions an IgA standard was purified from serum or nasal wash fluid (secretory IgA), respectively. The different standards were needed for accurate IgA quantification in the respective samples taking the different signal intensities of monomeric and dimeric IgA on the florescent bead-based assay into account. IgA was quantified by the bead-based assay established here in different equine samples of healthy adult individuals. In serum the median total IgA was 0.45mg/ml for Thoroughbred horses (TB, n=10) and 1.16mg/ml in Icelandic horses (ICH, n=12). In nasopharyngeal secretions of TB (n=7) 0.13mg/ml median total IgA was measured, and 0.25mg/ml for ICH (n=12). Saliva of ICH (n=6) contained a median of 0.15mg/ml, colostrum of Warmbloods (n=8) a median of 1.89mg/ml IgA. Compared to IgG1 and IgG4/7 quantified in the same samples, IgA appeared as the major immunoglobulin isotype in nasopharyngeal secretions and saliva while it is a minor isotype in serum and colostrum. The newly developed monoclonal antibodies against equine IgA and the
A GIS-BASED ENVIRONMENTAL HEALTH INFORMATION SOURCE FOR MALAYSIAN CONTEXT
Lau Tiu Chung; Lau Bee Theng; Henry Lee Seldon
2013-01-01
In this paper, we propose a GIS-based system for collection and targeted distribution of latest alerts and real-time environmental factors to the Malaysian population. We call it the Environmental Health Management System (EHMS). This GIS-based system is designed to facilitate and encourage research into environmental health quality issues by providing a comprehensive tracking and monitoring tool. This GIS-based system is embedded with Google Maps API and Geocoding API services to visualize t...
Directory of Open Access Journals (Sweden)
Erminio Paolo Canavese
2015-02-01
Full Text Available In questa case history Virtualgeo presenta la sua soluzione per diffondere l’uso delle nuove tecnologie geomatiche a supporto del turismo grazie a un WebGIS ricco di funzionalità. La realizzazione di un percorso turistico digitale auspica di fornire possibili suggerimenti all’interno del processo di adeguamento tecnologico perseguito dalle municipalità.In this case study Virtualgeo presents its solution to spread the use of new geomatics technologies to support tourism through a webGIS that is rich of features. The creation of a tourist route through digital technology-based processing tools hopes to provide possible suggestions in the process of technological updating pursued by the municipalities of Eastern Venice, providing those simple solutions that become more and more "necessary" in an era constructed through the network. The created webGIS is a tourist product that is useful for the institutions directly concerned with the promotion of the territory; for the "natives", i.e. the citizens who often know little the area where they live, and for the eco-tourists visiting this wonderful land. The webGIS should not be neglected as an extraordinary tool of knowledge of the area (cultural heritage, landscape, environment for teaching in schools of all levels.
Directory of Open Access Journals (Sweden)
Erminio Paolo Canavese
2015-02-01
Full Text Available In questa case history Virtualgeo presenta la sua soluzione per diffondere l’uso delle nuove tecnologie geomatiche a supporto del turismo grazie a un WebGIS ricco di funzionalità. La realizzazione di un percorso turistico digitale auspica di fornire possibili suggerimenti all’interno del processo di adeguamento tecnologico perseguito dalle municipalità. In this case study Virtualgeo presents its solution to spread the use of new geomatics technologies to support tourism through a webGIS that is rich of features. The creation of a tourist route through digital technology-based processing tools hopes to provide possible suggestions in the process of technological updating pursued by the municipalities of Eastern Venice, providing those simple solutions that become more and more "necessary" in an era constructed through the network. The created webGIS is a tourist product that is useful for the institutions directly concerned with the promotion of the territory; for the "natives", i.e. the citizens who often know little the area where they live, and for the eco-tourists visiting this wonderful land. The webGIS should not be neglected as an extraordinary tool of knowledge of the area (cultural heritage, landscape, environment for teaching in schools of all levels.
A GIS based hydrogeomorphic approach for identification of site ...
Indian Academy of Sciences (India)
a Geographical Information System (GIS) based hydrogeomorphic approach in the Bhatsa and. Kalu river basins of Thane district, in western DVP. The criteria adopted for the GIS analysis were based .... segments of the rivers. The majority of the lineaments correspond to either dyke ridges or stream channels which are of ...
Annotation of the protein coding regions of the equine genome
DEFF Research Database (Denmark)
Hestand, Matthew S.; Kalbfleisch, Theodore S.; Coleman, Stephen J.
2015-01-01
Current gene annotation of the horse genome is largely derived from in silico predictions and cross-species alignments. Only a small number of genes are annotated based on equine EST and mRNA sequences. To expand the number of equine genes annotated from equine experimental evidence, we sequenced m...... and appear to be small errors in the equine reference genome, since they are also identified as homozygous variants by genomic DNA resequencing of the reference horse. Taken together, we provide a resource of equine mRNA structures and protein coding variants that will enhance equine and cross...
A GIS-based disaggregate spatial watershed analysis using RADAR data
International Nuclear Information System (INIS)
Al-Hamdan, M.
2002-01-01
Hydrology is the study of water in all its forms, origins, and destinations on the earth.This paper develops a novel modeling technique using a geographic information system (GIS) to facilitate watershed hydrological routing using RADAR data. The RADAR rainfall data, segmented to 4 km by 4 km blocks, divides the watershed into several sub basins which are modeled independently. A case study for the GIS-based disaggregate spatial watershed analysis using RADAR data is provided for South Fork Cowikee Creek near Batesville, Alabama. All the data necessary to complete the analysis is maintained in the ArcView GIS software. This paper concludes that the GIS-Based disaggregate spatial watershed analysis using RADAR data is a viable method to calculate hydrological routing for large watersheds. (author)
The use of GIS-based support of recreational trail planning by local governments
DEFF Research Database (Denmark)
Olafsson, Anton Stahl; Skov-Petersen, Hans
2014-01-01
In the last decade, multiple GIS-based planning support systems have been developed in order to improve the basis for spatial planning. Recent research has focused on problems regarding a lack of utilisation or barriers to the use of advanced GIS and GIS-based planning support systems in planning...... applications. This paper discusses these research findings in the context of outdoor recreational planning by local governments in Denmark. According to a national survey of municipal planners, GIS-based planning support is widely used in Denmark, but more GIS is needed and is being requested for local outdoor...... recreation planning. However, considerable differences exist between the ways municipalities assess their need for and use of GIS planning support. These differences are explored in more detail using a factor analysis of planning variables and uses of GIS. Three situations are described: 1) extensive network...
Use of GIS-Based Sampling to Inform Food Security Assessments and Decision Making in Kenya
Wahome, A.; Ndubi, A. O.; Ndungu, L. W.; Mugo, R. M.; Flores Cordova, A. I.
2017-12-01
Kenya relies on agricultural production for supporting local consumption and other processing value chains. With changing climate in a rain-fed dependent agricultural production system, cropping zones are shifting and proper decision making will require updated data. Where up-to-date data is not available it is important that it is generated and passed over to relevant stakeholders to inform their decision making. The process of generating this data should be cost effective and less time consuming. The Kenyan State Department of Agriculture (SDA) runs an insurance programme for maize farmers in a number of counties in Kenya. Previously, SDA was using a list of farmers to identify the crop fields for this insurance programme. However, the process of listing of all farmers in each Unit Area of Insurance (UAI) proved to be tedious and very costly, hence need for an alternative approach, but acceptable sampling methodology. Building on the existing cropland maps, SERVIR, a joint NASA-USAID initiative that brings Earth observations (EO) for improved environmental decision making in developing countries, specifically its hub in Eastern and Soutehrn Africa developed a High Resolution Map based on 10m Sentinel satellite images from which a GIS based sampling frame for identifying maize fields was developed. Sampling points were randomly generated in each UAI and navigated to using hand-held GPS units for identification of maize farmers. In the GIS-based identification of farmers SDA uses 1 day to cover an area covered in 1 week by list identification of farmers. Similarly, SDA spends approximately 3,000 USD per sub-county to locate maize fields using GIS-based sampling as compared 10,000 USD they used to spend before. This has resulted in 70% cost reduction.
Application of GIS Technology - cadastral base of the municipality of Gostivar
Serafimoski, Toni
2011-01-01
In the thesis is presented modern GIS technology and its application in the field of cadastre. GIS technology is essentially based on the display and information processing related to given geographical coordinates. In the paper is implemented GIS software package Microstation, widely applied in the field of cadastre. The paper developed model using data from the cadastre of the municipality of Gostivar. Applied GIS technology opens up wide possibilities of processing of cadastral data,...
Development and challenges of using web-based GIS for health applications
DEFF Research Database (Denmark)
Gao, Sheng; Mioc, Darka; Boley, Harold
2011-01-01
Web-based GIS is increasingly used in health applications. It has the potential to provide critical information in a timely manner, support health care policy development, and educate decision makers and the general public. This paper describes the trends and recent development of health...... applications using a Web-based GIS. Recent progress on the database storage and geospatial Web Services has advanced the use of Web-based GIS for health applications, with various proprietary software, open source software, and Application Programming Interfaces (APIs) available. Current challenges in applying...... care planning, and public health participation....
A GIS-BASED ENVIRONMENTAL HEALTH INFORMATION SOURCE FOR MALAYSIAN CONTEXT
Directory of Open Access Journals (Sweden)
Lau Tiu Chung
2013-04-01
Full Text Available In this paper, we propose a GIS-based system for collection and targeted distribution of latest alerts and real-time environmental factors to the Malaysian population. We call it the Environmental Health Management System (EHMS. This GIS-based system is designed to facilitate and encourage research into environmental health quality issues by providing a comprehensive tracking and monitoring tool. This GIS-based system is embedded with Google Maps API and Geocoding API services to visualize the location and environmental health reports from the aggregated online newspaper and social media news feeds. We introduce the design and implementation of EHMS, including the web frontend, backend, ontology, database, data acquisition, classification engine, and the standard news feeds.
Evaluation of AirGIS: a GIS-based air pollution and human exposure modelling system
DEFF Research Database (Denmark)
Ketzel, Matthias; Berkowicz, Ruwim; Hvidberg, Martin
2011-01-01
This study describes in brief the latest extensions of the Danish Geographic Information System (GIS)-based air pollution and human exposure modelling system (AirGIS), which has been developed in Denmark since 2001 and gives results of an evaluation with measured air pollution data. The system...... shows, in general, a good performance for both long-term averages (annual and monthly averages), short-term averages (hourly and daily) as well as when reproducing spatial variation in air pollution concentrations. Some shortcomings and future perspectives of the system are discussed too....
Modelling land use changes according to transportation scenarios using raster based GIS indicators
DEFF Research Database (Denmark)
Fuglsang, Morten; Münier, Bernd; Hansen, Henning Sten
2012-01-01
the cellular automata model LUCIA. An Eastern Danish case area was selected, comprising the Copenhagen metropolitan area and its hinterland. The different scenarios are described using a range of different GIS datasets. These include mapping of accessibility based on public and private transportation, urban....... In the EU-FP7 research project PASHMINA (Paradigm Shift modelling and innovative approaches), three storylines of future transportation paradigm shifts towards 2050 are created. These storylines are translated into spatial planning strategies and their implication on land use changes were modelled via...... in urban distribution that different spatial planning strategies may initiate, and thus change the shape of the urban landscape. The scenarios outline different planning strategies, leading to a more homogenous urban structure, targeted at a reduction of transportation work and thus energy consumption...
Directory of Open Access Journals (Sweden)
Romain Paillot
2017-12-01
Full Text Available To date, vaccination is one of the most efficient methods of prevention against equine infectious diseases. The vaccinology session, which was organised during the annual meeting of the French Equine Veterinarians Association (AVEF at Reims (France in 2016, aimed to approach three subjects of importance for the equine industry. Vaccination against three major equine diseases were used as examples: equine influenza (equine influenza virus, rhinopneumonitis (equine herpes virus 1/4, and tetanus (Clostridium tetani neuro-toxin. (1 Emergency vaccination: while it has been very successful to reduce the impact of equine influenza epizooties and it is also recommended for tetanus in case of surgery and accident, the benefit of emergency vaccination against equine herpes virus 1/4 remains arguable; (2 Compatibility of equine vaccines from different brands: despite being a frequent concerns for equine veterinarians, little information is available about the compatibility of equine vaccines from different commercial origins. The consequence of mixing different equine vaccines targeting the same disease is believed to be limited but scientific evidences are sparse; and, (3 Laps vaccination and vaccine shortage: they could have serious consequences in terms of protection and their impact should be evaluated on a case by case basis, taking into account the risk of contact with the pathogen and the effect on herd immunity.
GIS-based multi-criteria analysis for Arabica coffee expansion in Rwanda.
Directory of Open Access Journals (Sweden)
Innocent Nzeyimana
Full Text Available The Government of Rwanda is implementing policies to increase the area of Arabica coffee production. Information on the suitable areas for sustainably growing Arabica coffee is still scarce. This study aimed to analyze suitable areas for Arabica coffee production. We analyzed the spatial distribution of actual and potential production zones for Arabica coffee, their productivity levels and predicted potential yields. We used a geographic information system (GIS for a weighted overlay analysis to assess the major production zones of Arabica coffee and their qualitative productivity indices. Actual coffee yields were measured in the field and were used to assess potential productivity zones and yields using ordinary kriging with ArcGIS software. The production of coffee covers about 32 000 ha, or 2.3% of all cultivated land in the country. The major zones of production are the Kivu Lake Borders, Central Plateau, Eastern Plateau, and Mayaga agro-ecological zones, where coffee is mainly cultivated on moderate slopes. In the highlands, coffee is grown on steep slopes that can exceed 55%. About 21% percent of the country has a moderate yield potential, ranging between 1.0 and 1.6 t coffee ha-1, and 70% has a low yield potential (<1.0 t coffee ha-1. Only 9% of the country has a high yield potential of 1.6-2.4 t coffee ha-1. Those areas are found near Lake Kivu where the dominant soil Orders are Inceptisols and Ultisols. Moderate yield potential is found in the Birunga (volcano, Congo-Nile watershed Divide, Impala and Imbo zones. Low-yield regions (<1 t ha-1 occur in the eastern semi-dry lowlands, Central Plateau, Eastern Plateau, Buberuka Highlands, and Mayaga zones. The weighted overlay analysis and ordinary kriging indicated a large spatial variability of potential productivity indices. Increasing the area and productivity of coffee in Rwanda thus has considerable potential.
Research on Livable Community Evaluation Based on GIS
Yin, Zhangcai; Wu, Yang; Jin, Zhanghaonan; Zhang, Xu
2018-01-01
Community is the basic unit of the city. Research on livable community could provide a bottom-up research path for the realization of livable city. Livability is the total factor affecting the quality of community life. In this paper, livable community evaluation indexes are evaluated based on GIS and fuzzy comprehensive evaluation method. Then the sum-index and sub-index of community livability are both calculated. And community livable evaluation index system is constructed based on the platform of GIS. This study provides theoretical support for the construction and management of livable communities, so as to guide the development and optimization of city.
Directory of Open Access Journals (Sweden)
Patricia Filippsen Favaro
2016-06-01
Full Text Available Equine influenza virus (EIV (H3N8 and H7N7 is the causative agent of equine influenza, or equine flu. The H7N7 subtype has been considered to be extinct worldwide since 1980. Affected animals have respiratory symptoms that can be worsened by secondary bacterial respiratory infection, thereby leading to great economic losses in the horse-breeding industry. In Brazil, equine influenza outbreaks were first reported in 1963 and studies on hemagglutination antibodies against viral subtypes in Brazilian horses have been conducted since then. The objective of the present review was to present the history of the emergence of EIV around the world and in Brazil and the studies that have thus far been developed on EIV in Brazilian equines.
Molecular Characteristics of the Equine Periodontal Ligament
Directory of Open Access Journals (Sweden)
Antje Pöschke
2018-01-01
Full Text Available The equine periodontal ligament (PDL is a fibrous connective tissue that covers the intra-alveolar parts of the tooth and anchors it to the alveolar bone—it, therefore, provides a similar function to a tendinous structure. While several studies have considered the formation and structure of tendons, there is insufficient information particularly on the molecular composition of the PDL. Especially for the equine PDL, there is limited knowledge concerning the expression of genes commonly regarded as typical for tendon tissue. In this study, the gene expression of, e.g., collagen type 1 alpha 1 (COL1, collagen type 3 alpha 1 (COL3, scleraxis (SCX, and fibrocartilage markers was examined in the functional mature equine PDL compared with immature and mature equine tendon tissue. PDL samples were obtained from incisor, premolar, and molar teeth from seven adult horses. Additionally, tendon samples were collected from four adult horses and five foals at different sampling locations. Analyses of gene expression were performed using real-time quantitative polymerase chain reaction (qRT-PCR. Significantly higher expression levels of COL1 and 3 were found in the mature equine PDL in comparison with mature tendon, indicating higher rates of collagen production and turnover in the mature equine PDL. The expression levels of SCX, a specific marker for tenogenic-differentiated cells, were on a similar level in functional mature PDL and in mature tendon tissue. Evidence of chondrogenic metaplasia, often found in tendon entheses or in pressurized regions of tendons, was not found in the mature equine PDL. The obtained results justify further experiments focused on the possible use of equine PDL cells for cell-based regenerative therapies.
International Nuclear Information System (INIS)
Zhu, Z; Bi, J; Wang, X; Zhu, W
2014-01-01
As an important sub-topic of the natural process of carbon emission data public information platform construction, coalfield spontaneous combustion of carbon emission WebGIS system has become an important study object. In connection with data features of coalfield spontaneous combustion carbon emissions (i.e. a wide range of data, which is rich and complex) and the geospatial characteristics, data is divided into attribute data and spatial data. Based on full analysis of the data, completed the detailed design of the Oracle database and stored on the Oracle database. Through Silverlight rich client technology and the expansion of WCF services, achieved the attribute data of web dynamic query, retrieval, statistical, analysis and other functions. For spatial data, we take advantage of ArcGIS Server and Silverlight-based API to invoke GIS server background published map services, GP services, Image services and other services, implemented coalfield spontaneous combustion of remote sensing image data and web map data display, data analysis, thematic map production. The study found that the Silverlight technology, based on rich client and object-oriented framework for WCF service, can efficiently constructed a WebGIS system. And then, combined with ArcGIS Silverlight API to achieve interactive query attribute data and spatial data of coalfield spontaneous emmission, can greatly improve the performance of WebGIS system. At the same time, it provided a strong guarantee for the construction of public information on China's carbon emission data
Smart caching based on mobile agent of power WebGIS platform.
Wang, Xiaohui; Wu, Kehe; Chen, Fei
2013-01-01
Power information construction is developing towards intensive, platform, distributed direction with the expansion of power grid and improvement of information technology. In order to meet the trend, power WebGIS was designed and developed. In this paper, we first discuss the architecture and functionality of power WebGIS, and then we study caching technology in detail, which contains dynamic display cache model, caching structure based on mobile agent, and cache data model. We have designed experiments of different data capacity to contrast performance between WebGIS with the proposed caching model and traditional WebGIS. The experimental results showed that, with the same hardware environment, the response time of WebGIS with and without caching model increased as data capacity growing, while the larger the data was, the higher the performance of WebGIS with proposed caching model improved.
GIS based analysis of Intercity Fatal Road Traffic Accidents in Iran.
Alizadeh, A; Zare, M; Darparesh, M; Mohseni, S; Soleimani-Ahmadi, M
2015-01-01
Road traffic accidents including intercity car traffic accidents (ICTAs) are among the most important causes of morbidity and mortality due to the growing number of vehicles, risky behaviors, and changes in lifestyle of the general population. A sound knowledge of the geographical distribution of car traffic accidents can be considered as an approach towards the accident causation and it can be used as an administrative tool in allocating the sources for traffic accidents prevention. This study was conducted to investigate the geographical distribution and the time trend of fatal intercity car traffic accidents in Iran. To conduct this descriptive study, all Iranian intercity road traffic mortality data were obtained from the Police reports in the Statistical Yearbook of the Governor's Budget and Planning. The obtained data were for 17 complete Iranian calendar years from March 1997 to March 2012. The incidence rate (IR) of fatal ICTAs for each year was calculated as the total number of fatal ICTAs in every 100000 population in specified time intervals. Figures and maps indicating the trends and geographical distribution of fatal ICTAs were prepared while using Microsoft Excel and ArcGis9.2 software. The number of fatal car accidents showed a general increasing trend from 3000 in 1996 to 13500 in 2012. The incidence of fatal intercity car accidents has changed from six in 100000 population in 1996 to 18 in 100000 population in 2012. GIS based data showed that the incidence rate of ICTAs in different provinces of Iran was very divergent. The highest incidence of fatal ICTAs was in Semnan province (IR= 35.2), followed by North Khorasan (IR=22.7), and South Khorasan (IR=22). The least incidence of fatal ICTAs was in Tehran province (IR=2.4) followed by Khozestan (IR=6.5), and Eastern Azarbayejan (IR=6.6). The compensation cost of fatal ICTAs also showed an increasing trend during the studied period. Since an increasing amount of money was being paid yearly for the car
GIS based analysis of Intercity Fatal Road Traffic Accidents in Iran
Alizadeh, A; Zare, M; Darparesh, M; Mohseni, S; Soleimani-Ahmadi, M
2015-01-01
Road traffic accidents including intercity car traffic accidents (ICTAs) are among the most important causes of morbidity and mortality due to the growing number of vehicles, risky behaviors, and changes in lifestyle of the general population. A sound knowledge of the geographical distribution of car traffic accidents can be considered as an approach towards the accident causation and it can be used as an administrative tool in allocating the sources for traffic accidents prevention. This study was conducted to investigate the geographical distribution and the time trend of fatal intercity car traffic accidents in Iran. To conduct this descriptive study, all Iranian intercity road traffic mortality data were obtained from the Police reports in the Statistical Yearbook of the Governor’s Budget and Planning. The obtained data were for 17 complete Iranian calendar years from March 1997 to March 2012. The incidence rate (IR) of fatal ICTAs for each year was calculated as the total number of fatal ICTAs in every 100000 population in specified time intervals. Figures and maps indicating the trends and geographical distribution of fatal ICTAs were prepared while using Microsoft Excel and ArcGis9.2 software. The number of fatal car accidents showed a general increasing trend from 3000 in 1996 to 13500 in 2012. The incidence of fatal intercity car accidents has changed from six in 100000 population in 1996 to 18 in 100000 population in 2012. GIS based data showed that the incidence rate of ICTAs in different provinces of Iran was very divergent. The highest incidence of fatal ICTAs was in Semnan province (IR= 35.2), followed by North Khorasan (IR=22.7), and South Khorasan (IR=22). The least incidence of fatal ICTAs was in Tehran province (IR=2.4) followed by Khozestan (IR=6.5), and Eastern Azarbayejan (IR=6.6). The compensation cost of fatal ICTAs also showed an increasing trend during the studied period. Since an increasing amount of money was being paid yearly for the
Higgins, Sara N; Howden, Krista J; James, Carolyn R; Epp, Tasha; Lohmann, Katharina L
2017-12-01
This retrospective study was undertaken to estimate i) the surveillance coverage for equine infectious anemia (EIA) based on owner-requested testing, and ii) the incidence of case detection from this surveillance activity to inform a review of Canada's national disease control strategy. Based on sample submissions by accredited veterinarians to laboratories CFIA-approved for EIA testing between 2009 and 2012, the estimated national surveillance coverage was 14% for all years, and 72 cases of EIA were detected. The annual national incidence of EIA detection ranged from 0.03 to 0.08 cases/1000 horses. On average, a greater proportion of the horse population was tested in eastern Canada (32%) than in western Canada (6%, P Canada (0.25 cases/1000 horses) than in eastern Canada (0.02 cases/1000 horses, P < 0.0001). This study identified regional differences in owner-requested EIA testing and case detection resulting from this testing activity.
Purification of equine Gc-globulin
DEFF Research Database (Denmark)
Houen, Gunnar; Pihl, Tina Holberg; Andersen, Pia Haubro
Objectives With the aim of producing antibodies for an equine Group specific component (Gc)-globulin assay, the protein was purified from normal equine plasma. Methods Equine Gc-globulin was purified from healthy horse plasma using ion exchange chromatography (Q-Sepharose, CM......-Sepharose) and preparative PAGE. Results Equine Gc-globulin has successfully been purified from healthy horse plasma and rabbits and mice are being immunized to produce specific antibodies. Conclusions Purification of equine Gc-globulin and the production of specific antibodies will make it possible to develop an assay...... to be a sensitive marker of acute tissue injury and fatal outcome in humans. Patients with a low plasma concentration of Gc-globulin due to severe tissue injury might potentially benefit from infusions with purified Gc-globulin [1]. With an equine Gc-globulin assay, future studies will investigate the concentration...
Antiherpetic Drugs in Equine Medicine.
Maxwell, Lara K
2017-04-01
Since vaccination may not prevent disease, antiherpetic drugs have been investigated for the therapy of several equine herpesviruses. Drug efficacy has been assessed in horses with disease, but most evidence is in vitro, in other species, or empirical. Oral valacyclovir is most often administered in the therapy of equine herpesvirus type-1 (EHV-1) to protect adult horses from equine herpesvirus myeloencephalopathy, while oral acyclovir is frequently administered for EHV-5 infection in the therapy of equine multinodular pulmonary fibrosis. Other antiherpetic drugs are promising but require further investigation. Several topical drugs are also empirically used in the therapy of equine viral keratitis. Copyright © 2016 Elsevier Inc. All rights reserved.
Kiupel, M; Fitzgerald, S D; Pennick, K E; Cooley, T M; O'Brien, D J; Bolin, S R; Maes, R K; Del Piero, F
2013-11-01
An outbreak of eastern equine encephalomyelitis (EEE) occurred in Michigan free-ranging white-tailed deer (Odocoileus virginianus) during late summer and fall of 2005. Brain tissue from 7 deer with EEE, as confirmed by reverse transcriptase polymerase chain reaction, was studied. Detailed microscopic examination, indirect immunohistochemistry (IHC), and in situ hybridization (ISH) were used to characterize the lesions and distribution of the EEE virus within the brain. The main lesion in all 7 deer was a polioencephalomyelitis with leptomeningitis, which was more prominent within the cerebral cortex, thalamus, hypothalamus, and brainstem. In 3 deer, multifocal microhemorrhages surrounded smaller vessels with or without perivascular cuffing, although vasculitis was not observed. Neuronal necrosis, associated with perineuronal satellitosis and neutrophilic neuronophagia, was most prominent in the thalamus and the brainstem. Positive IHC labeling was mainly observed in the perikaryon, axons, and dendrites of necrotic and intact neurons and, to a much lesser degree, in glial cells, a few neutrophils in the thalamus and the brainstem, and occasionally the cerebral cortex of the 7 deer. There was minimal IHC-based labeling in the cerebellum and hippocampus. ISH labeling was exclusively observed in the cytoplasm of neurons, with a distribution similar to IHC-positive neurons. Neurons positive by IHC and ISH were most prominent in the thalamus and brainstem. The neuropathology of EEE in deer is compared with other species. Based on our findings, EEE has to be considered a differential diagnosis for neurologic disease and meningoencephalitis in white-tailed deer.
Defining Primary Care Shortage Areas: Do GIS-based Measures Yield Different Results?
Daly, Michael R; Mellor, Jennifer M; Millones, Marco
2018-02-12
To examine whether geographic information systems (GIS)-based physician-to-population ratios (PPRs) yield determinations of geographic primary care shortage areas that differ from those based on bounded-area PPRs like those used in the Health Professional Shortage Area (HPSA) designation process. We used geocoded data on primary care physician (PCP) locations and census block population counts from 1 US state to construct 2 shortage area indicators. The first is a bounded-area shortage indicator defined without GIS methods; the second is a GIS-based measure that measures the populations' spatial proximity to PCP locations. We examined agreement and disagreement between bounded shortage areas and GIS-based shortage areas. Bounded shortage area indicators and GIS-based shortage area indicators agree for the census blocks where the vast majority of our study populations reside. Specifically, 95% and 98% of the populations in our full and urban samples, respectively, reside in census blocks where the 2 indicators agree. Although agreement is generally high in rural areas (ie, 87% of the rural population reside in census blocks where the 2 indicators agree), agreement is significantly lower compared to urban areas. One source of disagreement suggests that bounded-area measures may "overlook" some shortages in rural areas; however, other aspects of the HPSA designation process likely mitigate this concern. Another source of disagreement arises from the border-crossing problem, and it is more prevalent. The GIS-based PPRs we employed would yield shortage area determinations that are similar to those based on bounded-area PPRs defined for Primary Care Service Areas. Disagreement rates were lower than previous studies have found. © 2018 National Rural Health Association.
Biomarkers for equine joint injury and osteoarthritis.
McIlwraith, C Wayne; Kawcak, Christopher E; Frisbie, David D; Little, Christopher B; Clegg, Peter D; Peffers, Mandy J; Karsdal, Morten A; Ekman, Stina; Laverty, Sheila; Slayden, Richard A; Sandell, Linda J; Lohmander, L S; Kraus, Virginia B
2018-03-01
We report the results of a symposium aimed at identifying validated biomarkers that can be used to complement clinical observations for diagnosis and prognosis of joint injury leading to equine osteoarthritis (OA). Biomarkers might also predict pre-fracture change that could lead to catastrophic bone failure in equine athletes. The workshop was attended by leading scientists in the fields of equine and human musculoskeletal biomarkers to enable cross-disciplinary exchange and improve knowledge in both. Detailed proceedings with strategic planning was written, added to, edited and referenced to develop this manuscript. The most recent information from work in equine and human osteoarthritic biomarkers was accumulated, including the use of personalized healthcare to stratify OA phenotypes, transcriptome analysis of anterior cruciate ligament (ACL) and meniscal injuries in the human knee. The spectrum of "wet" biomarker assays that are antibody based that have achieved usefulness in both humans and horses, imaging biomarkers and the role they can play in equine and human OA was discussed. Prediction of musculoskeletal injury in the horse remains a challenge, and the potential usefulness of spectroscopy, metabolomics, proteomics, and development of biobanks to classify biomarkers in different stages of equine and human OA were reviewed. The participants concluded that new information and studies in equine musculoskeletal biomarkers have potential translational value for humans and vice versa. OA is equally important in humans and horses, and the welfare issues associated with catastrophic musculoskeletal injury in horses add further emphasis to the need for good validated biomarkers in the horse. © 2017 Orthopaedic Research Society. Published by Wiley Periodicals, Inc. J Orthop Res 36:823-831, 2018. © 2017 Orthopaedic Research Society. Published by Wiley Periodicals, Inc.
GIS-based health assessment of the marine ecosystem in Laizhou Bay, China.
Song, Debin; Gao, Zhiqiang; Zhang, Hua; Xu, Fuxiang; Zheng, Xiangyu; Ai, Jinquan; Hu, Xiaoke; Huang, Guopei; Zhang, Haibo
2017-12-15
According to 2014-2016 monitoring data, an assessment index system including water quality, depositional environment and ecosystem was built to evaluate the health statue of marine ecosystem in the Laizhou Bay using analytic hierarchy process (AHP) method. The results, spatialized in ArcGIS software, show: while the comprehensive ecological health index is 0.62, the ecological environmental quality in the Laizhou Bay is in a sub-healthy state; the unhealthy area is mainly concentrated in southwestern inshore region, and impacted by serious environmental problems, such as water eutrophication and heavy metal pollution; the northwestern and southeastern inshore regions are in a sub-healthy state, while the eastern inshore and northern areas are in the healthiest state. The land-based pollutants that discharge into the sea may be the leading factors that are causing ecological environment deterioration in the Laizhou Bay, and the reclamation work ongoing around the port has exacerbated the ecological risk. Copyright © 2017 Elsevier Ltd. All rights reserved.
GIS4schools: a new approach in GIS education
Demharter, Timo; Michel, Ulrich
2012-10-01
From a didactic point of view the procurement and the application of modern geographical methods and functions become more and more important. Although the integration of GIS in the classroom is repeatedly demanded, inter alia in Baden-Württemberg, Germany, the number of GIS users is small in comparison to other European countries or the USA. Possible reasons for this could, for instance, lie in the lack of GIS and computer knowledge of the teachers themselves and the subsequent extensive training effort in Desktop-GIS (KERSKI 2000, SCHLEICHER 2004). Today you have the technological possibilities to provide the broad public with geoinformation and geotechnology: Web technologies offer access to web-based, mobile and local applications through simple gateways. The objective of the project "GIS4schools" is to generate a service-based infrastructure, which can be operated via mobile clients as well as via Desktop-GIS or a Browser. Due to the easy availability of the services the focus is in particular on students. This circumstance is a novelty through which a differentiated approach to the implementation of GIS in schools is established. Accordingly, the pilot nature of this project becomes apparent as well as its greater importance beyond its actual content especially for the sector of media development at colleges of education. The continuity from Web-GIS to Desktop-GIS is innovative: The goal is to create an adapted multi-level solution which allows both, an easy introduction if desired or a detailed analysis - either to be achieved with a focus especially on students and their cooperation among one another.
Greene, S K
2001-08-01
The reintroduction and development of safe motorized instruments, the increased availability of continuing education, and the understanding and implementation of appropriate procedures allow practitioners to provide better dental care. Veterinarians realize that sedation, analgesia, a full-mouth speculum, and proper instrumentation are necessary to provide these services. Continued instrument design, future research, and new treatment and prophylactic protocols should have a positive impact on the future of equine dental health. New and rediscovered procedures for equilibrating equine occlusion are allowing horses to masticate more efficiently, carry a bit more comfortably, and experience improved performance. The horse, the horse owner, and the veterinary profession all benefit from providing complete equine dental care.
GRASS GIS: The first Open Source Temporal GIS
Gebbert, Sören; Leppelt, Thomas
2015-04-01
GRASS GIS is a full featured, general purpose Open Source geographic information system (GIS) with raster, 3D raster and vector processing support[1]. Recently, time was introduced as a new dimension that transformed GRASS GIS into the first Open Source temporal GIS with comprehensive spatio-temporal analysis, processing and visualization capabilities[2]. New spatio-temporal data types were introduced in GRASS GIS version 7, to manage raster, 3D raster and vector time series. These new data types are called space time datasets. They are designed to efficiently handle hundreds of thousands of time stamped raster, 3D raster and vector map layers of any size. Time stamps can be defined as time intervals or time instances in Gregorian calendar time or relative time. Space time datasets are simplifying the processing and analysis of large time series in GRASS GIS, since these new data types are used as input and output parameter in temporal modules. The handling of space time datasets is therefore equal to the handling of raster, 3D raster and vector map layers in GRASS GIS. A new dedicated Python library, the GRASS GIS Temporal Framework, was designed to implement the spatio-temporal data types and their management. The framework provides the functionality to efficiently handle hundreds of thousands of time stamped map layers and their spatio-temporal topological relations. The framework supports reasoning based on the temporal granularity of space time datasets as well as their temporal topology. It was designed in conjunction with the PyGRASS [3] library to support parallel processing of large datasets, that has a long tradition in GRASS GIS [4,5]. We will present a subset of more than 40 temporal modules that were implemented based on the GRASS GIS Temporal Framework, PyGRASS and the GRASS GIS Python scripting library. These modules provide a comprehensive temporal GIS tool set. The functionality range from space time dataset and time stamped map layer management
Isolation of mesenchymal stem cells from equine umbilical cord blood
DEFF Research Database (Denmark)
Koch, Thomas Gadegaard; Heerkens, Tammy; Thomsen, Preben Dybdahl
2007-01-01
. The hypothesis of this study was that equine MSCs could be isolated from fresh whole equine cord blood. Results: Cord blood was collected from 7 foals immediately after foaling. The mononuclear cell fraction was isolated by Ficoll density centrifugation and cultured in a DMEM low glucose based media at 38.5o......Background: There are no published studies on stem cells from equine cord blood although commercial storage of equine cord blood for future autologous stem cell transplantations is available. Mesenchymal stem cells (MSC) have been isolated from fresh umbilical cord blood of humans collected non......-invasively at the time of birth and from sheep cord blood collected invasively by a surgical intrauterine approach. Mesenchymal stem cells isolation percentage from frozen-thawed human cord blood is low and the future isolation percentage of MSCs from cryopreserved equine cord blood is therefore expectedly low...
Energy Technology Data Exchange (ETDEWEB)
Palmas, Claudia [Cagliari Univ. (Italy). Dept. of Land Engineering; Abis, Emanuela [Cagliari Univ. (Italy). Dept. of Architecture; Haaren, Christina von [Leibniz Univ. of Hannover (Germany). Dept. of Environmental Planning; Lovett, Andrew [East Anglia Univ., Norwich (United Kingdom). School of Environmental Sciences
2011-07-01
In recent years there has been an increasing interest in using micro renewable energy sources to heat and power homes. However, planning has not yet developed methodological approaches for integrating such objectives of optimized energy efficiency with other environmental requirements and concerns of sustainable residential development. This study addresses such integration by first presenting an approach to assess the different potentials of the landscape for generating renewable energy (solar, wind, geothermic, biomass). Subsequently, optimized locations for residential development according to other sustainability criteria are identified and the two sets of results integrated by systematic GIS operations. The methodological approach for evaluating spatial variations in energy potential and producing the energy potential maps was based on existing methods for assessing the energy potential of the landscape which were adapted to the local scale and data availability. In the case of bioenergy potential a new method was developed. Other environmental criteria for deciding about sustainable locations for residential areas with different types of micro generation were identified through a survey of more than 100 expert respondents. This survey involved pairwise comparisons of relevant factors, which were then translated using the Analytical Hierarchy Process into relative weights. Subsequently these weights were applied to factor maps in a GIS via a weighted linear combination method to obtain suitable areas for new settlements and preferred locations for micro renewable technologies in the eastern metropolitan area of Cagliari, Sardinia. (orig.)
GIS4schools: custom-made GIS-applications for educational use
Demharter, Timo; Michel, Ulrich
2013-10-01
From a didactic point of view the procurement and the application of modern geographical methods and functions become more and more important. Although the integration of GIS in the classroom is repeatedly demanded, inter alia in Baden-Württemberg, Germany, the number of GIS users is small in comparison to other European countries or the USA. Possible reasons for this could, for instance, lie in the lack of GIS and computer knowledge of the teachers themselves and the subsequent extensive training effort in Desktop-GIS [1]. Today you have the technological possibilities to provide the broad public with geoinformation and geotechnology: Web technologies offer access to web-based, mobile and local applications through simple gateways. The objective of the project "GIS4schools" is to generate a service-based infrastructure, which can be operated via mobile clients as well as via Desktop-GIS or a Browser. Due to the easy availability of the services the focus is in particular on students. This circumstance is a novelty through which a differentiated approach to the implementation of GIS in schools is established. Accordingly, the pilot nature of this project becomes apparent as well as its greater importance beyond its actual content especially for the sector of media development at colleges of education. The continuity from Web-GIS to Desktop-GIS is innovative: The goal is to create an adapted multi-level solution which allows both, an easy introduction if desired or a detailed analysis - either to be achieved with a focus especially on students and their cooperation among one another.
WebGIS based on semantic grid model and web services
Zhang, WangFei; Yue, CaiRong; Gao, JianGuo
2009-10-01
As the combination point of the network technology and GIS technology, WebGIS has got the fast development in recent years. With the restriction of Web and the characteristics of GIS, traditional WebGIS has some prominent problems existing in development. For example, it can't accomplish the interoperability of heterogeneous spatial databases; it can't accomplish the data access of cross-platform. With the appearance of Web Service and Grid technology, there appeared great change in field of WebGIS. Web Service provided an interface which can give information of different site the ability of data sharing and inter communication. The goal of Grid technology was to make the internet to a large and super computer, with this computer we can efficiently implement the overall sharing of computing resources, storage resource, data resource, information resource, knowledge resources and experts resources. But to WebGIS, we only implement the physically connection of data and information and these is far from the enough. Because of the different understanding of the world, following different professional regulations, different policies and different habits, the experts in different field will get different end when they observed the same geographic phenomenon and the semantic heterogeneity produced. Since these there are large differences to the same concept in different field. If we use the WebGIS without considering of the semantic heterogeneity, we will answer the questions users proposed wrongly or we can't answer the questions users proposed. To solve this problem, this paper put forward and experienced an effective method of combing semantic grid and Web Services technology to develop WebGIS. In this paper, we studied the method to construct ontology and the method to combine Grid technology and Web Services and with the detailed analysis of computing characteristics and application model in the distribution of data, we designed the WebGIS query system driven by
GIS based spatial pattern analysis: Children with Hepatitis A in Turkey.
Dogru, Ahmet Ozgur; David, Ruusa Magano; Ulugtekin, Necla; Goksel, Cigdem; Seker, Dursun Zafer; Sözen, Seval
2017-07-01
This study aimed to provide an insight into the geographic distribution of Hepatitis A incidence considering their temporal distribution, spatial patterns, hot spots and clusters identification in three different age-group (0-4, 5-9 and 10-14) in Turkey. Province based tabular data, including monthly numbers of Hepatitis A cases in children, and the populations from 2001 to 2011 were used as the basic input of the study. Time series maps were created using Geographic Information Systems (GIS) to introduce the temporal changes in the morbidity rates of Hepatitis A. The spatial variation of Hepatitis A was measured using Moran's I at the global level and the local indicators of spatial associations (LISAs) Moran's I and Getis-Ord G i *(d) in order to identify influential locations through clusters and hot spots detection of Hepatitis A cases. The morbidity rates in children under the age of 5 were found significantly lower than the other age-groups, whereas the age-group 5-9 revealed the highest morbidity rates in the study area. The morbidity of Hepatitis A was detected very high for the years 2001, and 2005-2007. The identification of the highly vulnerable provinces was conducted using local Moran's I and local Getis-Ord G i *(d). The majority of clusters and hot spots were detected to be agglomerated in the Eastern Mediterranean and South-Eastern Anatolian Regions and Ceyhan, Asi and Southeast part of Firat-Dicle river basins in Turkey. Copyright © 2017 Elsevier Inc. All rights reserved.
Analysis Of Educational Services Distribution-Based Geographic Information System GIS
Waleed Lagrab; Noura AKNIN
2015-01-01
Abstract This study analyzes the spatial distribution of kindergarten facilities in the study area based on the Geographic Information Systems GIS in order to test an efficiency of GIS technology to redistribute the existing kindergarten and choose the best location in the future and applying the standard criteria for selecting the suitable locations for kindergarten. To achieve this goal the data and information are collected via interviews and comprehensive statistics on the education facil...
Highway traffic noise prediction based on GIS
Zhao, Jianghua; Qin, Qiming
2014-05-01
Before building a new road, we need to predict the traffic noise generated by vehicles. Traditional traffic noise prediction methods are based on certain locations and they are not only time-consuming, high cost, but also cannot be visualized. Geographical Information System (GIS) can not only solve the problem of manual data processing, but also can get noise values at any point. The paper selected a road segment from Wenxi to Heyang. According to the geographical overview of the study area and the comparison between several models, we combine the JTG B03-2006 model and the HJ2.4-2009 model to predict the traffic noise depending on the circumstances. Finally, we interpolate the noise values at each prediction point and then generate contours of noise. By overlaying the village data on the noise contour layer, we can get the thematic maps. The use of GIS for road traffic noise prediction greatly facilitates the decision-makers because of GIS spatial analysis function and visualization capabilities. We can clearly see the districts where noise are excessive, and thus it becomes convenient to optimize the road line and take noise reduction measures such as installing sound barriers and relocating villages and so on.
Lifescience Database Archive (English)
Full Text Available H01535 Eastern equine encephalitis Eastern equine encephalitis virus (EEEV) is imp...o, Culiseta melanura. Eastern equine encephalitis is the most severe neuroinvasiv...e arboviral infection in the United States, frequently progressing to coma and death. Infectious disease ... Eastern equine...eaver SC ... TITLE ... Evolutionary patterns of eastern equine encephalitis virus in North versus South Americ...D, Hassan HK, McClure CJ, Unnasch TR ... TITLE ... Field investigations of winter transmission of eastern equine
Bachi, Keren
2013-01-01
Equine-facilitated prison programs have become more prevalent and operate in correctional facilities in 13 states throughout the United States. However, there is a deficit of empirical knowledge to guide them. This article reviews 19 studies of prison-based animal programs and centers on patterns in the literature. It reveals how previous studies…
Evaluating terrain based criteria for snow avalanche exposure ratings using GIS
Delparte, Donna; Jamieson, Bruce; Waters, Nigel
2010-05-01
Snow avalanche terrain in backcountry regions of Canada is increasingly being assessed based upon the Avalanche Terrain Exposure Scale (ATES). ATES is a terrain based classification introduced in 2004 by Parks Canada to identify "simple", "challenging" and "complex" backcountry areas. The ATES rating system has been applied to well over 200 backcountry routes, has been used in guidebooks, trailhead signs and maps and is part of the trip planning component of the AVALUATOR™, a simple decision-support tool for backcountry users. Geographic Information Systems (GIS) offers a means to model and visualize terrain based criteria through the use of digital elevation model (DEM) and land cover data. Primary topographic variables such as slope, aspect and curvature are easily derived from a DEM and are compatible with the equivalent evaluation criteria in ATES. Other components of the ATES classification are difficult to extract from a DEM as they are not strictly terrain based. An overview is provided of the terrain variables that can be generated from DEM and land cover data; criteria from ATES which are not clearly terrain based are identified for further study or revision. The second component of this investigation was the development of an algorithm for inputting suitable ATES criteria into a GIS, thereby mimicking the process avalanche experts use when applying the ATES classification to snow avalanche terrain. GIS based classifications were compared to existing expert assessments for validity. The advantage of automating the ATES classification process through GIS is to assist avalanche experts with categorizing and mapping remote backcountry terrain.
Sun, Siqi; Xiao, Yi; Guo, Luo
2018-02-01
Eastern Sichuan Basin is one of the areas sensitive to global climate change. Due to impacts from human disturbance, the farmland in the study area has been degrading, and the desertification of land has been expanding rapidly. Based on the data of Landsat TM/ETM image in 1990, 1995, 2000, 2005 and 2010, this thesis analysed the spatial characteristics and dynamic trends of land use pattern in eastern Sichuan basin using software for remote sense and geographical information system. The driving factors of land-use change in study area were also discussed. The results indicated that: (i) the area of farmland has significantly decreased because of degradation and conversion from grassland into building land; (ii) farmland patches have changed into fragmented and isolated ones; (iii) the main landscapes in study area, are farmland and forests; (iv) land-use change is significantly associated with the human activities. This study provides a strong theoretical and technical basis for the policy-making of environmental protection and management in Eastern Sichuan Basin of Sichuan Province in china.
Directory of Open Access Journals (Sweden)
Ioanna Papadopoulou
2012-09-01
Full Text Available For civil protection reasons there is a strong need to improve the inventory of areas that are more vulnerable to earthquake ground motions or to earthquake-related secondary effects, such as landslides, liquefaction or soil amplifications. The use of remote sensing and Geographic Information Systems (GIS methods along with the related geo-databases can assist local and national authorities to be better prepared and organized. Remote sensing and GIS techniques are investigated in north-eastern Greece in order to contribute to the systematic, standardized inventory of those areas that are more susceptible to earthquake ground motions, to earthquake-related secondary effects and to tsunami-waves. Knowing areas with aggregated occurrence of causal (“negative” factors influencing earthquake shock and, thus, the damage intensity, this knowledge can be integrated into disaster preparedness and mitigation measurements. The evaluation of satellite imageries, digital topographic data and open source geodata contributes to the acquisition of the specific tectonic, geologic and geomorphologic settings influencing local site conditions in an area and, thus, estimate possible damage to be suffered.
Vendrig, J C; Coffeng, L E; Fink-Gremmels, J
2012-12-01
Increasing evidence suggests that reactions to lipopolysaccharide (LPS), particularly in the gut, can be partly or completely mitigated by colostrum- and milk-derived oligosaccharides. Confirmation of this hypothesis could lead to the development of new therapeutic concepts. To demonstrate the influence of equine colostral carbohydrates on the inflammatory response in an in vitro model with equine peripheral blood mononuclear cells (PBMCs). Carbohydrates were extracted from mare colostrum, and then evaluated for their influence on LPS-induced inflammatory responses in PBMCs isolated from the same mares, mRNA expression of tumour necrosis factor-alpha, interleukin-6 and interleukin-10 was measured as well as the protein levels of tumour necrosis factor-alpha (TNF-alpha) and interleukin-10 (IL-10). Equine colostral carbohydrates significantly reduced LPS-induced TNF-alpha protein at both times measured and significantly reduced LPS-induced TNF-alpha, IL-6 and IL-10 mRNA expression by PBMCs. Moreover, cell viability significantly increased in the presence of high concentrations of colostral carbohydrates. Carbohydrates derived from equine colostrum reduce LPS-induced inflammatory responses of equine PBMCs. Colostrum and milk-derived carbohydrates are promising candidates for new concepts in preventive and regenerative medicine.
GIS-based landscape design research: Stourhead landscape garden as a case study
Directory of Open Access Journals (Sweden)
Steffen Nijhuis
2017-11-01
Full Text Available Landscape design research is important for cultivating spatial intelligence in landscape architecture. This study explores GIS (geographic information systems as a tool for landscape design research - investigating landscape designs to understand them as architectonic compositions (architectonic plan analysis. The concept ‘composition’ refers to a conceivable arrangement, an architectural expression of a mental construct that is legible and open to interpretation. Landscape architectonic compositions and their representations embody a great wealth of design knowledge as objects of our material culture and reflect the possible treatment of the ground, space, image and program as a characteristic coherence. By exploring landscape architectonic compositions with GIS, design researchers can acquire design knowledge that can be used in the creation and refinement of a design. The research aims to identify and illustrate the potential role of GIS as a tool in landscape design research, so as to provide insight into the possibilities and limitations of using GIS in this capacity. The critical, information-oriented case of Stourhead landscape garden (Wiltshire, UK, an example of a designed landscape that covers the scope and remit of landscape architecture design, forms the heart of the study. The exploration of Stourhead by means of GIS can be understood as a plausibility probe. Here the case study is considered a form of ‘quasi-experiment’, testing the hypothesis and generating a learning process that constitutes a prerequisite for advanced understanding, while using an adjusted version of the framework for landscape design analysis by Steenbergen and Reh (2003. This is a theoretically informed analytical method based on the formal interpretation of the landscape architectonic composition addressing four landscape architectonic categories: the basic, the spatial, the symbolic and the programmatic form. This study includes new aspects to be
GIS Based Measurement and Regulatory Zoning of Urban Ecological Vulnerability
Directory of Open Access Journals (Sweden)
Xiaorui Zhang
2015-07-01
Full Text Available Urban ecological vulnerability is measured on the basis of ecological sensitivity and resilience based on the concept analysis of vulnerability. GIS-based multicriteria decision analysis (GIS-MCDA methods are used, supported by the spatial analysis tools of GIS, to define different levels of vulnerability for areas of the urban ecology. These areas are further classified into different types of regulatory zones. Taking the city of Hefei in China as the empirical research site, this study uses GIS-MCDA, including the index system, index weights and overlay rules, to measure the degree of its ecological vulnerability on the GIS platform. There are eight indices in the system. Raking and analytical hierarchy process (AHP methods are used to calculate index weights according to the characteristics of the index system. The integrated overlay rule, including selection of the maximum value, and weighted linear combination (WLC are applied as the overlay rules. In this way, five types of vulnerability areas have been classified as follows: very low vulnerability, low vulnerability, medium vulnerability, high vulnerability and very high vulnerability. They can be further grouped into three types of regulatory zone of ecological green line, ecological grey line and ecological red line. The study demonstrates that ecological green line areas are the largest (53.61% of the total study area and can be intensively developed; ecological grey line areas (19.59% of the total area can serve as the ecological buffer zone, and ecological red line areas (26.80% cannot be developed and must be protected. The results indicate that ecological green line areas may provide sufficient room for future urban development in Hefei city. Finally, the respective regulatory countermeasures are put forward. This research provides a scientific basis for decision-making around urban ecological protection, construction and sustainable development. It also provides theoretical method
Security attack detection algorithm for electric power gis system based on mobile application
Zhou, Chao; Feng, Renjun; Wang, Liming; Huang, Wei; Guo, Yajuan
2017-05-01
Electric power GIS is one of the key information technologies to satisfy the power grid construction in China, and widely used in power grid construction planning, weather, and power distribution management. The introduction of electric power GIS based on mobile applications is an effective extension of the geographic information system that has been widely used in the electric power industry. It provides reliable, cheap and sustainable power service for the country. The accurate state estimation is the important conditions to maintain the normal operation of the electric power GIS. Recent research has shown that attackers can inject the complex false data into the power system. The injection attack of this new type of false data (load integrity attack LIA) can successfully bypass the routine detection to achieve the purpose of attack, so that the control center will make a series of wrong decision. Eventually, leading to uneven distribution of power in the grid. In order to ensure the safety of the electric power GIS system based on mobile application, it is very important to analyze the attack mechanism and propose a new type of attack, and to study the corresponding detection method and prevention strategy in the environment of electric power GIS system based on mobile application.
Lifescience Database Archive (English)
Full Text Available 7|POLS_EEEVF Structural polyprotein OS=Eastern equine encephalitis virus (strain Florida 91-469) Align lengt...icant alignments: (bits) Value sp|Q4QXJ7|POLS_EEEVF Structural polyprotein OS=Eastern equine en... 30 4.9 sp...|P08768|POLS_EEEV Structural polyprotein OS=Eastern equine enc... 30 4.9 sp|P27284|POLS_EEEV3 Structural polyprotein OS=Eastern equin...e en... 29 6.5 >sp|Q4QXJ7|POLS_EEEVF Structural polyprotein OS=Eastern equine...68|POLS_EEEV Structural polyprotein OS=Eastern equine encephalitis virus PE=2 SV=1 Length = 1239 Score = 29.
2008-01-01
The equine industries in Ireland are vibrant and growing. They are broadly classified into two sectors: Thoroughbred racing, and sports and leisure. This paper describes these sectors in terms of governance, education and training in equine welfare, and available data concerning horse numbers, identification, traceability and disposal. Animal welfare, and specifically equine welfare, has received increasing attention internationally. There is general acceptance of concepts such as animal needs and persons' responsibilities toward animals in their care, as expressed in the 'Five Freedoms'. As yet, little has been published on standards of equine welfare pertaining to Ireland, or on measures to address welfare issues here. This paper highlights the central role of horse identification and legal registration of ownership to safeguard the health and welfare of horses. PMID:21851704
Directory of Open Access Journals (Sweden)
Collins J
2008-11-01
Full Text Available Abstract The equine industries in Ireland are vibrant and growing. They are broadly classified into two sectors: Thoroughbred racing, and sports and leisure. This paper describes these sectors in terms of governance, education and training in equine welfare, and available data concerning horse numbers, identification, traceability and disposal. Animal welfare, and specifically equine welfare, has received increasing attention internationally. There is general acceptance of concepts such as animal needs and persons' responsibilities toward animals in their care, as expressed in the 'Five Freedoms'. As yet, little has been published on standards of equine welfare pertaining to Ireland, or on measures to address welfare issues here. This paper highlights the central role of horse identification and legal registration of ownership to safeguard the health and welfare of horses.
International Nuclear Information System (INIS)
Han Shaoyang; Ke Dan; Hu Shuiqing; Guo Qingyin; Hou Huiqun
2005-01-01
The integrated prediction model of sandstone-type uranium deposits and its integrated evaluation methods as well as flow of the work based on GIS are studied. A software for extracting metallogenic information is also developed. A multi-source exploring information database is established in the northwest of Ordos Basin, and an integrated digital mineral deposit prospecting model of sandstone-type uranium deposits is designed based on GIS. The authors have completed metallogenic information extraction and integrated evaluation of sandstone-type uranium deposits based on GIS in the study area. Research results prove that the integrated prediction of sandstone-type uranium deposits based on GIS may further delineate prospective target areas rapidly and improve the predictive precision. (authors)
Geography and Timing of Cases of Eastern Equine Encephalitis in New York State from 1992 to 2012.
Oliver, JoAnne; Lukacik, Gary; Kramer, Laura D; Backenson, P Bryon; Sherwood, James A; Howard, John J
2016-04-01
In New York State (NYS), Eastern equine encephalitis (EEE) was first reported in a human in 1971, in horses in 1970, and in pheasants in 1952. Following work for the interval from 1970 to 1991, we identified cases in vertebrates from 1992 to 2012, through a passive surveillance system involving veterinarians in clinical practice, county health departments, and the Departments of Agriculture and Markets, Environmental Conservation, and Health, of the State of New York. During an 11-year hiatus, from 1992 to 2002, no case in any vertebrate was observed. In a re-emergence, from 2003 to 2012, disease occurred in 12 counties, including 7 counties where disease had never been documented. Vertebrate cases included 4 cases in humans and 77 nonhuman occurrences; in 58 horses, Equus ferus caballus L.; 2 deer, Odocoileus virginianus Zimmermann; 6 dogs, Canis familiaris; 10 birds; and 1 flock of pheasants, Phasianus colchicus L. These were the first reported cases in NYS in white-tailed deer, the domestic dog, and in five species of birds: American crow, Corvus brachyrhynchos Brehm; American goldfinch, Carduelis tristis L.; bald eagle, Haliaeetus leucocephalus L.; blue jay, Cyanocitta cristata (L.); and red-tailed hawk, Buteo jamaicensis Gmelin. One crow was dually infected with EEE virus and West Nile virus. The northern, southern, and southeastern borders of the state were newly affected. The geographic area, time periods, and vertebrate species with risk of EEE disease expanded from 1992 to 2012.
Study of Earthquake Disaster Prediction System of Langfang city Based on GIS
Huang, Meng; Zhang, Dian; Li, Pan; Zhang, YunHui; Zhang, RuoFei
2017-07-01
In this paper, according to the status of China’s need to improve the ability of earthquake disaster prevention, this paper puts forward the implementation plan of earthquake disaster prediction system of Langfang city based on GIS. Based on the GIS spatial database, coordinate transformation technology, GIS spatial analysis technology and PHP development technology, the seismic damage factor algorithm is used to predict the damage of the city under different intensity earthquake disaster conditions. The earthquake disaster prediction system of Langfang city is based on the B / S system architecture. Degree and spatial distribution and two-dimensional visualization display, comprehensive query analysis and efficient auxiliary decision-making function to determine the weak earthquake in the city and rapid warning. The system has realized the transformation of the city’s earthquake disaster reduction work from static planning to dynamic management, and improved the city’s earthquake and disaster prevention capability.
Innate immune responses of equine monocytes cultured in equine platelet lysate.
Naskou, Maria C; Norton, Natalie A; Copland, Ian B; Galipeau, Jacques; Peroni, John F
2018-01-01
Platelet lysate (PL) has been extensively used for the laboratory expansion of human mesenchymal stem cells (MSC) in order to avoid fetal bovine serum (FBS) which has been associated with immune-mediated host reactions and transmission of bovine-origin microbial contaminants. Before suggesting the routine use of PL for MSC culture, we wanted to further investigate whether PL alone might trigger inflammatory responses when exposed to reactive white blood cells such as monocytes. Our objectives were to evaluate the inflammatory profile of equine monocytes cultured with equine PL (ePL) and to determine if ePL can modulate the expression of inflammatory cytokines in lipopolysaccharide (LPS)-stimulated monocytes. In a first experiment, equine monocytes were isolated and incubated with donor horse serum (DHS), FBS, six individual donors ePL or pooled ePL from all horses. In a second experiment, monocytes were stimulated with E. coli LPS in the presence of 1, 5 or 10% DHS and/or pooled ePL. After 6h of incubation, cell culture supernatants were assayed via ELISA for production of the pro-inflammatory cytokines tumor necrosis factor alpha (TNF-α) and Interleukin 1β (IL-1β) as well as for the anti-inflammatory Interleukin 10 (IL-10). Equine monocytes incubated with pooled ePL produced significantly less TNF-α and significantly more IL-10 than monocytes incubated in FBS. A statistically significant difference was not identified for the production of IL-1β. The second experiment showed that pooled ePL added to LPS-stimulated equine monocytes resulted in a significant reduction in TNF-α and IL-1β production. IL-10 production was not significantly upregulated by the addition of ePL to LPS-stimulated monocytes. Finally, the addition of ePL to LPS-stimulated monocytes in the presence of various concentrations of DHS resulted to statistically significant decrease of TNF-α and IL-1β compared to the control groups. This is the first study to demonstrate that ePL suppresses
Restriction of Equine Infectious Anemia Virus by Equine APOBEC3 Cytidine Deaminases ▿ †
Zielonka, Jörg; Bravo, Ignacio G.; Marino, Daniela; Conrad, Elea; Perković, Mario; Battenberg, Marion; Cichutek, Klaus; Münk, Carsten
2009-01-01
The mammalian APOBEC3 (A3) proteins comprise a multigene family of cytidine deaminases that act as potent inhibitors of retroviruses and retrotransposons. The A3 locus on the chromosome 28 of the horse genome contains multiple A3 genes: two copies of A3Z1, five copies of A3Z2, and a single copy of A3Z3, indicating a complex evolution of multiple gene duplications. We have cloned and analyzed for expression the different equine A3 genes and examined as well the subcellular distribution of the corresponding proteins. Additionally, we have tested the functional antiretroviral activity of the equine and of several of the human and nonprimate A3 proteins against the Equine infectious anemia virus (EIAV), the Simian immunodeficiency virus (SIV), and the Adeno-associated virus type 2 (AAV-2). Hematopoietic cells of horses express at least five different A3s: A3Z1b, A3Z2a-Z2b, A3Z2c-Z2d, A3Z2e, and A3Z3, whereas circulating macrophages, the natural target of EIAV, express only part of the A3 repertoire. The five A3Z2 tandem copies arose after three consecutive, recent duplication events in the horse lineage, after the split between Equidae and Carnivora. The duplicated genes show different antiviral activities against different viruses: equine A3Z3 and A3Z2c-Z2d are potent inhibitors of EIAV while equine A3Z1b, A3Z2a-Z2b, A3Z2e showed only weak anti-EIAV activity. Equine A3Z1b and A3Z3 restricted AAV and all equine A3s, except A3Z1b, inhibited SIV. We hypothesize that the horse A3 genes are undergoing a process of subfunctionalization in their respective viral specificities, which might provide the evolutionary advantage for keeping five copies of the original gene. PMID:19458006
GIS-Based bivariate statistical techniques for groundwater potential ...
Indian Academy of Sciences (India)
24
This study shows the potency of two GIS-based data driven bivariate techniques namely ... In the view of these weaknesses , there is a strong requirement for reassessment of .... Font color: Text 1, Not Expanded by / Condensed by , ...... West Bengal (India) using remote sensing, geographical information system and multi-.
GIS-BASED PREDICTION OF HURRICANE FLOOD INUNDATION
Energy Technology Data Exchange (ETDEWEB)
JUDI, DAVID [Los Alamos National Laboratory; KALYANAPU, ALFRED [Los Alamos National Laboratory; MCPHERSON, TIMOTHY [Los Alamos National Laboratory; BERSCHEID, ALAN [Los Alamos National Laboratory
2007-01-17
A simulation environment is being developed for the prediction and analysis of the inundation consequences for infrastructure systems from extreme flood events. This decision support architecture includes a GIS-based environment for model input development, simulation integration tools for meteorological, hydrologic, and infrastructure system models and damage assessment tools for infrastructure systems. The GIS-based environment processes digital elevation models (30-m from the USGS), land use/cover (30-m NLCD), stream networks from the National Hydrography Dataset (NHD) and soils data from the NRCS (STATSGO) to create stream network, subbasins, and cross-section shapefiles for drainage basins selected for analysis. Rainfall predictions are made by a numerical weather model and ingested in gridded format into the simulation environment. Runoff hydrographs are estimated using Green-Ampt infiltration excess runoff prediction and a 1D diffusive wave overland flow routing approach. The hydrographs are fed into the stream network and integrated in a dynamic wave routing module using the EPA's Storm Water Management Model (SWMM) to predict flood depth. The flood depths are then transformed into inundation maps and exported for damage assessment. Hydrologic/hydraulic results are presented for Tropical Storm Allison.
Methodology for a GIS-based damage assessment for researchers following large scale disasters
Crawford, Patrick Shane
The 1990s were designated the International Decade for Natural Disaster Reduction by the United Nations General Assembly. This push for decrease of loss of life, property destruction, and social and economic disruption brought advancements in disaster management, including damage assessment. Damage assessment in the wake of natural and manmade disasters is a useful tool for government agencies, insurance companies, and researchers. As technologies evolve damage assessment processes constantly evolve as well. Alongside the advances in Geographic Information Systems (GIS), remote sensing, and Global Positioning System (GPS) technology, as well as the growing awareness of the needs of a standard operating procedure for GIS-based damage assessment and a need to make the damage assessment process as quick and accurate as possible, damage assessment procedures are becoming easier to execute and the results are becoming more accurate and robust. With these technological breakthroughs, multi-disciplinary damage assessment reconnaissance teams have become more efficient in their assessment methods through better organization and more robust through addition of new datasets. Damage assessment personnel are aided by software tools that offer high-level analysis and increasingly rapid damage assessment methods. GIS software has advanced the damage assessment methods of these teams by combining remotely sensed aerial imagery, GPS, and other technologies to expand the uses of the data. GIS allows researchers to use aerial imagery to show field collected data in the geographic location that it was collected so that information can be revisited, measurements can be taken, and data can be disseminated to other researchers and the public. The GIS-based data available to the reconnaissance team includes photographs of damage, worksheets, calculations, voice messages collected while studying the affected area, and many other datasets which are based on the type of disaster and the
2012-01-31
equine encephalitis in the Amazon region of Peru ." Am J Trop Med Hyg 76(2): 293-298. Alsharifi, M., Y. Furuya, et al. (2009). "Intranasal flu...the Amazon River Basin. The strains in these groups are highly divergent, polyphyletic, co- circulating, geographically-associated, and primarily...well understood and serological associations with wild birds, ground-dwelling rodents , marsupials, and reptiles have been reported (Monath, Sabattini
Microdialysis in equine research
DEFF Research Database (Denmark)
Sørensen, Mette Aamand; Jacobsen, Stine; Petersen, Lars Jelstrup
2013-01-01
and cerebrospinal fluid and blood. Only a few papers have been published within each area, indicating that few equine researchers are aware of the unique opportunities provided by the technique. This review discusses the theory and applications of microdialysis with a special emphasis on clinical and experimental...... equine studies, which may be useful to veterinary experimental and clinical researchers....
Scintigraphy in equine practice
International Nuclear Information System (INIS)
Fulton, I.C.; Anderson, B.
2002-01-01
The most common use for nuclear medicine in equine practice is bone imaging using technetium 99m as the radionuclide. This article will describe establishment of a facility to perform equine scintigraphy, the peculiarities associated with nuclear medicine and horses and describe a variety of the pathology we identify using scintigraphy. Copyright (2002) The Australian and New Zealand Society of Nuclear Medicine Inc
GIS-Based Population Model Applied to Nevada Transportation Routes
International Nuclear Information System (INIS)
Mills, G.S.; Neuhauser, K.S.
1999-01-01
Recently, a model based on geographic information system (GIS) processing of US Census Block data has made high-resolution population analysis for transportation risk analysis technically and economically feasible. Population density bordering each kilometer of a route may be tabulated with specific route sections falling into each of three categories (Rural, Suburban or Urban) identified for separate risk analysis. In addition to the improvement in resolution of Urban areas along a route, the model provides a statistically-based correction to population densities in Rural and Suburban areas where Census Block dimensions may greatly exceed the 800-meter scale of interest. A semi-automated application of the GIS model to a subset of routes in Nevada (related to the Yucca Mountain project) are presented, and the results compared to previous models including a model based on published Census and other data. These comparisons demonstrate that meaningful improvement in accuracy and specificity of transportation risk analyses is dependent on correspondingly accurate and geographically-specific population density data
GIS Teacher Training: Empirically-Based Indicators of Effectiveness
Höhnle, Steffen; Fögele, Janis; Mehren, Rainer; Schubert, Jan Christoph
2016-01-01
In spite of various actions, the implementation of GIS (geographic information systems) in German schools is still very low. In the presented research, teaching experts as well as teaching novices were presented with empirically based constraints for implementation stemming from an earlier survey. In the process of various group discussions, the…
Development of geophysical and geochemical data processing software based on component GIS
International Nuclear Information System (INIS)
Ke Dan; Yu Xiang; Wu Qubo; Han Shaoyang; Li Xi
2013-01-01
Based on component GIS and mixed programming techniques, a software which combines the basic GIS functions, conventional and unconventional data process methods for the regional geophysical and geochemical data together, is designed and developed. The software has many advantages, such as friendly interface, easy to use and utility functions and provides a useful platform for regional geophysical and geochemical data processing. (authors)
ASPEN Plus based simulation models have been developed to design a pyrolysis process for the on-site production and utilization of pyrolysis oil from equine waste at the Equine Rehabilitation Center at Morrisville State College (MSC). The results indicate that utilization of all available Equine Reh...
Lifescience Database Archive (English)
Full Text Available H00379 Mosquito-borne viral encephalitis, including: Japanese encephalitis [DS:H01533]; Western equine... encephalitis [DS:H01534]; Eastern equine encephalitis [DS:H01535]; Australian encephali...0052] (Japanese encephalitis) Western equine encephalitis virus [GN:T40053] (Western equine encephalitis) Eastern equine... encephalitis virus [GN:T40054] (Eastern equine encephalitis) Murray
Advances in equine dental radiology.
Baratt, Robert
2013-08-01
Although diagnostic images can be obtained with traditional rare-earth film-screen combinations, digital radiography (DR) has enhanced the ability of the general practitioner to obtain diagnostic radiographs of the equine head. With the widespread availability of DR in equine practices, the practitioner can more readily learn the correct positioning for the various projections of the equine head that are used to evaluate the dentition and sinuses. Digital systems provide rapid processing of the image, enabling the practitioner to correct positioning errors and retake the image without significant delay. Copyright © 2013 Elsevier Inc. All rights reserved.
GIS-Based Planning and Modeling for Renewable Energy: Challenges and Future Research Avenues
Directory of Open Access Journals (Sweden)
Bernd Resch
2014-05-01
Full Text Available In the face of the broad political call for an “energy turnaround”, we are currently witnessing three essential trends with regard to energy infrastructure planning, energy generation and storage: from planned production towards fluctuating production on the basis of renewable energy sources, from centralized generation towards decentralized generation and from expensive energy carriers towards cost-free energy carriers. These changes necessitate considerable modifications of the energy infrastructure. Even though most of these modifications are inherently motivated by geospatial questions and challenges, the integration of energy system models and Geographic Information Systems (GIS is still in its infancy. This paper analyzes the shortcomings of previous approaches in using GIS in renewable energy-related projects, extracts distinct challenges from these previous efforts and, finally, defines a set of core future research avenues for GIS-based energy infrastructure planning with a focus on the use of renewable energy. These future research avenues comprise the availability base data and their “geospatial awareness”, the development of a generic and unified data model, the usage of volunteered geographic information (VGI and crowdsourced data in analysis processes, the integration of 3D building models and 3D data analysis, the incorporation of network topologies into GIS, the harmonization of the heterogeneous views on aggregation issues in the fields of energy and GIS, fine-grained energy demand estimation from freely-available data sources, decentralized storage facility planning, the investigation of GIS-based public participation mechanisms, the transition from purely structural to operational planning, data privacy aspects and, finally, the development of a new dynamic power market design.
ANALYSIS OF LAND RESOURCES SUITABILITY BY FUNCTIONAL MODEL IN EASTERN CROATIA REGION
Directory of Open Access Journals (Sweden)
Vladimir Vukadinović
2011-06-01
Full Text Available A total of 17405 soil samples (2003rd-2009th years were analyzed in the eastern part of Croatia. The aim of this paper is to assess land suitability for crops i.e. to describe quantitatively land quality and indicate disadvantages of land using system in investigated area. The described mathematical model uses score functions for estimating indicators of soil suitability. Soil suitability assessment computer model for crops, supported by GIS, proved to be fast, efficient and enough reliable. Using GIS tool it is possible to visualize land suitability and present it in different cartographic bases such as maps whereas using geostatistical method – kriging enables to possible to provide regionalization of production area based on quantitative assessment of land suitability for crops.
B. Heim; Jens Klump; N. Fagel; Hedi Oberhänsli
2008-01-01
Web-based Geographical Information Systems (GIS) are excellent tools within interdisciplinary and multi-national geoscience projects to exchange and visualize project data. The web-based GIS presented in this paper was designed for the paleolimnological project 'High-resolution CONTINENTal paleoclimate record in Lake Baikal' (CONTINENT) (Lake Baikal, Siberia, Russia) to allow the interactive handling of spatial data. The GIS database combines project data (core positions, sample positions, th...
76 FR 55213 - Commercial Transportation of Equines to Slaughter
2011-09-07
.... APHIS-2006-0168] RIN 0579-AC49 Commercial Transportation of Equines to Slaughter AGENCY: Animal and... regarding the commercial transportation of equines to slaughter to add a definition of equine for slaughter... of equines in commercial transportation to slaughter are met. DATES: Effective Date: October 7, 2011...
Marketing your equine practice.
Magnus, Robert P
2009-12-01
The take-home message in marketing your equine practice is simple: understand your position in the target market and the buying behavior of your current and prospective customers. Time well spent on analysis and evaluation of options can maximize customer value in the services and products you offer. This allows you to capture profit and to attain your personal and professional goals as an equine practitioner.
GIS-based assessment of landslide susceptibility using certainty ...
Indian Academy of Sciences (India)
tion systems (GIS) using different models. Many of these ... as spatial multicriteria decision analysis (MCDA) approach ... 2013), support vec- ... Landslide susceptibility assessment using mathematical methods in GIS, Qianyang China 1401.
A web GIS based integrated flood assessment modeling tool for coastal urban watersheds
Kulkarni, A. T.; Mohanty, J.; Eldho, T. I.; Rao, E. P.; Mohan, B. K.
2014-03-01
Urban flooding has become an increasingly important issue in many parts of the world. In this study, an integrated flood assessment model (IFAM) is presented for the coastal urban flood simulation. A web based GIS framework has been adopted to organize the spatial datasets for the study area considered and to run the model within this framework. The integrated flood model consists of a mass balance based 1-D overland flow model, 1-D finite element based channel flow model based on diffusion wave approximation and a quasi 2-D raster flood inundation model based on the continuity equation. The model code is written in MATLAB and the application is integrated within a web GIS server product viz: Web Gram Server™ (WGS), developed at IIT Bombay, using Java, JSP and JQuery technologies. Its user interface is developed using open layers and the attribute data are stored in MySQL open source DBMS. The model is integrated within WGS and is called via Java script. The application has been demonstrated for two coastal urban watersheds of Navi Mumbai, India. Simulated flood extents for extreme rainfall event of 26 July, 2005 in the two urban watersheds of Navi Mumbai city are presented and discussed. The study demonstrates the effectiveness of the flood simulation tool in a web GIS environment to facilitate data access and visualization of GIS datasets and simulation results.
Automatic segmentation of equine larynx for diagnosis of laryngeal hemiplegia
Salehin, Md. Musfequs; Zheng, Lihong; Gao, Junbin
2013-10-01
This paper presents an automatic segmentation method for delineation of the clinically significant contours of the equine larynx from an endoscopic image. These contours are used to diagnose the most common disease of horse larynx laryngeal hemiplegia. In this study, hierarchal structured contour map is obtained by the state-of-the-art segmentation algorithm, gPb-OWT-UCM. The conic-shaped outer boundary of equine larynx is extracted based on Pascal's theorem. Lastly, Hough Transformation method is applied to detect lines related to the edges of vocal folds. The experimental results show that the proposed approach has better performance in extracting the targeted contours of equine larynx than the results of using only the gPb-OWT-UCM method.
Strizki, J M; Repik, P M
1995-11-01
Eastern equine encephalitis (EEE) virus is a mosquito-borne alphavirus that can produce a severe and often fatal acute encephalitis in humans, with significant neurologic sequelae in survivors. Due to the serious nature of the disease, an investigational inactivated EEE vaccine (PE-6) is available to individuals at risk for infection. Both serologic and recent molecular analyses of EEE viruses have demonstrated marked differences between the two antigenic varieties of EEE virus, designated North American (NA) and South American (SA). In view of these findings, we have examined the reactivity of sera from three individuals immunized with the EEE vaccine, derived from an NA isolate, with field strains of EEE virus. Anti-EEE serum antibodies from vaccinees reacted strongly in Western blot assays with both of the envelope (E1 and E2) glycoproteins of each NA strain examined, while reactivities with the glycoproteins of SA strains were substantially weaker and variable and dependent upon both the immune response of the vaccinee and the virus isolate assayed. Most striking was the modest to virtual lack of reactivity with the E2 protein of SA strains. Antigenic differences among the glycoproteins of EEE viruses were not as pronounced in immunoprecipitation analysis. Most significantly, although human immune sera displayed high neutralizing titers against each of the NA isolates examined, only negligible neutralizing titers were obtained against SA isolates. These data suggest that immunized individuals would mount an effective antibody response against infection with NA strains of EEE virus, but that further investigation is clearly warranted to fully assess the protective capability of the vaccine against infection with SA strains.
Equine Immunoglobulin and Equine Neutralizing F(ab')₂ Protect Mice from West Nile Virus Infection.
Cui, Jiannan; Zhao, Yongkun; Wang, Hualei; Qiu, Boning; Cao, Zengguo; Li, Qian; Zhang, Yanbo; Yan, Feihu; Jin, Hongli; Wang, Tiecheng; Sun, Weiyang; Feng, Na; Gao, Yuwei; Sun, Jing; Wang, Yanqun; Perlman, Stanley; Zhao, Jincun; Yang, Songtao; Xia, Xianzhu
2016-12-18
West Nile virus (WNV) is prevalent in Africa, Europe, the Middle East, West Asia, and North America, and causes epidemic encephalitis. To date, no effective therapy for WNV infection has been developed; therefore, there is urgent need to find an efficient method to prevent WNV disease. In this study, we prepared and evaluated the protective efficacy of immune serum IgG and pepsin-digested F(ab')₂ fragments from horses immunized with the WNV virus-like particles (VLP) expressing the WNV M and E proteins. Immune equine F(ab')₂ fragments and immune horse sera efficiently neutralized WNV infection in tissue culture. The passive transfer of equine immune antibodies significantly accelerated the virus clearance in the spleens and brains of WNV infected mice, and reduced mortality. Thus, equine immunoglobulin or equine neutralizing F(ab')₂ passive immunotherapy is a potential strategy for the prophylactic or therapeutic treatment of patients infected with WNV.
Equine Immunoglobulin and Equine Neutralizing F(ab′2 Protect Mice from West Nile Virus Infection
Directory of Open Access Journals (Sweden)
Jiannan Cui
2016-12-01
Full Text Available West Nile virus (WNV is prevalent in Africa, Europe, the Middle East, West Asia, and North America, and causes epidemic encephalitis. To date, no effective therapy for WNV infection has been developed; therefore, there is urgent need to find an efficient method to prevent WNV disease. In this study, we prepared and evaluated the protective efficacy of immune serum IgG and pepsin-digested F(ab′2 fragments from horses immunized with the WNV virus-like particles (VLP expressing the WNV M and E proteins. Immune equine F(ab′2 fragments and immune horse sera efficiently neutralized WNV infection in tissue culture. The passive transfer of equine immune antibodies significantly accelerated the virus clearance in the spleens and brains of WNV infected mice, and reduced mortality. Thus, equine immunoglobulin or equine neutralizing F(ab′2 passive immunotherapy is a potential strategy for the prophylactic or therapeutic treatment of patients infected with WNV.
A study on spatial decision support systems for HIV/AIDS prevention based on COM GIS technology
Yang, Kun; Luo, Huasong; Peng, Shungyun; Xu, Quanli
2007-06-01
Based on the deeply analysis of the current status and the existing problems of GIS technology applications in Epidemiology, this paper has proposed the method and process for establishing the spatial decision support systems of AIDS epidemic prevention by integrating the COM GIS, Spatial Database, GPS, Remote Sensing, and Communication technologies, as well as ASP and ActiveX software development technologies. One of the most important issues for constructing the spatial decision support systems of AIDS epidemic prevention is how to integrate the AIDS spreading models with GIS. The capabilities of GIS applications in the AIDS epidemic prevention have been described here in this paper firstly. Then some mature epidemic spreading models have also been discussed for extracting the computation parameters. Furthermore, a technical schema has been proposed for integrating the AIDS spreading models with GIS and relevant geospatial technologies, in which the GIS and model running platforms share a common spatial database and the computing results can be spatially visualized on Desktop or Web GIS clients. Finally, a complete solution for establishing the decision support systems of AIDS epidemic prevention has been offered in this paper based on the model integrating methods and ESRI COM GIS software packages. The general decision support systems are composed of data acquisition sub-systems, network communication sub-systems, model integrating sub-systems, AIDS epidemic information spatial database sub-systems, AIDS epidemic information querying and statistical analysis sub-systems, AIDS epidemic dynamic surveillance sub-systems, AIDS epidemic information spatial analysis and decision support sub-systems, as well as AIDS epidemic information publishing sub-systems based on Web GIS.
Cloud Computing and Its Applications in GIS
Kang, Cao
2011-12-01
Cloud computing is a novel computing paradigm that offers highly scalable and highly available distributed computing services. The objectives of this research are to: 1. analyze and understand cloud computing and its potential for GIS; 2. discover the feasibilities of migrating truly spatial GIS algorithms to distributed computing infrastructures; 3. explore a solution to host and serve large volumes of raster GIS data efficiently and speedily. These objectives thus form the basis for three professional articles. The first article is entitled "Cloud Computing and Its Applications in GIS". This paper introduces the concept, structure, and features of cloud computing. Features of cloud computing such as scalability, parallelization, and high availability make it a very capable computing paradigm. Unlike High Performance Computing (HPC), cloud computing uses inexpensive commodity computers. The uniform administration systems in cloud computing make it easier to use than GRID computing. Potential advantages of cloud-based GIS systems such as lower barrier to entry are consequently presented. Three cloud-based GIS system architectures are proposed: public cloud- based GIS systems, private cloud-based GIS systems and hybrid cloud-based GIS systems. Public cloud-based GIS systems provide the lowest entry barriers for users among these three architectures, but their advantages are offset by data security and privacy related issues. Private cloud-based GIS systems provide the best data protection, though they have the highest entry barriers. Hybrid cloud-based GIS systems provide a compromise between these extremes. The second article is entitled "A cloud computing algorithm for the calculation of Euclidian distance for raster GIS". Euclidean distance is a truly spatial GIS algorithm. Classical algorithms such as the pushbroom and growth ring techniques require computational propagation through the entire raster image, which makes it incompatible with the distributed nature
Ali Ali
2008-01-01
The purpose of the study was to investigate the barriers preventing the use of Geographic Information Systems (GIS) in secondary school geography lessons and to determine its effectiveness on students success. A workshop focusing on ways to implement GIS-based application in the classroom for 14 teachers from nine high schools was conducted in 2006. The teachers were given GIS software, digital data for an application, and the necessary written documents describing the application. Due to var...
Sotomayor-Bonilla, Jesús; Abella-Medrano, Carlos Antonio; Chaves, Andrea; Álvarez-Mendizábal, Paulina; Rico-Chávez, Óscar; Ibáñez-Bernal, Sergio; Rostal, Melinda K; Ojeda-Flores, Rafael; Barbachano-Guerrero, Arturo; Gutiérrez-Espeleta, Gustavo; Aguirre, A Alonso; Daszak, Peter; Suzán, Gerardo
2017-07-01
Arboviruses are important zoonotic agents with complex transmission cycles and are not well understood because they may involve many vectors and hosts. We studied sympatric wild mammals and hematophagous mosquitoes having the potential to act as hosts and vectors in two areas of southern Mexico. Mosquitoes, bats, and rodents were captured in Calakmul (Campeche) and Montes Azules (Chiapas), between November 2010 and August 2011. Spleen samples from 146 bats and 14 rodents were tested for molecular evidence of Venezuelan equine encephalitis virus (VEEV), eastern equine encephalitis virus (EEEV), western equine encephalitis virus (WEEV), and West Nile virus (WNV) using PCR protocols. Bat ( Artibeus lituratus , Carollia sowelli , Glossophaga soricina , and Sturnira parvidens) and rodent ( Sigmodon hispidus and Oryzomys alfaroi ) species were positive for VEEV. No individuals were positive for WNV, EEEV, or WEEV. A total of 1,298 mosquitoes were collected at the same sites, and five of the mosquito species collected were known VEEV vectors (Aedes fulvus, Mansonia indubitans, Psorophora ferox, Psorophora cilipes, and Psorophora confinnis). This survey simultaneously presents the first molecular evidence, to our knowledge, of VEEV in bats and rodents from southern Mexico and the identification of potential sympatric vectors. Studies investigating sympatric nonhuman hosts, vectors, and arboviruses must be expanded to determine arboviral dynamics in complex systems in which outbreaks of emerging and reemerging zoonoses are continuously occurring.
Theller, Larry
2016-01-01
For Fall semester 2016 the ABE department moved the course ASM 540 Basic GIS from ArcGIS Desktop 10.2 to ArcGIS Pro 1.3. This software from ESRI has a completely new look and feel, (ribbon-based rather than cascading menus) and is a true 64 bit application, capable of multi-threading, and built on Python 3. After ArcGIS Desktop 10.5 is released, desktop ends and the future release will be ArcGIS Pro; so it makes sense to switch sooner rather than later. This talk will discuss some issues and...
GIS-based bivariate statistical techniques for groundwater potential ...
Indian Academy of Sciences (India)
Ali Haghizadeh
2017-11-23
Nov 23, 2017 ... regions. This study shows the potency of two GIS-based data driven ... growth of these tools has also prepared another ..... Urban. 30467. 3. 0.06. 0.20. 0.74. 0.80. −0.64. Distance from road ..... and artificial neural networks for potential groundwater .... ping: A case study at Mehran region, Iran; Catena 137.
Equine Assisted Couples Therapy: An Exploratory Study
Ham, Taylor Marie
2013-01-01
Equine assisted psychotherapy (EAP) is an emerging experiential methodologythat has recently gained recognition as a method for addressing a range of presentingproblems for a wide variety of client populations. Couples therapy is one area that thepractice of equine assisted psychotherapy has recently gained traction. This studydescribes the practice of equine assisted couples therapy in terms of practitionercharacteristics, approach to treatment, therapeutic goals and outcomes. Mental healthp...
GIS-based Approaches to Catchment Area Analyses of Mass Transit
DEFF Research Database (Denmark)
Andersen, Jonas Lohmann Elkjær; Landex, Alex
2009-01-01
Catchment area analyses of stops or stations are used to investigate potential number of travelers to public transportation. These analyses are considered a strong decision tool in the planning process of mass transit especially railroads. Catchment area analyses are GIS-based buffer and overlay...... analyses with different approaches depending on the desired level of detail. A simple but straightforward approach to implement is the Circular Buffer Approach where catchment areas are circular. A more detailed approach is the Service Area Approach where catchment areas are determined by a street network...... search to simulate the actual walking distances. A refinement of the Service Area Approach is to implement additional time resistance in the network search to simulate obstacles in the walking environment. This paper reviews and compares the different GIS-based catchment area approaches, their level...
Cell Based GIS as Cellular Automata for Disaster Spreading Predictions and Required Data Systems
Directory of Open Access Journals (Sweden)
Kohei Arai
2013-03-01
Full Text Available A method for prediction and simulation based on the Cell Based Geographic Information System(GIS as Cellular Automata (CA is proposed together with required data systems, in particular metasearch engine usage in an unified way. It is confirmed that the proposed cell based GIS as CA has flexible usage of the attribute information that is attached to the cell in concert with location information and does work for disaster spreading simulation and prediction.
A GIS-based atmospheric dispersion model for pollutants emitted by complex source areas.
Teggi, Sergio; Costanzini, Sofia; Ghermandi, Grazia; Malagoli, Carlotta; Vinceti, Marco
2018-01-01
Gaussian dispersion models are widely used to simulate the concentrations and deposition fluxes of pollutants emitted by source areas. Very often, the calculation time limits the number of sources and receptors and the geometry of the sources must be simple and without holes. This paper presents CAREA, a new GIS-based Gaussian model for complex source areas. CAREA was coded in the Python language, and is largely based on a simplified formulation of the very popular and recognized AERMOD model. The model allows users to define in a GIS environment thousands of gridded or scattered receptors and thousands of complex sources with hundreds of vertices and holes. CAREA computes ground level, or near ground level, concentrations and dry deposition fluxes of pollutants. The input/output and the runs of the model can be completely managed in GIS environment (e.g. inside a GIS project). The paper presents the CAREA formulation and its applications to very complex test cases. The tests shows that the processing time are satisfactory and that the definition of sources and receptors and the output retrieval are quite easy in a GIS environment. CAREA and AERMOD are compared using simple and reproducible test cases. The comparison shows that CAREA satisfactorily reproduces AERMOD simulations and is considerably faster than AERMOD. Copyright © 2017 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Ke Dan; Han Shaoyang; Hou Huiqun; Hu Shuiqing
2006-01-01
Component GIS owns many merits such as flexible function and easy to be used, which makes it very suitable for the development of professional GIS application system in geoscience field. During the process of exploration and evaluation for uranium resources, computer application system has been a powerful tool owning to the following functions: professional processing, management and storage of data, spatial analysis, visualization and mapping, etc. In this paper technological routine is presented for the development of integrated evaluation information system for sandstone-hosted uranium deposits based on ArcGIS Engine. General GIS functions can be realized with ArcGIS Engine easily and quickly, the developers could concentrate their attentions on developing professional functions, which will shorten the developing period and make the system more efficient. It is showed that the system developed on ArcGIS Engine platform is stable in operation, flexible in functions and professional in application. (authors)
9 CFR 317.9 - Labeling of equine products.
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Labeling of equine products. 317.9... INSPECTION AND CERTIFICATION LABELING, MARKING DEVICES, AND CONTAINERS General § 317.9 Labeling of equine products. The immediate containers of any equine products shall be labeled to show the kinds of animals...
A GIS-based Power Transmission Management Information System
Institute of Scientific and Technical Information of China (English)
2010-01-01
<正>Based on analyzing the shortcomings of electric power enterprise in traditional operation pattern,this paper combines components GIS with the application of management information system,and uses the structure which unifies three layers C/S and B/S.Also,proposed using the GPS intellectualization patrol.This may be useful to guarantees the transmission line’s operation to be safe and stable.
Integration agent-based models and GIS as a virtual urban dynamic laboratory
Chen, Peng; Liu, Miaolong
2007-06-01
Based on the Agent-based Model and spatial data model, a tight-coupling integrating method of GIS and Agent-based Model (ABM) is to be discussed in this paper. The use of object-orientation for both spatial data and spatial process models facilitates their integration, which can allow exploration and explanation of spatial-temporal phenomena such as urban dynamic. In order to better understand how tight coupling might proceed and to evaluate the possible functional and efficiency gains from such a tight coupling, the agent-based model and spatial data model are discussed, and then the relationships affecting spatial data model and agent-based process models interaction. After that, a realistic crowd flow simulation experiment is presented. Using some tools provided by general GIS systems and a few specific programming languages, a new software system integrating GIS and MAS as a virtual laboratory applicable for simulating pedestrian flows in a crowd activity centre has been developed successfully. Under the environment supported by the software system, as an applicable case, a dynamic evolution process of the pedestrian's flows (dispersed process for the spectators) in a crowds' activity center - The Shanghai Stadium has been simulated successfully. At the end of the paper, some new research problems have been pointed out for the future.
"Many Secrets Are Told around Horses": An Ethnographic Study of Equine-Assisted Psychotherapy
Van Tiem, Jennifer
2014-01-01
This dissertation presents an ethnography of equine-assisted psychotherapy (EAP) based on nine months of fieldwork at "Equine Healers," a non-profit organization in central Colorado that specialized in various therapeutic modalities associated with EAP. In bridging scholarly work around animals, a literature suffused with the notion of…
PROMAB-GIS: A GIS based Tool for Estimating Runoff and Sediment Yield in running Waters
Jenewein, S.; Rinderer, M.; Ploner, A.; Sönser, T.
2003-04-01
In recent times settlements have expanded, traffic and tourist activities have increased in most alpine regions. As a consequence, on the one hand humans and goods are affected by natural hazard processes more often, while on the other hand the demand for protection by both technical constructions and planning measures carried out by public authorities is growing. This situation results in an ever stronger need of reproducibility, comparability, transparency of all methods applied in modern natural hazard management. As a contribution to a new way of coping this situation Promab-GIS Version 1.0 has been developed. Promab-Gis has been designed as a model for time- and space-dependent determination of both runoff and bedload transport in rivers of small alpine catchment areas. The estimation of the unit hydrograph relies upon the "rational formula" and the time-area curves of the watershed. The time area diagram is a graph of cumulative drainage area contributing to discharge at the watershed outlet within a specified time of travel. The sediment yield is estimated for each cell of the channel network by determining the actual process type (erosion, transport or accumulation). Two types of transport processes are considered, sediment transport and debris flows. All functions of Promab-GIS are integrated in the graphical user interface of ArcView as pull-up menus and tool buttons. Hence the application of Promab-GIS does not rely on a sophisticated knowledge of GIS in general, respectively the ArcView software. However, despite the use of computer assistance, Promab-GIS still is an expert support system. In order to obtain plausible results, the users must be familiar with all the relevant processes controlling runoff and sediment yield in torrent catchments.
The equine veterinarian : past, present and prospects of a profession
Loomans, J.B.A.
2008-01-01
The equine veterinarian has regained its position in the veterinary profession. Equine veterinarians work in equine practices as well as in mixed practices. In general, it can be said that the backbone of equine work is formed by a relatively small amount of activities for which only a limited
Directory of Open Access Journals (Sweden)
S. P. Waghmare
2010-08-01
Full Text Available Equine influenza virus is a leading cause of respiratory disease in the horses. The disease is the OIE listed disease of equines, ponies, mules and donkeys and spreads very fast. The sporadic outbreaks of the disease have occurred all over the country. Many cases have been reported in Delhi, Meerut, Saharanpur, Jaipur, Hisar, Calcutta, Ahmedabad. Nearly all the horses at Matheran (Hill station were infected with influenza. The disease has spread like wildfire at the stables of Royal Western India Turf Club (RWITC at Pune and suspended the Mumbai racing season for prolonged period of time resulting in marked economic losses. After affecting racing in Mumbai, Calcutta and New Delhi, the dreaded equine influenza has spread to Karnataka and Mysore. An outbreak of disease has marred the racing season across the country. The disease was first detected in Jammu & Kashmir before entering the central region Horses at the army polo clubs and Delhi equestrian center were also affected. As per the recent survey conducted by the army across India, it has been found that 5400 horses are infected so far, especially thoroughbred most severely. Nearly, 95 % of horses on a major farm in India are suspected of suffering from equine influenza. The government also banned inter-state movement of horses for three months to contain the disease. [Vet World 2010; 3(4.000: 194-197
Analysis of open source GIS software
Božnis, Andrius
2006-01-01
GIS is one of the most perspective information technology sciences sphere. GIS conjuncts the digital image analysis and data base systems. This makes GIS wide applicable and very high skills demanding system. There is a lot of commercial GIS software which is well advertised and which functionality is pretty well known, while open source software is forgotten. In this diploma work is made analysis of available open source GIS software on the Internet, in the scope of different projects interr...
Welton, B.; Chouinard, K.; Sultan, M.; Becker, D.; Milewski, A.; Becker, R.
2010-12-01
Rising populations in the arid and semi arid parts of the World are increasing the demand for fresh water supplies worldwide. Many data sets needed for assessment of hydrologic applications across vast regions of the world are expensive, unpublished, difficult to obtain, or at varying scales which complicates their use. Fortunately, this situation is changing with the development of global remote sensing datasets and web-based platforms such as GIS Server. GIS provides a cost effective vehicle for comparing, analyzing, and querying a variety of spatial datasets as geographically referenced layers. We have recently constructed a web-based GIS, that incorporates all relevant geological, geochemical, geophysical, and remote sensing data sets that were readily used to identify reservoir types and potential well locations on local and regional scales in various tectonic settings including: (1) extensional environment (Red Sea rift), (2) transcurrent fault system (Najd Fault in the Arabian-Nubian Shield), and (3) compressional environments (Himalayas). The web-based GIS could also be used to detect spatial and temporal trends in precipitation, recharge, and runoff in large watersheds on local, regional, and continental scales. These applications were enabled through the construction of a web-based ArcGIS Server with Google Map’s interface and the development of customized geoprocessing tools. ArcGIS Server provides out-of-the-box setups that are generic in nature. This platform includes all of the standard web based GIS tools (e.g. pan, zoom, identify, search, data querying, and measurement). In addition to the standard suite of tools provided by ArcGIS Server an additional set of advanced data manipulation and display tools was also developed to allow for a more complete and customizable view of the area of interest. The most notable addition to the standard GIS Server tools is the custom on-demand geoprocessing tools (e.g., graph, statistical functions, custom raster
CLOUD BASED WEB 3D GIS TAIWAN PLATFORM
Directory of Open Access Journals (Sweden)
W.-F. Tsai
2012-09-01
Full Text Available This article presents the status of the web 3D GIS platform, which has been developed in the National Applied Research Laboratories. The purpose is to develop a global earth observation 3D GIS platform for applications to disaster monitoring and assessment in Taiwan. For quick response to preliminary and detailed assessment after a natural disaster occurs, the web 3D GIS platform is useful to access, transfer, integrate, display and analyze the multi-scale huge data following the international OGC standard. The framework of cloud service for data warehousing management and efficiency enhancement using VMWare is illustrated in this article.
Facilitating Spatial Thinking in World Geography Using Web-Based GIS
Jo, Injeong; Hong, Jung Eun; Verma, Kanika
2016-01-01
Advocates for geographic information system (GIS) education contend that learning about GIS promotes students' spatial thinking. Empirical studies are still needed to elucidate the potential of GIS as an instructional tool to support spatial thinking in other geography courses. Using a non-equivalent control group research design, this study…
An Overview of GIS-Based Modeling and Assessment of Mining-Induced Hazards: Soil, Water, and Forest.
Suh, Jangwon; Kim, Sung-Min; Yi, Huiuk; Choi, Yosoon
2017-11-27
In this study, current geographic information system (GIS)-based methods and their application for the modeling and assessment of mining-induced hazards were reviewed. Various types of mining-induced hazard, including soil contamination, soil erosion, water pollution, and deforestation were considered in the discussion of the strength and role of GIS as a viable problem-solving tool in relation to mining-induced hazards. The various types of mining-induced hazard were classified into two or three subtopics according to the steps involved in the reclamation procedure, or elements of the hazard of interest. Because GIS is appropriated for the handling of geospatial data in relation to mining-induced hazards, the application and feasibility of exploiting GIS-based modeling and assessment of mining-induced hazards within the mining industry could be expanded further.
An Overview of GIS-Based Modeling and Assessment of Mining-Induced Hazards: Soil, Water, and Forest
Kim, Sung-Min; Yi, Huiuk; Choi, Yosoon
2017-01-01
In this study, current geographic information system (GIS)-based methods and their application for the modeling and assessment of mining-induced hazards were reviewed. Various types of mining-induced hazard, including soil contamination, soil erosion, water pollution, and deforestation were considered in the discussion of the strength and role of GIS as a viable problem-solving tool in relation to mining-induced hazards. The various types of mining-induced hazard were classified into two or three subtopics according to the steps involved in the reclamation procedure, or elements of the hazard of interest. Because GIS is appropriated for the handling of geospatial data in relation to mining-induced hazards, the application and feasibility of exploiting GIS-based modeling and assessment of mining-induced hazards within the mining industry could be expanded further. PMID:29186922
An Overview of GIS-Based Modeling and Assessment of Mining-Induced Hazards: Soil, Water, and Forest
Directory of Open Access Journals (Sweden)
Jangwon Suh
2017-11-01
Full Text Available In this study, current geographic information system (GIS-based methods and their application for the modeling and assessment of mining-induced hazards were reviewed. Various types of mining-induced hazard, including soil contamination, soil erosion, water pollution, and deforestation were considered in the discussion of the strength and role of GIS as a viable problem-solving tool in relation to mining-induced hazards. The various types of mining-induced hazard were classified into two or three subtopics according to the steps involved in the reclamation procedure, or elements of the hazard of interest. Because GIS is appropriated for the handling of geospatial data in relation to mining-induced hazards, the application and feasibility of exploiting GIS-based modeling and assessment of mining-induced hazards within the mining industry could be expanded further.
Equine corneal stromal abscesses
DEFF Research Database (Denmark)
Henriksen, M. D. L.; Andersen, P. H.; Plummer, C. E.
2013-01-01
The last 30 years have seen many changes in the understanding of the pathogenesis and treatment of equine corneal stromal abscesses (SAs). Stromal abscesses were previously considered an eye problem related to corneal bacterial infection, equine recurrent uveitis, corneal microtrauma and corneal....... Medical and surgical treatments are now directed towards elimination of fungal and bacterial infections, reduction and replacement of diseased corneal stroma, and suppression of iridocyclitis. If the abscess and anterior uveitis do not respond satisfactorily to medical therapy, full thickness or split...
Equine Management and Production. Teacher Edition.
Oklahoma State Dept. of Vocational and Technical Education, Stillwater. Curriculum and Instructional Materials Center.
This package contains the instructor's manual, instructor's resource package, and student workbook for a 1-year introductory course in equine management and production. The course emphasizes the skills needed to manage small one- or two-horse facilities and to enter postsecondary equine education programs. The instructor's manual presents basic…
Cheng, Liang; Zhang, Wen; Wang, Jiechen; Li, Manchun; Zhong, Lishan
2014-01-01
Geographic information science (GIS) features a wide range of disciplines and has broad applicability. Challenges associated with rapidly developing GIS technology and the currently limited teaching and practice materials hinder universities from cultivating highly skilled GIS graduates. Based on the idea of "small core, big network," a…
Descriptive epidemiology of equine influenza in India (2008-2009: temporal and spatial trends
Directory of Open Access Journals (Sweden)
Partap S. Narwal
2010-12-01
Full Text Available Equine influenza is a contagious viral disease that affects all members of the family Equidae, i.e. horses, donkeys and mules. The authors describe the pattern of equine influenza outbreaks in a number of states of India from July 2008 to June 2009. The disease was first reported in June 2008 in Katra (Jammu and Kashmir and spread to ten other states within a year. All outbreaks of equine influenza in the various states were confirmed by laboratory investigations (virus isolation and/or serological confirmation based on haemagglutination inhibition [HI] assays of paired samples before declaring them as equine influenza virus-affected state(s. The virus (H3N8 was reported from various locations in the country including Katra, Mysore (Karnataka, Ahmedabad (Gujarat, Gopeshwar and Uttarkashi (Uttarakhand and was isolated in 9- to 11-day-old embryonated chicken eggs. The virus was confirmed as H3N8 by HI assays with standard serum and amplification of full-length haemagglutinin and neuraminidase genes by reverse transcriptase-polymerase chain reaction. Serum samples (n = 4 740 of equines from 13 states in India screened by HI revealed 1 074 (22.65% samples as being positive for antibodies to equine influenza virus (H3N8.
Equine piroplasmosis is an infectious, tick-borne disease caused by the hemoprotozoan parasites Theileria (previously Babesia) equi and Babesia caballi. Piroplasmosis affects all wild and domestic equid species and causes signs related to intravascular hemolysis and associated systemic illness. Infe...
Serosurveillance of infectious agents in equines of the Central ...
African Journals Online (AJOL)
The presence of antibodies against Equine Infectious Anemia Virus (EIAV), Equine Herpes Virus 1 and 4 (EHV-1 and EHV-4), West Nile Virus (WNV), Influenza A Virus (IAV), Equine Viral Arteritis Virus (EVAV), Babesia caballi, Theileria equi, Neospora caninum and Chlamydia abortus was determined using commercial ...
WATERSHED BASED WEB GIS: CASE STUDY OF PALOPO WATERSHED AREA SOUTH SULAWESI, INDONESIA
Directory of Open Access Journals (Sweden)
Jalaluddin Rumi PRASAD
2017-09-01
Full Text Available Data and land resource information complete, accurate, and current is an input in management planning, evaluation, and monitoring Watershed. Implementation of this research is conducted with optimum utilization of secondary data that is supported by direct field measurement data, digitalizing the maps associated, Geographic Information Systems modeling, and model calibration. This research has resulted in a Geographic Information System Management of potential Watershed GIS Web-based or abbreviated WEB GIS MPPDAS using Palopo watershed area, South Sulawesi as a case study sites for the development of a prototype that consists of three applications the main website ie Web Portal, Web GIS, and Web Tutorial. The system is built to show online (and offline maps watershed in the administrative area of Palopo along with the location of its potential accumulated in the four (4 groups of layers, including groups of main layer (2 layer, a group of base layer (14 layers, groups of thematic layers (12 layers, a group of policy layer (8 layer. In addition to display a map, use the WEB application of GIS MPPDAS can also use tools or controls in the application to perform analyzes in its monitoring and evaluation, including: Geocoding, Add layer, Digitizing, Selection, Measurements, Graph, Filtering, Geolocation, Overlay cartographic, and etc.
GIS-Based Railway Route Selection for the Proposed Kenya-Sudan ...
African Journals Online (AJOL)
This paper describes a procedure developed for automated railway feasibility analysis based on GIS and Multi-Criteria analysis. Good engineering railway alignment requirements are assessed and suitable factors and constraints for feasibility analysis derived. Relevant digital map layers are then prepared and reclassified ...
The Equine Business: The Spectacular Growth of a new Equine segment market in France
Grefe , Gwenaëlle; Pickel-Chevalier , Sylvine
2015-01-01
International audience; A social revolution in riding has created incredible growth in the equine-product market. This new equine economy is, in fact, characterized by the range of activities available (32 riding styles are listed by the FFE 1), by riders' needs (equipment for both riders and their horses including fences, water troughs, horse-boxes etc.), by product ranges (from entry-level to luxury goods), but also by fashion which, thanks to the profile of today's horse-riders (predominan...
Design and realization of tourism spatial decision support system based on GIS
Ma, Zhangbao; Qi, Qingwen; Xu, Li
2008-10-01
In this paper, the existing problems of current tourism management information system are analyzed. GIS, tourism as well as spatial decision support system are introduced, and the application of geographic information system technology and spatial decision support system to tourism management and the establishment of tourism spatial decision support system based on GIS are proposed. System total structure, system hardware and software environment, database design and structure module design of this system are introduced. Finally, realization methods of this systemic core functions are elaborated.
A review of equine renal imaging techniques
International Nuclear Information System (INIS)
Matthews, H.K.; Toal, R.L.
1996-01-01
Radiography has a limited role in the evaluation of the kidneys in foals and adult horses. Ultrasonography is the current method of choice for structural evaluation of the kidneys in horses as it provides additional information to standard serum chemistry and urinalysis evaluation. A variety of structural abnormalities have been identified in diseased equine kidneys with the use of ultrasound. Ultrasound guided renal biopsy is the preferred method for performing renal biopsy in the horse. The use of Duplex Doppler ultrasound may allow for the characterization of regional hemodynamics of the equine kidney, but is currently an untapped method for evaluation of equine renal hemodynamics. Radionuclide methods including scintigraphy and quantitative renal function measurement can be used to provide further information about equine renal function. Scintigraphy can provide structural and possibly functional information. Quantitative methods using radiopharmaceuticals can provide precise measurement of glomerular filtration rate and effective renal blood flow. This method is especially helpful in identifying acute renal failure and in guiding response to treatment. All equine renal imaging techniques should be a supplement to the physical examination and standard laboratory tests. Additional diagnostic aids such as urinary tract endoscopy should also be considered in horses with hematuria, hydroureter, and suspected calculi. Taken together, all these modalities provide a thorough evaluation of the equine renal system and provide a basis for the clinician to select treatment options and provide prognostic information to the owner
PRESENCE OF RESPIRATORY VIRUSES IN EQUINES IN BRAZIL
Directory of Open Access Journals (Sweden)
Dalva Assunção Portari Mancini
2014-06-01
Full Text Available Equines are susceptible to respiratory viruses such as influenza and parainfluenza. Respiratory diseases have adversely impacted economies all over the world. This study was intended to determine the presence of influenza and parainfluenza viruses in unvaccinated horses from some regions of the state of São Paulo, Brazil. Blood serum collected from 72 equines of different towns in this state was tested by hemagglutination inhibition test to detect antibodies for both viruses using the corresponding antigens. About 98.6% (71 and 97.2% (70 of the equines responded with antibody protective titers (≥ 80 HIU/25µL H7N7 and H3N8 subtypes of influenza A viruses, respectively. All horses (72 also responded with protective titers (≥ 80 HIU/25µL against the parainfluenza virus. The difference between mean antibody titers to H7N7 and H3N8 subtypes of influenza A viruses was not statistically significant (p > 0.05. The mean titers for influenza and parainfluenza viruses, on the other hand, showed a statistically significant difference (p < 0.001. These results indicate a better antibody response from equines to parainfluenza 3 virus than to the equine influenza viruses. No statistically significant differences in the responses against H7N7 and H3N8 subtypes of influenza A and parainfluenza 3 viruses were observed according to the gender (female, male or the age (≤ 2 to 20 years-old groups. This study provides evidence of the concomitant presence of two subtypes of the equine influenza A (H7N7 and H3N8 viruses and the parainfluenza 3 virus in equines in Brazil. Thus, it is advisable to vaccinate equines against these respiratory viruses.
Selective therapy in equine parasite control--application and limitations.
Nielsen, M K; Pfister, K; von Samson-Himmelstjerna, G
2014-05-28
Since the 1960s equine parasite control has relied heavily on frequent anthelmintic treatments often applied with frequent intervals year-round. However, increasing levels of anthelmintic resistance in cyathostomins and Parascaris equorum are now forcing the equine industry to change to a more surveillance-based treatment approach to facilitate a reduction in treatment intensity. The principle of selective therapy has been implemented with success in small ruminant parasite control, and has also found use in horse populations. Typically, egg counts are performed from all individuals in the population, and those exceeding a predetermined cutoff threshold are treated. Several studies document the applicability of this method in populations of adult horses, where the overall cyathostomin egg shedding can be controlled by only treating about half the horses. However, selective therapy has not been evaluated in foals and young horses, and it remains unknown whether the principle is adequate to also provide control over other important parasites such as tapeworms, ascarids, and large strongyles. One recent study associated selective therapy with increased occurrence of Strongylus vulgaris. Studies are needed to evaluate potential health risks associated with selective therapy, and to assess to which extent development of anthelmintic resistance can be delayed with this approach. The choice of strongyle egg count cutoff value for anthelmintic treatment is currently based more on tradition than science, and a recent publication illustrated that apparently healthy horses with egg counts below 100 eggs per gram (EPG) can harbor cyathostomin burdens in the range of 100,000 luminal worms. It remains unknown whether leaving such horses untreated constitutes a potential threat to equine health. The concept of selective therapy has merit for equine strongyle control, but several questions remain as it has not been fully scientifically evaluated. There is a great need for new and
Evidence Supporting Intralesional Stem Cell Therapy to Improve Equine Flexor Tendon Healing
Directory of Open Access Journals (Sweden)
Sushmitha Durgam
2017-01-01
Full Text Available Clinical bottom lineCurrent experimental evidence suggests that intralesional stem cell administration improves the histological characteristics and matrix organisation of healing equine superficial digital flexor tendons (SDFT; however, the clinical relevance of these findings are not clear. Current case-based evidence suggests that cell-based therapies improve the quality of tendon healing and reduce the recurrence rates of SDFT injuries but the lack of any randomised, controlled prospective studies with function-based outcomes is still concerning, given the widespread advocacy for and use of ‘stem cell’ therapies for the treatment of equine tendon injuries.
Analysis Of Educational Services Distribution-Based Geographic Information System GIS
Directory of Open Access Journals (Sweden)
Waleed Lagrab
2015-03-01
Full Text Available Abstract This study analyzes the spatial distribution of kindergarten facilities in the study area based on the Geographic Information Systems GIS in order to test an efficiency of GIS technology to redistribute the existing kindergarten and choose the best location in the future and applying the standard criteria for selecting the suitable locations for kindergarten. To achieve this goal the data and information are collected via interviews and comprehensive statistics on the education facilities in Mukalla districts in YEMEN which contributed to building a geographic database for the study area. After that the Kindergarten spatial patterns are analyzed in terms of proximity to each other and used near some other land in the surrounding area such as streets highways factories etc. Also measures the concentration dispersion clustering and distribution direction for the kindergarten this study showed the effectiveness of the GIS for spatial data analysis. One of the most important finding that most of the Kindergarten was established in Mukalla city did not take into account the criteria that set by the authorities. Furthermore almost district suffers from a shortage in the number of kindergarten and pattern of distribution of those kindergartens dominated by spatial dispersed.
Feizizadeh, Bakhtiar; Blaschke, Thomas
2014-01-01
GIS-based multicriteria decision analysis (MCDA) methods are increasingly being used in landslide susceptibility mapping. However, the uncertainties that are associated with MCDA techniques may significantly impact the results. This may sometimes lead to inaccurate outcomes and undesirable consequences. This article introduces a new GIS-based MCDA approach. We illustrate the consequences of applying different MCDA methods within a decision-making process through uncertainty analysis. Three GIS-MCDA methods in conjunction with Monte Carlo simulation (MCS) and Dempster–Shafer theory are analyzed for landslide susceptibility mapping (LSM) in the Urmia lake basin in Iran, which is highly susceptible to landslide hazards. The methodology comprises three stages. First, the LSM criteria are ranked and a sensitivity analysis is implemented to simulate error propagation based on the MCS. The resulting weights are expressed through probability density functions. Accordingly, within the second stage, three MCDA methods, namely analytical hierarchy process (AHP), weighted linear combination (WLC) and ordered weighted average (OWA), are used to produce the landslide susceptibility maps. In the third stage, accuracy assessments are carried out and the uncertainties of the different results are measured. We compare the accuracies of the three MCDA methods based on (1) the Dempster–Shafer theory and (2) a validation of the results using an inventory of known landslides and their respective coverage based on object-based image analysis of IRS-ID satellite images. The results of this study reveal that through the integration of GIS and MCDA models, it is possible to identify strategies for choosing an appropriate method for LSM. Furthermore, our findings indicate that the integration of MCDA and MCS can significantly improve the accuracy of the results. In LSM, the AHP method performed best, while the OWA reveals better performance in the reliability assessment. The WLC
Training Law Enforcement Officials on Responding to Equine Calls
Anderson, Kathleen P.; Stauffer, Gary; Stauffer, Monte; Anderson, Doug; Biodrowski, Kristie
2016-01-01
The occurrence of equine abuse/neglect cases is an ongoing issue. However, officials responding to equine cases are rarely experienced in handling horses. Therefore, workshops teaching basic horse husbandry were offered to better equip and prepare officials to respond to equine cases. Trainings consisted of both classroom and hands-on sessions.…
Porter, Aimee I; Erwin-Cohen, Rebecca A; Twenhafel, Nancy; Chance, Taylor; Yee, Steven B; Kern, Steven J; Norwood, David; Hartman, Laurie J; Parker, Michael D; Glass, Pamela J; DaSilva, Luis
2017-02-07
Licensed antiviral therapeutics and vaccines to protect against eastern equine encephalitis virus (EEEV) in humans currently do not exist. Animal models that faithfully recapitulate the clinical characteristics of human EEEV encephalitic disease, including fever, drowsiness, anorexia, and neurological signs such as seizures, are needed to satisfy requirements of the Food and Drug Administration (FDA) for clinical product licensing under the Animal Rule. In an effort to meet this requirement, we estimated the median lethal dose and described the pathogenesis of aerosolized EEEV in the common marmoset (Callithrix jacchus). Five marmosets were exposed to aerosolized EEEV FL93-939 in doses ranging from 2.4 × 10 1 PFU to 7.95 × 10 5 PFU. The median lethal dose was estimated to be 2.05 × 10 2 PFU. Lethality was observed as early as day 4 post-exposure in the highest-dosed marmoset but animals at lower inhaled doses had a protracted disease course where humane study endpoint was not met until as late as day 19 post-exposure. Clinical signs were observed as early as 3 to 4 days post-exposure, including fever, ruffled fur, decreased grooming, and leukocytosis. Clinical signs increased in severity as disease progressed to include decreased body weight, subdued behavior, tremors, and lack of balance. Fever was observed as early as day 2-3 post-exposure in the highest dose groups and hypothermia was observed in several cases as animals became moribund. Infectious virus was found in several key tissues, including brain, liver, kidney, and several lymph nodes. Clinical hematology results included early neutrophilia, lymphopenia, and thrombocytopenia. Key pathological changes included meningoencephalitis and retinitis. Immunohistochemical staining for viral antigen was positive in the brain, retina, and lymph nodes. More intense and widespread IHC labeling occurred with increased aerosol dose. We have estimated the medial lethal dose of aerosolized EEEV and
Equine assisted therapy for children and adolescents with autism spectrum disorders
Jakše, Tina
2012-01-01
Equine assisted therapy is presented as one of possible approaches when helping individuals with special needs. This work includes explanation of basic conceptions from the fields of equine assisted therapy and autism spectrum disorders. Motives for inclusion individuals with autism spetrcum disorders to this form of therapy are presented. Study was planned based on presented findings and carried out during school year 2009/2010. The purpose of this study is to ascertain possible effects of e...
9 CFR 316.12 - Marking of equine carcasses and parts thereof.
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Marking of equine carcasses and parts... equine carcasses and parts thereof. (a) All inspected and passed equine carcasses and parts thereof... marking products in this part. (b) All equine carcasses and meat and other parts thereof shall be marked...
GIS based procedure of cumulative environmental impact assessment.
Balakrishna Reddy, M; Blah, Baiantimon
2009-07-01
Scale and spatial limits of impact assessment study in a GIS platform are two very important factors that could have a bearing on the genuineness and quality of impact assessment. While effect of scale has been documented and well understood, no significant study has been carried out on spatial considerations in an impact assessment study employing GIS technique. A novel technique of impact assessment demonstrable through GIS approach termed hereby as 'spatial data integrated GIS impact assessment method (SGIAM)' is narrated in this paper. The technique makes a fundamental presumption that the importance of environmental impacts is dependent, among other things, on spatial distribution of the effects of the proposed action and of the affected receptors in a study area. For each environmental component considered (e.g., air quality), impact indices are calculated through aggregation of impact indicators which are measures of the severity of the impact. The presence and spread of environmental descriptors are suitably quantified through modeling techniques and depicted. The environmental impact index is calculated from data exported from ArcINFO, thus giving significant importance to spatial data in the impact assessment exercise.
Lifescience Database Archive (English)
Full Text Available ructural polyprotein OS=Eastern equine encephalitis virus (strain PE-3.0815) Align length 24 Score (bit) 30....alue sp|Q306W7|POLS_EEEV8 Structural polyprotein OS=Eastern equine en... 30 3.7 sp|Q306W5|POLS_EEEV1 Structu...ral polyprotein OS=Eastern equine en... 30 3.7 sp|Q74HV0|LUXS_LACJO S-ribosylhomocysteine lyase OS=Lactobaci...llu... 30 4.8 sp|Q4QXJ7|POLS_EEEVF Structural polyprotein OS=Eastern equine en...... 29 8.3 sp|P27284|POLS_EEEV3 Structural polyprotein OS=Eastern equine en... 29 8.3 sp|P08768|POLS_EEEV Struc
Lifescience Database Archive (English)
Full Text Available it_id Q4QXJ7 Definition sp|Q4QXJ7|POLS_EEEVF Structural polyprotein OS=Eastern equine encephalitis virus (st...ore E Sequences producing significant alignments: (bits) Value sp|Q4QXJ7|POLS_EEEVF Structural polyprotein OS=Eastern equine... en... 32 1.3 sp|P08768|POLS_EEEV Structural polyprotein OS=Eastern equine enc... 32 1.3 sp|...P27284|POLS_EEEV3 Structural polyprotein OS=Eastern equine en... 31 1.7 sp|Q86925...|POLS_AURAV Structural polyprotein OS=Aura virus PE=3 SV=2 31 2.2 sp|Q306W7|POLS_EEEV8 Structural polyprotein OS=Eastern equine
Skaff, Nicholas K; Armstrong, Philip M; Andreadis, Theodore G; Cheruvelil, Kendra S
2017-10-18
Eastern equine encephalitis virus (EEEV) is an expanding mosquito-borne threat to humans and domestic animal populations in the northeastern United States. Outbreaks of EEEV are challenging to predict due to spatial and temporal uncertainty in the abundance and viral infection of Cs. melanura, the principal enzootic vector. EEEV activity may be closely linked to wetlands because they provide essential habitat for mosquito vectors and avian reservoir hosts. However, wetlands are not homogeneous and can vary by vegetation, connectivity, size, and inundation patterns. Wetlands may also have different effects on EEEV transmission depending on the assessed spatial scale. We investigated associations between wetland characteristics and Cs. melanura abundance and infection with EEEV at multiple spatial scales in Connecticut, USA. Our findings indicate that wetland vegetative characteristics have strong associations with Cs. melanura abundance. Deciduous and evergreen forested wetlands were associated with higher Cs. melanura abundance, likely because these wetlands provide suitable subterranean habitat for Cs. melanura development. In contrast, Cs. melanura abundance was negatively associated with emergent and scrub/shrub wetlands, and wetland connectivity to streams. These relationships were generally strongest at broad spatial scales. Additionally, the relationships between wetland characteristics and EEEV infection in Cs. melanura were generally weak. However, Cs. melanura abundance was strongly associated with EEEV infection, suggesting that wetland-associated changes in abundance may be indirectly linked to EEEV infection in Cs. melanura. Finally, we found that wet hydrological conditions during the transmission season and during the fall/winter preceding the transmission season were associated with higher Cs. melanura abundance and EEEV infection, indicating that wet conditions are favorable for EEEV transmission. These results expand the broad-scale understanding
Application of GIS-based SCS-CN method in West Bank catchments, Palestine
Directory of Open Access Journals (Sweden)
Sameer Shadeed
2010-03-01
Full Text Available Among the most basic challenges of hydrology are the prediction and quantification of catchment surface runoff. The runoff curve number (CN is a key factor in determining runoff in the SCS (Soil Conservation Service based hydrologic modeling method. The traditional SCS-CN method for calculating the composite curve number is very tedious and consumes a major portion of the hydrologic modeling time. Therefore, geographic information systems (GIS are now being used in combination with the SCS-CN method. This paper assesses the modeling of flow in West Bank catchments using the GIS-based SCS-CN method. The West Bank, Palestine, is characterized as an arid to semi-arid region with annual rainfall depths ranging between 100 mm in the vicinity of the Jordan River to 700 mm in the mountains extending across the central parts of the region. The estimated composite curve number for the entire West Bank is about 50 assuming dry conditions. This paper clearly demonstrates that the integration of GIS with the SCS-CN method provides a powerful tool for estimating runoff volumes in West Bank catchments, representing arid to semi-arid catchments of Palestine.
A Framework for Sharing and Integrating Remote Sensing and GIS Models Based on Web Service
Chen, Zeqiang; Lin, Hui; Chen, Min; Liu, Deer; Bao, Ying; Ding, Yulin
2014-01-01
Sharing and integrating Remote Sensing (RS) and Geographic Information System/Science (GIS) models are critical for developing practical application systems. Facilitating model sharing and model integration is a problem for model publishers and model users, respectively. To address this problem, a framework based on a Web service for sharing and integrating RS and GIS models is proposed in this paper. The fundamental idea of the framework is to publish heterogeneous RS and GIS models into standard Web services for sharing and interoperation and then to integrate the RS and GIS models using Web services. For the former, a “black box” and a visual method are employed to facilitate the publishing of the models as Web services. For the latter, model integration based on the geospatial workflow and semantic supported marching method is introduced. Under this framework, model sharing and integration is applied for developing the Pearl River Delta water environment monitoring system. The results show that the framework can facilitate model sharing and model integration for model publishers and model users. PMID:24901016
A framework for sharing and integrating remote sensing and GIS models based on Web service.
Chen, Zeqiang; Lin, Hui; Chen, Min; Liu, Deer; Bao, Ying; Ding, Yulin
2014-01-01
Sharing and integrating Remote Sensing (RS) and Geographic Information System/Science (GIS) models are critical for developing practical application systems. Facilitating model sharing and model integration is a problem for model publishers and model users, respectively. To address this problem, a framework based on a Web service for sharing and integrating RS and GIS models is proposed in this paper. The fundamental idea of the framework is to publish heterogeneous RS and GIS models into standard Web services for sharing and interoperation and then to integrate the RS and GIS models using Web services. For the former, a "black box" and a visual method are employed to facilitate the publishing of the models as Web services. For the latter, model integration based on the geospatial workflow and semantic supported marching method is introduced. Under this framework, model sharing and integration is applied for developing the Pearl River Delta water environment monitoring system. The results show that the framework can facilitate model sharing and model integration for model publishers and model users.
Study of Noise Map and its Features in an Indoor Work Environment through GIS-Based Software
Directory of Open Access Journals (Sweden)
Faramarz Majidi
2016-06-01
Full Text Available Background: Noise mapping in industry can be useful to assess the risks of harmful noise, or to monitor noise in machine rooms. Using GIS -based software for plotting noise maps in an indoor noisy work environment can be helpful for occupational hygienists to monitor noise pollution. Methods: This study was carried out in a noisy packaging unit of a food industry in Ghazvin industrial zone, to evaluate noise levels by GIS technique. For this reason the floor of packaging unit was divided into squares of 2×2 meters and the center of each square was marked as a measurement station based on NIOSH method. The sound pressure level in each station was measured and then the measurement values were imported into Arc GIS software to plot noise map. Results: Unlike the current method, the noise maps generated by GIS technique are consistent with the nature of sound propagation. Conclusion: This study showed that for an indoor work environment, the application of GIS technology rendering the assessment of noise levels in the form of noise maps, is more realistic and more accurate than the routine method which is now being used by the occupational hygienists.
gis-based hydrological model based hydrological model upstream
African Journals Online (AJOL)
eobe
(GIS) environment to simulate various parame attributed to a ... water, sediment and agricultural chem large complex .... The 90m resolution topography data (see Figure 2) used for this .... results of the calibration and validation exercise are as.
[Wetland landscape pattern change based on GIS and RS: a review].
Kong, Fan-Ting; Xi, Min; Li, Yue; Kong, Fan-Long; Chen, Wan
2013-04-01
Wetland is an ecological landscape with most biodiversity in nature, which has unique ecological structure and function, and contains abundant natural resources to provide material guarantee for human's living and development. Wetland landscape pattern is the comprehensive result of various ecological processes, and has become a hot issue in wetland ecological study. At present, the combination of geographic information system (GIS) and remote sensing (RS) technologies is an important way to study the wetland landscape pattern change. This paper reviewed the research progress in the wetland landscape change based on GIS and RS from the aspects of the research methods of wetland landscape pattern, index of wetland landscape pattern, and driving forces of wetland landscape pattern evolution, and discussed the applications of the combination of GIS and RS in monitoring the wetland landscape pattern change, the index selection of wetland landscape pattern, and the driving mechanisms of the combined action of human and nature. Some deficiencies in the current studies were put forward, and the directions of the future-studies were prospected.
GIS-based interactive tool to map the advent of world conquerors
Lakkaraju, Mahesh
The objective of this thesis is to show the scale and extent of some of the greatest empires the world has ever seen. This is a hybrid project between the GIS based interactive tool and the web-based JavaScript tool. This approach lets the students learn effectively about the emperors themselves while understanding how long and far their empires spread. In the GIS based tool, a map is displayed with various points on it, and when a user clicks on one point, the relevant information of what happened at that particular place is displayed. Apart from this information, users can also select the interactive animation button and can walk through a set of battles in chronological order. As mentioned, this uses Java as the main programming language, and MOJO (Map Objects Java Objects) provided by ESRI. MOJO is very effective as its GIS related features can be included in the application itself. This app. is a simple tool and has been developed for university or high school level students. D3.js is an interactive animation and visualization platform built on the Javascript framework. Though HTML5, CSS3, Javascript and SVG animations can be used to derive custom animations, this tool can help bring out results with less effort and more ease of use. Hence, it has become the most sought after visualization tool for multiple applications. D3.js has provided a map-based visualization feature so that we can easily display text-based data in a map-based interface. To draw the map and the points on it, D3.js uses data rendered in TOPO JSON format. The latitudes and longitudes can be provided, which are interpolated into the Map svg. One of the main advantages of doing it this way is that more information is retained when we use a visual medium.
GIS supported calculations of 137Cs deposition in Sweden based on precipitation data
International Nuclear Information System (INIS)
Almgren, Sara; Nilsson, Elisabeth; Erlandsson, Bengt; Isaksson, Mats
2006-01-01
It is of interest to know the spatial variation and the amount of 137 Cs e.g. in case of an accident with a radioactive discharge. In this study, the spatial distribution of the quarterly 137 Cs deposition over Sweden due to nuclear weapons fallout (NWF) during the period 1962-1966 was determined by relating the measured deposition density at a reference site to the amount of precipitation. Measured quarterly values of 137 Cs deposition density per unit precipitation at three reference sites and quarterly precipitation at 62 weather stations distributed over Sweden were used in the calculations. The reference sites were assumed to represent areas with different quarterly mean precipitation. The extent of these areas was determined from the distribution of the mean measured precipitation between 1961 and 1990 and varied according to seasonal variations in the mean precipitation pattern. Deposition maps were created by interpolation within a geographical information system (GIS). Both integrated (total) and cumulative (decay corrected) deposition densities were calculated. The lowest levels of NWF 137 Cs deposition density were noted in north-eastern and eastern parts of Sweden and the highest levels in the western parts of Sweden. Furthermore the deposition density of 137 Cs, resulting from the Chernobyl accident was determined for an area in western Sweden based on precipitation data. The highest levels of Chernobyl 137 Cs in western Sweden were found in the western parts of the area along the coast and the lowest in the east. The sum of the deposition densities from NWF and Chernobyl in western Sweden was then compared to the total activity measured in soil samples at 27 locations. Comparisons between the predicted values of this study show a good agreement with measured values and other studies
GIS-based Integration of Interdisciplinary Ecological Data to Detect ...
African Journals Online (AJOL)
Key words: mangrove, satellite imagery, environment, aerial photography, GIS, Kenya Historic environmental, faunal, floral and socioeconomic data of Gazi Bay in coastal Kenya were collated and integrated into a GIS environment and data of impacts due to various factors were then related to remotely sensed data.
Directory of Open Access Journals (Sweden)
Janez Dular
1992-12-01
Full Text Available Concepts of spatial and landscape archaeologu have been accepted within Stepene archaeology for a decade. These concepts are based on the assumption that man, by his diverse activities, made a tremendous impact on the landscape as a whole. Therefore in the research of archaeological settlement patterns, the whole landscape should be observed and analgzed. Diverse techniques of archaeological survey for data collection were developed and theoretical concepts for interpretation of those data were adapted from geographg, but onlg by applying GIS technology were this concepts made accessible to ali archaeologists. Basic concepts for GIS applications were defined in the research project "The Genesis of the cultural landscape" at the Department of Archaeology of the University of Ljubljana. However, the Hvar Project, as the first archaeological čase study, played the crucial role in acceptance of GIS technology. The analyses were concentrated on the possibilities of GIS applications in archaeo logical analysis. The best results were achieved in definition of archaeological site territories, subsistence strategies, communications and trade analyses. Few regional čase studies were started this gear because it is to be expected that soon the majoritg of the GIS archaeological applications will be in protection and management of cultural heritage. Simultaneously the Institute for Archaeology at the Slovene Academy of Sciences and Art has started with the computerization of the site and monuments database which will be integrated into the state GIS.
Geomorphodiversity derived by a GIS-based geomorphological map: case study the Czech Republic
Czech Academy of Sciences Publication Activity Database
Demek, J.; Kirchner, Karel; Mackovčin, P.; Slavík, P.
2011-01-01
Roč. 55, č. 4 (2011), s. 415-436 ISSN 0372-8854 Institutional research plan: CEZ:AV0Z30860518 Keywords : geomorphodiversity * GIS geomorphological data base * GIS-geomorphological map * Czech Republic Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 0.642, year: 2011 http://www.ingentaconnect.com/content/schweiz/zfg/2011/00000055/00000004/art00001?token=004d10697e442f2067217d763b442c233e46533f34687627504541676249266d656cbe1a808f2
International Nuclear Information System (INIS)
Yuan, Z.Q.; Gault, E.A.; Gobeil, P.; Nixon, C.; Campo, M.S.; Nasir, L.
2008-01-01
It is now widely recognized that BPV-1 and less commonly BPV-2 are the causative agents of equine sarcoids. Here we present the generation of equine cell lines harboring BPV-1 genomes and expressing viral genes. These lines have been either explanted from sarcoid biopsies or generated in vitro by transfection of primary fibroblasts with BPV-1 DNA. Previously detected BPV-1 genome variations in equine sarcoids are also found in sarcoid cell lines, and only variant BPV-1 genomes can transform equine cells. These equine cell lines are morphologically transformed, proliferate faster than parental cells, have an extended life span and can grow independently of substrate. These characteristics are more marked the higher the level of viral E5, E6 and E7 gene expression. These findings confirm that the virus has an active role in the induction of sarcoids and the lines will be invaluable for further studies on the role of BPV-1 in sarcoid pathology
Gis-Based Multi-Criteria Decision Analysis for Forest Fire Risk Mapping
Akay, A. E.; Erdoğan, A.
2017-11-01
The forested areas along the coastal zone of the Mediterranean region in Turkey are classified as first-degree fire sensitive areas. Forest fires are major environmental disaster that affects the sustainability of forest ecosystems. Besides, forest fires result in important economic losses and even threaten human lives. Thus, it is critical to determine the forested areas with fire risks and thereby minimize the damages on forest resources by taking necessary precaution measures in these areas. The risk of forest fire can be assessed based on various factors such as forest vegetation structures (tree species, crown closure, tree stage), topographic features (slope and aspect), and climatic parameters (temperature, wind). In this study, GIS-based Multi-Criteria Decision Analysis (MCDA) method was used to generate forest fire risk map. The study was implemented in the forested areas within Yayla Forest Enterprise Chiefs at Dursunbey Forest Enterprise Directorate which is classified as first degree fire sensitive area. In the solution process, "extAhp 2.0" plug-in running Analytic Hierarchy Process (AHP) method in ArcGIS 10.4.1 was used to categorize study area under five fire risk classes: extreme risk, high risk, moderate risk, and low risk. The results indicated that 23.81 % of the area was of extreme risk, while 25.81 % was of high risk. The result indicated that the most effective criterion was tree species, followed by tree stages. The aspect had the least effective criterion on forest fire risk. It was revealed that GIS techniques integrated with MCDA methods are effective tools to quickly estimate forest fire risk at low cost. The integration of these factors into GIS can be very useful to determine forested areas with high fire risk and also to plan forestry management after fire.
GIS WORK GROUP: AN OVERVIEW (INCLUDES GIS-QA AND AUDITING GIS DATABASE SYSTEMS)
In order to promote cooperation in the implementation of GIS in regional offices, a GIS Regional Workgroup was established by the ten Regions in 1989. Since that time the GIS Work Group evolved and now consists of members from each of the ten EPA Regional Offices, the Office of A...
Black Sea GIS developed in MHI
Zhuk, E.; Khaliulin, A.; Zodiatis, G.; Nikolaidis, A.; Isaeva, E.
2016-08-01
The work aims at creating the Black Sea geoinformation system (GIS) and complementing it with a model bank. The software for data access and visualization was developed using client server architecture. A map service based on MapServer and MySQL data management system were chosen for the Black Sea GIS. Php-modules and python-scripts are used to provide data access, processing, and exchange between the client application and the server. According to the basic data types, the module structure of GIS was developed. Each type of data is matched to a module which allows selection and visualization of the data. At present, a GIS complement with a model bank (the models build in to the GIS) and users' models (programs launched on users' PCs but receiving and displaying data via GIS) is developed.
Epidemiology and molecular detection of equine herpesviruses in western Algeria in 2011.
Laabassi, F; Hue, E; Fortier, C; Morilland, E; Legrand, L; Hans, A; Pronost, S
2017-08-01
An episode of acute equine respiratory infection was reported in western Algeria (Tiaret province) between February and March 2011, affecting a large population of horses. Nasal swabs (n=100) were taken from horses aged between 1 and 27 years, presenting with cough and mucopurulent nasal discharge. The prevalence of equine respiratory virus infections was examined using quantitative polymerase chain reaction (qPCR). One, or more, of four equine respiratory viruses were detected in the nasal swabs of 90 of 100 horses (90%) and the detection rate of equine herpesvirus type 1 (EHV-1), equine herpesvirus type 4 (EHV-4), equine herpesvirus type 2 (EHV-2) and equine herpesvirus type 5 (EHV-5) were 2%, 14%, 90% and 75%, respectively. Equine influenza virus and equine arteritis virus were not detected in any samples. Among the 90 infected horses, 70 were co-infected with EHV-2 and EHV-5 and 14 others were co-infected with EHV-4, EHV-2 and EHV-5. The present study shows a positivity rate of 97.3% for EHV-5 in young horses aged equine herpesviruses 1, 2, 4 and 5 are endemic in horse populations from Algeria as detected for the first time by qPCR. Copyright © 2017 Elsevier B.V. All rights reserved.
The haemagglutination activity of equine herpesvirus type 1 glycoprotein C.
Andoh, Kiyohiko; Hattori, Shiho; Mahmoud, Hassan Y A H; Takasugi, Maaya; Shimoda, Hiroshi; Bannai, Hiroshi; Tsujimura, Koji; Matsumura, Tomio; Kondo, Takashi; Kirisawa, Rikio; Mochizuki, Masami; Maeda, Ken
2015-01-02
Equine herpesvirus type 1 (EHV-1) has haemagglutination (HA) activity toward equine red blood cells (RBCs), but the identity of its haemagglutinin is unknown. To identify the haemagglutinin of EHV-1, the major glycoproteins of EHV-1 were expressed in 293T cells, and the cells or cell lysates were mixed with equine RBCs. The results showed that only EHV-1 glycoprotein C (gC)-producing cells adsorbed equine RBCs, and that the lysate of EHV-1 gC-expressing cells agglutinated equine RBCs. EHV-1 lacking gC did not show HA activity. HA activity was inhibited by monoclonal antibodies (MAbs) specific for gC, but not by antibodies directed against other glycoproteins. In addition, HA activity was not inhibited by the addition of heparin. These results indicate that EHV-1 gC can bind equine RBCs irrespective of heparin, in contrast to other herpesvirus gC proteins. Copyright © 2014 Elsevier B.V. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Kast, Karl; Saucke, Ulrich; Elsaesser, Ralph [Dr.-Ing. Karl Kast + Partner (GbR) Ingenieurgemeinschaft fuer Umwelt- und Geotechnik, Ettlingen (Germany)
2010-07-01
The German standard DIN 19 700 stipulates regular safety reports assessing dams and their operation as part of the continuous dam monitoring scheme. Experience has shown that a GIS based dam monitoring system exhibits evident advantages regarding a continuous assessment. Besides and easy access to all relevant information grouped by themes, it offers a graphic analysis of measuring data and their display in the GIS system. In addition, concerning relevant failure mechanism, individual modules of a GIS based expert system are designed for the purpose of assessing the safety of the dam in the event of uncommon incidents. (orig.)
Web-based GIS for spatial pattern detection: application to malaria incidence in Vietnam.
Bui, Thanh Quang; Pham, Hai Minh
2016-01-01
There is a great concern on how to build up an interoperable health information system of public health and health information technology within the development of public information and health surveillance programme. Technically, some major issues remain regarding to health data visualization, spatial processing of health data, health information dissemination, data sharing and the access of local communities to health information. In combination with GIS, we propose a technical framework for web-based health data visualization and spatial analysis. Data was collected from open map-servers and geocoded by open data kit package and data geocoding tools. The Web-based system is designed based on Open-source frameworks and libraries. The system provides Web-based analyst tool for pattern detection through three spatial tests: Nearest neighbour, K function, and Spatial Autocorrelation. The result is a web-based GIS, through which end users can detect disease patterns via selecting area, spatial test parameters and contribute to managers and decision makers. The end users can be health practitioners, educators, local communities, health sector authorities and decision makers. This web-based system allows for the improvement of health related services to public sector users as well as citizens in a secure manner. The combination of spatial statistics and web-based GIS can be a solution that helps empower health practitioners in direct and specific intersectional actions, thus provide for better analysis, control and decision-making.
The embryogenesis of the equine femorotibial joint : The equine interzone
Jenner, F; van Osch, G J V M; Weninger, W; Geyer, S; Stout, T; van Weeren, René; Brama, P; van Weeren, René
REASONS FOR PERFORMING STUDY: Articular cartilage regeneration is the focus and goal of considerable research effort. Since articular chondrocytes descend from a distinct cohort of progenitor cells located in embryonic nascent joints (interzones), establishing the timing of equine interzone
Hydropower systems planning in distribution networks based on GIS
Energy Technology Data Exchange (ETDEWEB)
Ramirez-Rosado, I.J.; Zorzano-Santamaria, P.; Fernandez-Jiminez, L.A.; Garcia-Garrido, E.; Zorzano-Alba, E.; Lara-Santillan, P.M.; Mendoza-Villena, M. [La Rioja Univ., La Rioja (Spain). Dept. of Electrical Engineering
2005-07-01
Planning models for hydraulic energy systems developed with a new computational geographic information system (GIS) tool were presented. The GIS tool was used to identify sections of rivers that are suitable for small-scale run-of-river hydropower generation in the La Rioja region of Spain. The tool was also used to evaluate economic data related to financing grants, technological costs, installation costs, and forecast demands for various consumption scenarios. Case studies of 2 hydropower systems were used to test the tool. The planning models were based on levelized electric costs (LEC) of run-of-river hydropower systems, and enabled the systems to be analyzed in isolation as well as when connected to an existing electricity network. Results of the modelling studies showed that the tool is capable of analyzing the LEC of potential hydropower systems in a range of different scenarios while maintaining the geographic characteristics and requirements of individual regions. 7 refs., 4 figs.
Directory of Open Access Journals (Sweden)
Kosec Marjan
2016-01-01
Full Text Available Equine viral arteritis (EVA is a contagious disease of equids caused by equine artheritis virus (EAV, widespread in most countries in the world, where patients are diagnosed. The infection usually starts asymptomatic. Clinical signs indicate respiratory infection of different intensity and also abortions are present at different stages of gestation. Large prevalence of this disease in the world has become a growing economic problem. The disease is specific to a particular kind of animals, and it affects only equids (horses, donkeys, mules, mule and zebras. In countries where the infection has been confirmed, the percentage of positive animals differ. Likewise, there is difference in percentage among certain animal kinds. The highest percentage of positive animals has been found in totters and the lowest in cold-blooded.
DEVELOPING GIS-BASED DEMAND-RESPONSIVE TRANSIT SYSTEM IN TEHRAN CITY
Directory of Open Access Journals (Sweden)
H. Faroqi
2015-12-01
Full Text Available Create, maintain and development of public transport network in metropolitan are important problems in the field of urban transport management. In public transport, maximize the efficient use of public fleet capacity has been considered. Concepts and technologies of GIS have provided suitable way for management and optimization of the public transports systems. In demand-responsive public transportation system, firstly fellow traveller groups have been established for applicants based on spatial concepts and tools of GIS, second for each group according to its’ members and their paths, a public vehicle has been allocated to them then based on dynamic routing, the fellow passenger group has been gathered from their origins and has been moved to their destinations through optimal route. The suggested system has been implemented based on network data and commuting trips statistics of 1 to 6 districts in Tehran city. Evaluation performed on the results show the 34% increase using of Taxi capacity, 13% increase using of Van capacity and 10% increase using of Bus capacity in comparison between current public transport system and suggested public transportation system has been improved.
[Equine Infectious Anemia (EIA)].
Kaiser, A; Meier, H P; Straub, R; Gerber, V
2009-04-01
Equine Infectious Anemia (EIA) is a reportable, eradicable epizootic disease caused by the equine lentivirus of the retrovirus family which affects equids only and occurs worldwide. The virus is transmitted by blood, mainly by sanguivorous insects. The main symptoms of the disease are pyrexia, apathy, loss of body condition and weight, anemia, edema and petechia. However, infected horses can also be inapparent carriers without any overt signs. The disease is diagnosed by serological tests like the Coggins test and ELISA tests. Presently, Switzerland is offi cially free from EIA. However, Switzerland is permanently at risk of introducing the virus as cases of EIA have recently been reported in different European countries.
Depth data research of GIS based on clustering analysis algorithm
Xiong, Yan; Xu, Wenli
2018-03-01
The data of GIS have spatial distribution. Geographic data has both spatial characteristics and attribute characteristics, and also changes with time. Therefore, the amount of data is very large. Nowadays, many industries and departments in the society are using GIS. However, without proper data analysis and mining scheme, GIS will not exert its maximum effectiveness and will waste a lot of data. In this paper, we use the geographic information demand of a national security department as the experimental object, combining the characteristics of GIS data, taking into account the characteristics of time, space, attributes and so on, and using cluster analysis algorithm. We further study the mining scheme for depth data, and get the algorithm model. This algorithm can automatically classify sample data, and then carry out exploratory analysis. The research shows that the algorithm model and the information mining scheme can quickly find hidden depth information from the surface data of GIS, thus improving the efficiency of the security department. This algorithm can also be extended to other fields.
Directory of Open Access Journals (Sweden)
Dong-Hoon Chung
2014-06-01
Full Text Available Alphaviruses present serious health threats as emerging and re-emerging viruses. Venezuelan equine encephalitis virus (VEEV, a New World alphavirus, can cause encephalitis in humans and horses, but there are no therapeutics for treatment. To date, compounds reported as anti-VEEV or anti-alphavirus inhibitors have shown moderate activity. To discover new classes of anti-VEEV inhibitors with novel viral targets, we used a high-throughput screen based on the measurement of cell protection from live VEEV TC-83-induced cytopathic effect to screen a 340,000 compound library. Of those, we identified five novel anti-VEEV compounds and chose a quinazolinone compound, CID15997213 (IC50 = 0.84 µM, for further characterization. The antiviral effect of CID15997213 was alphavirus-specific, inhibiting VEEV and Western equine encephalitis virus, but not Eastern equine encephalitis virus. In vitro assays confirmed inhibition of viral RNA, protein, and progeny synthesis. No antiviral activity was detected against a select group of RNA viruses. We found mutations conferring the resistance to the compound in the N-terminal domain of nsP2 and confirmed the target residues using a reverse genetic approach. Time of addition studies showed that the compound inhibits the middle stage of replication when viral genome replication is most active. In mice, the compound showed complete protection from lethal VEEV disease at 50 mg/kg/day. Collectively, these results reveal a potent anti-VEEV compound that uniquely targets the viral nsP2 N-terminal domain. While the function of nsP2 has yet to be characterized, our studies suggest that the protein might play a critical role in viral replication, and further, may represent an innovative opportunity to develop therapeutic interventions for alphavirus infection.
Study on Global GIS architecture and its key technologies
Cheng, Chengqi; Guan, Li; Lv, Xuefeng
2010-11-01
Global GIS (G2IS) is a system, which supports the huge data process and the global direct manipulation on global grid based on spheroid or ellipsoid surface. Based on global subdivision grid (GSG), Global GIS architecture is presented in this paper, taking advantage of computer cluster theory, the space-time integration technology and the virtual reality technology. Global GIS system architecture is composed of five layers, including data storage layer, data representation layer, network and cluster layer, data management layer and data application layer. Thereinto, it is designed that functions of four-level protocol framework and three-layer data management pattern of Global GIS based on organization, management and publication of spatial information in this architecture. Three kinds of core supportive technologies, which are computer cluster theory, the space-time integration technology and the virtual reality technology, and its application pattern in the Global GIS are introduced in detail. The primary ideas of Global GIS in this paper will be an important development tendency of GIS.
Epidemiological survey of equine influenza in horses in India.
Mavadiya, S V; Raval, S K; Mehta, S A; Kanani, A N; Vagh, A A; Tank, P H; Patel, P R
2012-12-01
A highly contagious virus infection in horses, influenza is the single most important equine respiratory disease in the world. This paper presents details of a one-year study (1 June 2008 to 31 May 2009) to determine the prevalence of equine influenza in the horses of Gujarat State in India. The prevalence of equine influenza A/equi-2 was 12.02%, but none of the samples were positive for equine influenza A/equi-1. The prevalence of equine influenza (A/equi-2) was 15.38%, 11.94%, 10.18%, and 9.09% in horses of the Kathiyawari breed, a non-descript breed, the Marwari breed and the Indian Thoroughbred breed, respectively. The highest prevalence of influenza was observed in yearlings (17.48%) and prevalence was at its highest in the month of April (28.89%). The prevalence rate in males, females and geldings was 11.95%, 10.38% and 8.47%, respectively. The mortality rate and case fatality rate were 1.28% and 10.64%, respectively.
Anugrah, Wirdah; Suryono; Suseno, Jatmiko Endro
2018-02-01
Management of water resources based on Geographic Information System can provide substantial benefits to water availability settings. Monitoring the potential water level is needed in the development sector, agriculture, energy and others. In this research is developed water resource information system using real-time Geographic Information System concept for monitoring the potential water level of web based area by applying rule based system method. GIS consists of hardware, software, and database. Based on the web-based GIS architecture, this study uses a set of computer that are connected to the network, run on the Apache web server and PHP programming language using MySQL database. The Ultrasound Wireless Sensor System is used as a water level data input. It also includes time and geographic location information. This GIS maps the five sensor locations. GIS is processed through a rule based system to determine the level of potential water level of the area. Water level monitoring information result can be displayed on thematic maps by overlaying more than one layer, and also generating information in the form of tables from the database, as well as graphs are based on the timing of events and the water level values.
GIS-based rare events logistic regression for mineral prospectivity mapping
Xiong, Yihui; Zuo, Renguang
2018-02-01
Mineralization is a special type of singularity event, and can be considered as a rare event, because within a specific study area the number of prospective locations (1s) are considerably fewer than the number of non-prospective locations (0s). In this study, GIS-based rare events logistic regression (RELR) was used to map the mineral prospectivity in the southwestern Fujian Province, China. An odds ratio was used to measure the relative importance of the evidence variables with respect to mineralization. The results suggest that formations, granites, and skarn alterations, followed by faults and aeromagnetic anomaly are the most important indicators for the formation of Fe-related mineralization in the study area. The prediction rate and the area under the curve (AUC) values show that areas with higher probability have a strong spatial relationship with the known mineral deposits. Comparing the results with original logistic regression (OLR) demonstrates that the GIS-based RELR performs better than OLR. The prospectivity map obtained in this study benefits the search for skarn Fe-related mineralization in the study area.
The architecture of a virtual grid GIS server
Wu, Pengfei; Fang, Yu; Chen, Bin; Wu, Xi; Tian, Xiaoting
2008-10-01
The grid computing technology provides the service oriented architecture for distributed applications. The virtual Grid GIS server is the distributed and interoperable enterprise application GIS architecture running in the grid environment, which integrates heterogeneous GIS platforms. All sorts of legacy GIS platforms join the grid as members of GIS virtual organization. Based on Microkernel we design the ESB and portal GIS service layer, which compose Microkernel GIS. Through web portals, portal GIS services and mediation of service bus, following the principle of SoC, we separate business logic from implementing logic. Microkernel GIS greatly reduces the coupling degree between applications and GIS platforms. The enterprise applications are independent of certain GIS platforms, and making the application developers to pay attention to the business logic. Via configuration and orchestration of a set of fine-grained services, the system creates GIS Business, which acts as a whole WebGIS request when activated. In this way, the system satisfies a business workflow directly and simply, with little or no new code.
[Infection control and hygiene management in equine hospitals].
Walther, Birgit; Janssen, Traute; Gehlen, Heidrun; Vincze, Szilvia; Borchers, Kerstin; Wieler, Lothar H; Barton, Ann Kristin; Lübke-Becker, Antina
2014-01-01
With the rising importance of nosocomial infections in equine hospitals, increased efforts with regard to biosecurity and infection control are necessary. This even more since nosocomial infections are often associated with multi-drug resistant pathogens. Consequently, the implementation of targeted prevention programs is essential. Since nosocomial infections are usually multifactorial events, realization of only a single measure is rarely effective to overcome nosocomial spread in clinical practice. Equine patients may be colonized at admission with multi-drug resistant pathogens such as methicillin resistant Staphylococcus aureus (MRSA) and/or extended spectrum beta lactamase-producing (ESBL-) Enterobacteriaceae. Regardless of their individual resistance properties, these bacteria are common and usually unnoticed colonizers of either the nasopharynx or the intestinal tract. Also viral diseases caused by equine herpesvirus 1 (EHV-1) and EHV-4 may reach a clinic by patients which are latently infected or in the incubation period. To prevent nosocomal outbreaks, achieve an interruption in the infection chain and to eradicate infectious agents from the hospital environment, a professional hospital management is necessary. This should be adapted to both the wide range of pathogens causing nosocomial infections and the individual needs of equine patients. Amongst others, this approach includes a risk classification of equine patients at admission and information/enlightenment of the animal owners at discharge. An efficient management of inpatients, a targeted hygiene management and clear responsibilities with respect to biosecurity together with a surveillance of nosocomial infections form the cornerstone of infection control in equine hospitals.
A DISTRIBUTED HYPERMAP MODEL FOR INTERNET GIS
Institute of Scientific and Technical Information of China (English)
无
2000-01-01
The rapid development of Internet technology makes it possible to integrate GIS with the Internet,forming Internet GIS.Internet GIS is based on a distributed client/server architecture and TCP/IP & IIOP.When constructing and designing Internet GIS,we face the problem of how to express information units of Internet GIS.In order to solve this problem,this paper presents a distributed hypermap model for Internet GIS.This model provides a solution to organize and manage Internet GIS information units.It also illustrates relations between two information units and in an internal information unit both on clients and servers.On the basis of this model,the paper contributes to the expressions of hypermap relations and hypermap operations.The usage of this model is shown in the implementation of a prototype system.
Equine-Assisted Therapies: Complementary Medicine or Not?
Ratcliffe, Katherine T.; Sanekane, Cindy
2009-01-01
Equine-assisted therapies are interventions that use the unique qualities of a horse to assist persons with disabilities to improve their gross motor, language, social, and self-help skills. Programs offering these services are varied and operate on all major continents across the world. The effectiveness of equine-assisted therapies is generally…
Gis-Based Smart Cartography Using 3d Modeling
Malinverni, E. S.; Tassetti, A. N.
2013-08-01
3D City Models have evolved to be important tools for urban decision processes and information systems, especially in planning, simulation, analysis, documentation and heritage management. On the other hand existing and in use numerical cartography is often not suitable to be used in GIS because not geometrically and topologically correctly structured. The research aim is to 3D structure and organize a numeric cartography for GIS and turn it into CityGML standardized features. The work is framed around a first phase of methodological analysis aimed to underline which existing standard (like ISO and OGC rules) can be used to improve the quality requirement of a cartographic structure. Subsequently, from this technical specifics, it has been investigated the translation in formal contents, using an owner interchange software (SketchUp), to support some guide lines implementations to generate a GIS3D structured in GML3. It has been therefore predisposed a test three-dimensional numerical cartography (scale 1:500, generated from range data captured by 3D laser scanner), tested on its quality according to the previous standard and edited when and where necessary. Cad files and shapefiles are converted into a final 3D model (Google SketchUp model) and then exported into a 3D city model (CityGML LoD1/LoD2). The GIS3D structure has been managed in a GIS environment to run further spatial analysis and energy performance estimate, not achievable in a 2D environment. In particular geometrical building parameters (footprint, volume etc.) are computed and building envelop thermal characteristics are derived from. Lastly, a simulation is carried out to deal with asbestos and home renovating charges and show how the built 3D city model can support municipal managers with risk diagnosis of the present situation and development of strategies for a sustainable redevelop.
Henry, Paul; Semple, Hugh
2012-01-01
GIS has shown promise in Project Based Learning (PBL) environments, but many obstacles exist in its integration into school curriculums. This article discusses the development and utilization of an online GIS tool that was created to illustrate that the perceptual gap between relevance and ease of use of GIS software can be bridged at the K-12…
A Microbiological Map of the Healthy Equine Gastrointestinal Tract.
Directory of Open Access Journals (Sweden)
Aaron C Ericsson
Full Text Available Horses are exquisitely sensitive to non-specific gastrointestinal disturbances as well as systemic and extraintestinal conditions related to gut health, yet minimal data are available regarding the composition of the microbiota present in the equine stomach, small intestine, and cecum and their relation to fecal microbiota. Moreover, there is minimal information regarding the concordance of the luminal and mucosal microbial communities throughout the equine gut. Illumina-based 16S rRNA gene amplicon sequencing of the luminal and mucosal microbiota present in seven regions of the gastrointestinal tract of nine healthy adult horses revealed a distinct compositional divide between the small and large intestines. This disparity in composition was more pronounced within the luminal contents, but was also detected within mucosal populations. Moreover, the uniformity of the gut microbiota was much higher in the cecum and colon relative to that in the stomach, jejunum and ileum, despite a significantly higher number of unique sequences detected in the colon. Collectively, the current data suggest that while colonic samples (a proxy for feces may provide a reasonable profile of the luminal contents of the healthy equine large intestine, they are not informative with regard to the contents of the stomach or small intestine. In contrast to the distinct difference between the highly variable upper gastrointestinal tract microbiota and relatively uniform large bowel microbiota present within the lumen, these data also demonstrate a regional continuity present in mucosal microbial communities throughout the length of the equine gut.
Development and characterization of a homologous radioimmunoassay for equine prolactin
International Nuclear Information System (INIS)
Roser, J.F.; Chang, Y.S.; Papkoff, H.; Li, C.H.
1984-01-01
A specific and sensitive homologous radioimmunoassay has been developed for equine prolactin, suitable for measuring prolactin concentrations in serum of horses. The sensitivity of the assay ranged from 0.4 to 0.6 ng/ml and the intra- and inter-assay coefficients of variation averaged 6.9 and 15.4%, respectively, for five doses of hormone. Cross-reactivity with other mammalian and nonmammalian prolactins and growth hormones was less than 20 and 0.3%, respectively. Cross-reactivity with equine growth hormone was less than 0.07%. Equine serum and pituitary extracts showed parallel dilution-response curves with equine prolactin. The percentage recovery of exogenous equine prolactin in serum was 89%. Preliminary analysis of several physiological samples (stallions, pregnant, and nonpregnant mares) yielded values from 0.6 to 12.0 ng/ml
The equine practitioner-farrier relationship: building a partnership.
Moyer, William; O'Grady, Stephen E; Werner, Harry W
2012-04-01
The importance of hoof care in maintaining the health and soundness of a horse cannot be overstated. The aphorism, “No foot, no horse” still holds true. For equine ambulatory practitioners, the time devoted to a thorough understanding of the equine digit and it’s care is well worth the investment. The effort devoted to developing good relationships with individuals who will likely be responsible for implementing the changes suggested as a result of that understanding will be rewarded many times over in the course of the equine ambulatory practitioner’s career.
A WebGIS-based system for analyzing and visualizing air quality data for Shanghai Municipality
Wang, Manyi; Liu, Chaoshun; Gao, Wei
2014-10-01
An online visual analytical system based on Java Web and WebGIS for air quality data for Shanghai Municipality was designed and implemented to quantitatively analyze and qualitatively visualize air quality data. By analyzing the architecture of WebGIS and Java Web, we firstly designed the overall scheme for system architecture, then put forward the software and hardware environment and also determined the main function modules for the system. The visual system was ultimately established with the DIV + CSS layout method combined with JSP, JavaScript, and some other computer programming languages based on the Java programming environment. Moreover, Struts, Spring, and Hibernate frameworks (SSH) were integrated in the system for the purpose of easy maintenance and expansion. To provide mapping service and spatial analysis functions, we selected ArcGIS for Server as the GIS server. We also used Oracle database and ESRI file geodatabase to store spatial data and non-spatial data in order to ensure the data security. In addition, the response data from the Web server are resampled to implement rapid visualization through the browser. The experimental successes indicate that this system can quickly respond to user's requests, and efficiently return the accurate processing results.
Directory of Open Access Journals (Sweden)
Romain Paillot
2016-11-01
Full Text Available Vaccination is highly effective to prevent, control, and limit the impact of equine influenza (EI, a major respiratory disease of horses. However, EI vaccines should contain relevant equine influenza virus (EIV strains for optimal protection. The OIE expert surveillance panel annually reviews EIV evolution and, since 2010, the use of Florida clade 1 and 2 sub-lineages representative vaccine strains is recommended. This report summarises the development process of a fully- updated recombinant canarypox-based EI vaccine in order to meet the last OIE recommendations, including the vaccine mode of action, production steps and schedule. The EI vaccine ProteqFlu contains 2 recombinant canarypox viruses expressing the haemagglutinin of the A/equine/Ohio/03 and A/equine/Richmond/1/07 isolates (Florida clade 1 and 2 sub-lineages, respectively. The updated EI vaccine was tested for efficacy against the representative Florida clade 2 EIV strain A/equine/Richmond/1/07 in the Welsh mountain pony model. Protective antibody response, clinical signs of disease and virus shedding were compared with unvaccinated control ponies. Significant protection was measured in vaccinated ponies, which supports the vaccine registration. The recombinant canarypox-based EI vaccine was the first fully updated EI vaccine available in the EU, which will help to minimise the increasing risk of vaccine breakdown due to constant EIV evolution through antigenic drift.
Sensuous and Reflexive GIS: exploring visualisation and VRML
Directory of Open Access Journals (Sweden)
Mark Gillings
1996-09-01
Full Text Available Over the last five years, landscape-based archaeological research has been transformed as the widespread introduction of Geographical Information Systems (GIS has begun to revolutionise the way we, as archaeologists, manage and manipulate spatial information. As GIS-based applications begin to reach maturity and the role of GIS as a flexible mechanism for the articulation, exploration and analysis of landscape data becomes more fully realised, GIS is increasingly being seen as much as a place to think as a simple data management and mapping tool.
Kearney, C M; Buckley, C T; Jenner, F; Moissonnier, P; Brama, P A J
2014-07-01
Selection of suture material in equine surgery is often based on costs or subjective factors, such as the surgeon's personal experience, rather than objective facts. The amount of objective data available on durability of suture materials with regard to specific equine physiological conditions is limited. To evaluate the effect of various equine physiological and pathological fluids on the rate of degradation of a number of commonly used suture materials. In vitro material testing. Suture materials were exposed in vitro to physiological fluid, followed by biomechanical analysis. Three absorbable suture materials, glycolide/lactide copolymer, polyglactin 910 and polydioxanone were incubated at 37°C for 7, 14 or 28 days in phosphate-buffered saline, equine serum, equine urine and equine peritoneal fluid from an animal with peritonitis. Five strands of each suture material type were tested to failure in a materials testing machine for each time point and each incubation medium. Yield strength, strain and Young's modulus were calculated, analysed and reported. For all suture types, the incubation time had a significant effect on yield strength, percentage elongation and Young's modulus in all culture media (Ptype was also shown significantly to influence changes in each of yield strength, percentage elongation and Young's modulus in all culture media (Ptype of fluid have significant effects on the biomechanical properties of various suture materials. These findings are important for evidence-based selection of suture material in clinical cases. © 2013 EVJ Ltd.
Rieger, Martin; Kochleus, Christian; Teschner, Dana; Rascher, Daniela; Barton, Ann Kristin; Geerlof, Arie; Kremmer, Elisabeth; Schmid, Michael; Hartmann, Anton; Gehlen, Heidrun
2014-09-01
In human medicine, procalcitonin (PCT) is a very common and well-established biomarker for sepsis. Even though sepsis is also a leading cause of death in foals and adult horses, up to now, no data about the role of equine PCT in septic horses has been available. Based on monoclonal antibodies targeted against human PCT, we report here the development of a sandwich ELISA for the quantification of equine PCT in equine plasma samples. The ELISA was characterized for intra- and interassay variance and a working range from 25 to 1,000 ng mL(-1) was defined as within this range; both intra- and interassay variances were below 15 %. The target recovery ranged between 73 and 106 %. The ELISA was used to determine the equine PCT concentration in 24 healthy and 5 septic horses to show the potential for clinical evaluation of equine PCT. Significantly different (P = 0.0006) mean equine PCT concentrations were found for the healthy control group and the sepsis group (47 and 8,450 ng mL(-1)).
Zarski, Lila M; High, Emily A; Nelli, Rahul K; Bolin, Steven R; Williams, Kurt J; Hussey, Gisela
2017-10-01
Equine herpesvirus 5 (EHV-5) infection is associated with pulmonary fibrosis in horses, but further studies on EHV-5 persistence in equine cells are needed to fully understand viral and host contributions to disease pathogenesis. Our aim was to develop a quantitative PCR (qPCR) assay to measure EHV-5 viral copy number in equine cell cultures, blood lymphocytes, and nasal swabs of horses. Furthermore, we used a recently developed equine primary respiratory cell culture system to study EHV-5 pathogenesis at the respiratory tract. PCR primers and a probe were designed to target gene E11 of the EHV-5 genome. Sensitivity and repeatability were established, and specificity was verified by testing multiple isolates of EHV-5, as well as DNA from other equine herpesviruses. Four-week old fully differentiated (mature), newly seeded (immature) primary equine respiratory epithelial cell (ERECs), and equine dermal cell cultures were inoculated with EHV-5 and the cells and supernatants collected daily for 14days. Blood lymphocytes and nasal swabs were collected from horses experimentally infected with equine herpesvirus 1 (EHV-1). The qPCR assay detected EHV-5 at stable concentrations throughout 14days in inoculated mature EREC and equine dermal cell cultures (peaking at 202 and 5861 viral genomes per 10 6 cellular β actin, respectively). EHV-5 copies detected in the immature EREC cultures increased over 14days and reached levels greater than 10,000 viral genomes per 10 6 cellular β actin. Moreover, EHV-5 was detected in the lymphocytes of 76% of horses and in the nasal swabs of 84% of horses experimentally infected with EHV-1 pre-inoculation with EHV-1. Post-inoculation with EHV-1, EHV-5 was detected in lymphocytes of 52% of horses while EHV-5 levels in nasal swabs were not significantly different from pre-inoculation levels. In conclusion, qPCR was a reliable technique to investigate viral load in in vivo and in vitro samples, and EHV-5 replication in equine epithelial cells
Hitchens, P L; Hultgren, J; Frössling, J; Emanuelson, U; Keeling, L J
2017-07-01
Determining welfare status in a population is the first step in efforts to improve welfare. The primary objective of this study was to explore a new epidemiological approach for analysis of data from official competent authorities that pertain to compliance with animal welfare legislation. We reviewed data already routinely collected as part of Swedish official animal welfare inspections for 2010-13, using a checklist containing 45 checkpoints (CPs). These covered animal-, resource- and management-based measures of equine welfare. The animal-based CPs were measures that directly related to the animal and included social contact, body condition, hoof condition and cleanliness. Non-compliance with one or more of the animal-based CPs was used as a binary outcome of poor equine welfare; 95% confidence intervals (CI) were estimated using the exact binomial distribution. Associations were determined using multivariable logistic regression, adjusting for clustering on premises. Resource- and management-based CPs (model inputs) were reduced by principal component analysis. Other input factors included premises characteristics (e.g. size, location) and inspection characteristics (e.g. type of inspection). There were 30 053 premises with horses from 21 counties registered by the Swedish Board of Agriculture. In total 13 321 inspections of premises were conducted at 28.4% (n=8532) of all registered premises. For random inspections, the premises-prevalence of poor equine welfare was 9.5% (95% CI 7.5, 11.9). Factors associated with poor equine welfare were non-compliance with requirements for supervision, care or feeding of horses, facility design, personnel, stable hygiene, pasture and exercise area maintenance, as well as the owner not being notified of the inspection, a previous complaint or deficiency, spring compared with autumn, and not operating as a professional equine business. Horses at premises compliant with stabling and shelter requirements had significantly better
GIS-based Watershed Management Modeling for Surface Runoff Calculation in Tatara River Basin, Japan
Ix, Hour; Mori, Makito; Hiramatsu, Kazuaki; Harada, Masayoshi
2007-01-01
In the past few decades when Geographical Information System (GIS) technology was not fully developed in practical use, watershed delineation work used to be conducted manually by hydrologists based on topographic maps. The work was a tedious operation, since it had to be done repeatedly in similar manner for each basin or sub-basin of interest, and its process always left some unpredicted errors. Nowadays, GIS software is being upgraded regularly with powerful tools responding to the needs o...
DEFF Research Database (Denmark)
Pedersen, Philip Juul; Thomsen, Kirsten Brolin; Olander, Emma Rie
2015-01-01
and conventional PCR on mRNA purified from equine myocardial tissue. Equine KV11.1 and KCNE2 cDNA had a high homology to human genes (93 and 88%, respectively). Equine and human KV11.1 and KV11.1/KCNE2 were expressed in Xenopus laevis oocytes and investigated by two-electrode voltage-clamp. Equine KV11.1 currents...... were larger compared to human KV11.1, and the voltage dependence of activation was shifted to more negative values with V1/2 = -14.2±1.1 mV and -17.3±0.7, respectively. The onset of inactivation was slower for equine KV11.1 compared to the human homolog. These differences in kinetics may account...... for the larger amplitude of the equine current. Furthermore, the equine KV11.1 channel was susceptible to pharmacological block with terfenadine. The physiological importance of KV11.1 was investigated in equine right ventricular wedge preparations. Terfenadine prolonged action potential duration and the effect...
Xiaodan, Wang; Xianghao, Zhong; Pan, Gao
2010-10-01
Regional eco-security assessment is an intricate, challenging task. In previous studies, the integration of eco-environmental models and geographical information systems (GIS) usually takes two approaches: loose coupling and tight coupling. However, the present study used a full coupling approach to develop a GIS-based regional eco-security assessment decision support system (ESDSS). This was achieved by merging the pressure-state-response (PSR) model and the analytic hierarchy process (AHP) into ArcGIS 9 as a dynamic link library (DLL) using ArcObjects in ArcGIS and Visual Basic for Applications. Such an approach makes it easy to capitalize on the GIS visualization and spatial analysis functions, thereby significantly supporting the dynamic estimation of regional eco-security. A case study is presented for the Tibetan Plateau, known as the world's "third pole" after the Arctic and Antarctic. Results verified the usefulness and feasibility of the developed method. As a useful tool, the ESDSS can also help local managers to make scientifically-based and effective decisions about Tibetan eco-environmental protection and land use. Copyright (c) 2010 Elsevier Ltd. All rights reserved.
A GIS-based Quantitative Approach for the Search of Clandestine Graves, Italy.
Somma, Roberta; Cascio, Maria; Silvestro, Massimiliano; Torre, Eliana
2018-05-01
Previous research on the RAG color-coded prioritization systems for the discovery of clandestine graves has not considered all the factors influencing the burial site choice within a GIS project. The goal of this technical note was to discuss a GIS-based quantitative approach for the search of clandestine graves. The method is based on cross-referenced RAG maps with cumulative suitability factors to host a burial, leading to the editing of different search scenarios for ground searches showing high-(Red), medium-(Amber), and low-(Green) priority areas. The application of this procedure allowed several outcomes to be determined: If the concealment occurs at night, then the "search scenario without the visibility" will be the most effective one; if the concealment occurs in daylight, then the "search scenario with the DSM-based visibility" will be most appropriate; the different search scenarios may be cross-referenced with offender's confessions and eyewitnesses' testimonies to verify the veracity of their statements. © 2017 American Academy of Forensic Sciences.
Actinobacillus equuli subsp. equuli associated with equine valvular endocarditis
DEFF Research Database (Denmark)
Aalbæk, Bent; Østergaard, Stine; Buhl, Rikke
2007-01-01
Microbiological and pathological data from a case of equine valvular endocarditis are reported. Limited information is available on the pathogenic potential of equine Actinobacillus species as several strains originate from apparently healthy horses. After the establishment of two subspecies within...... this species, this seems to be the first report of an etiological association between A. equuli subsp. equuli and equine endocarditis. Furthermore, new information on some phenotypical characteristics of this subspecies are reported, compared to previous findings...
A Web GIS Framework for Participatory Sensing Service: An Open Source-Based Implementation
Directory of Open Access Journals (Sweden)
Yu Nakayama
2017-04-01
Full Text Available Participatory sensing is the process in which individuals or communities collect and analyze systematic data using mobile phones and cloud services. To efficiently develop participatory sensing services, some server-side technologies have been proposed. Although they provide a good platform for participatory sensing, they are not optimized for spatial data management and processing. For the purpose of spatial data collection and management, many web GIS approaches have been studied. However, they still have not focused on the optimal framework for participatory sensing services. This paper presents a web GIS framework for participatory sensing service (FPSS. The proposed FPSS enables an integrated deployment of spatial data capture, storage, and data management functions. In various types of participatory sensing experiments, users can collect and manage spatial data in a unified manner. This feature is realized by the optimized system architecture and use case based on the general requirements for participatory sensing. We developed an open source GIS-based implementation of the proposed framework, which can overcome financial difficulties that are one of the major problems of deploying sensing experiments. We confirmed with the prototype that participatory sensing experiments can be performed efficiently with the proposed FPSS.
DEFF Research Database (Denmark)
Christensen, Michelle Brønniche; Sørensen, Jens Christian; Jacobsen, Stine
2013-01-01
BACKGROUND: Serum amyloid A (SAA) is useful as a diagnostic marker of systemic inflammation in horses, but only heterologous assays based on non-equine calibration and standardization are available for measurements of equine SAA. More accurate measurements could be obtained using purified species......-specific SAA in native conformation for assay calibration and standardization. Further knowledge about the biochemical properties of SAA would facilitate a future production of native species-specific calibration material Therefore, the aim of the study was an investigation of the solubility and potentials...... for purification of equine SAA based on biochemical properties.Freeze dried equine acute phase serum was dissolved in 70% 2-propanol, 8 M urea, and milli-Q water, respectively. Supercritical fluid extraction (SFE), size-exclusive chromatography (FPLC-SEC), and preparative isoelectric focusing (IEF) were performed...
Yildirim, Volkan
2012-09-01
One of the most important steps in solid waste management is the selection of an appropriate landfill site. The site selection process requires the evaluation and analysis of several criteria. However, the traditional evaluation method is not sufficient for the site selection process. Geographical information system (GIS) technologies are effectively used in the process of site selection, which is a spatial problem. This article describes a raster GIS-based landfill site selection (LSS) method. This method utilizes a raster-based spatial database in which the factors affect the landfill site selection. The final product in this method is the cost surface map showing pixel-based values of the appropriate areas. Furthermore, this GIS-based LSS method was applied for the evaluation of two landfill sites in Trabzon Province in Turkey, for which the traditional evaluation method for site selection was used. The suitability values on the cost surface map of these two landfills have shown that these sites are not appropriate for a solid waste landfill. In conclusion, it was demonstrated that the method of raster GIS-based site selection gives more effective results than traditional methods.
Directory of Open Access Journals (Sweden)
Dong Soo Kong
2013-08-01
Full Text Available In recent years, Non-Point Source Pollution has been rising as a significant environmental issue. The sediment-laden water problem is causing serious impacts on river ecosystems not only in South Korea but also in most countries. The vegetative filter strip (VFS has been thought to be one of the most effective methods to reduce the transport of sediment to down-gradient area. However, the effective width of the VFS first needs to be determined before VFS installation in the field. To provide an easy-to-use interface with a scientific VFS modeling engine, the Web GIS-based VFSMOD system was developed in this study. The Web GIS-based VFSMOD uses the UH and VFSM executable programs from the VFSMOD-w model as core engines to simulate rainfall-runoff and sediment trapping. To provide soil information for a point of interest, the Google Map interface to the MapServer soil database system was developed using the Google Map API, Javascript, Perl/CGI, and Oracle DB programming. Three modules of the Web GIS-based VFSMOD system were developed for various VFS designs under single storm, multiple storm, and long-term period scenarios. These modules in the Web GIS-based VFSMOD system were applied to the study watershed in South Korea and these were proven as efficient tools for the VFS design for various purposes.
A GIS-based method for household recruitment in a prospective pesticide exposure study
Directory of Open Access Journals (Sweden)
Phillips Michael J
2008-04-01
Full Text Available Abstract Background Recent advances in GIS technology and remote sensing have provided new opportunities to collect ecologic data on agricultural pesticide exposure. Many pesticide studies have used historical or records-based data on crops and their associated pesticide applications to estimate exposure by measuring residential proximity to agricultural fields. Very few of these studies collected environmental and biological samples from study participants. One of the reasons for this is the cost of identifying participants who reside near study fields and analyzing samples obtained from them. In this paper, we present a cost-effective, GIS-based method for crop field selection and household recruitment in a prospective pesticide exposure study in a remote location. For the most part, our multi-phased approach was carried out in a research facility, but involved two brief episodes of fieldwork for ground truthing purposes. This method was developed for a larger study designed to examine the validity of indirect pesticide exposure estimates by comparing measured exposures in household dust, water and urine with records-based estimates that use crop location, residential proximity and pesticide application data. The study focused on the pesticide atrazine, a broadleaf herbicide used in corn production and one of the most widely-used pesticides in the U.S. Results We successfully used a combination of remotely-sensed data, GIS-based methods and fieldwork to select study fields and recruit participants in Illinois, a state with high corn production and heavy atrazine use. Our several-step process consisted of the identification of potential study fields and residential areas using aerial photography; verification of crop patterns and land use via site visits; development of a GIS-based algorithm to define recruitment areas around crop fields; acquisition of geocoded household-level data within each recruitment area from a commercial vendor; and
Identification of equine influenza virus infection in Asian wild horses (Equus przewalskii).
Yin, Xin; Lu, Gang; Guo, Wei; Qi, Ting; Ma, Jian; Zhu, Chao; Zhao, Shihua; Pan, Jialiang; Xiang, Wenhua
2014-05-01
An outbreak of equine influenza was observed in the Asian wild horse population in Xinjiang Province, China, in 2007. Nasal swabs were collected from wild horses and inoculated into 9-10-day SPF embryonated eggs. The complete genome of the isolate was sequenced. A comparison of the amino acid sequence revealed that the isolate was an equine influenza virus strain, which we named A/equine/Xinjiang/4/2007. Each gene of the virus was found to have greater than 99 % homology to equine influenza virus strains of the Florida-2 sublineage, which were circulating simultaneously in China, and a lesser amount of homology was found to the strain A/equine/Qinghai/1/1994 (European lineage), which was isolated during the last outbreak in China. These observations were confirmed by phylogenetic analysis. In addition, the deduced amino acid sequence of the neuraminidase of the A/equine/Xinjiang/4/2007 strain was identical to that of A/equine/California/8560/2002, an American isolate, and was found to be similar to those of Florida-2 strains found in other countries by comparing them with nine other field strains that were isolated in China from 2007 to 2008. It is suggested that the neuraminidase segment of A/equine/Xinjiang/4/2007 may have been obtained from equine influenza virus strains from other countries. We report for the first time an outbreak of equine influenza in the Asian wild horse population, and the complete genome of the virus is provided and analyzed.
Energy Technology Data Exchange (ETDEWEB)
NONE
1994-12-31
In 1991, a spatial forest database over large regions of Ontario was initiated as the basis for research into forest fragmentation and biodiversity using data generated from the digital analysis of LANDSAT thematic mapper satellite data integrated into a geographic information system (GIS). The project was later extended into the eastern segment of the Boreal forest system. This report describes preparation of the spatial forest data base over the eastern Boreal Forest Region that extends from the northern boundary of the Great Lakes-St. Lawrence Forest Region and the southern margin of the James Bay Lowland, between the Ontario-Quebec border and a point west of Michipicoten on Lake Superior. The report describes the methodology used to produce the data base and results, including mapping of water, dense and sparse conifer forest, mixed forest, dense and sparse deciduous forest, poorly vegetated areas, recent cutovers of less than 10 years, old cutovers and burns, recent burns of less than 10 years, wetlands, bedrock outcrops, agriculture, built-up areas, and mine tailings.
Equine-Assisted Experiential Learning in Occupational Therapy Education
Murphy, Lynne; Wilson, Jacqueline; Greenberg, Stacey
2017-01-01
Equine-assisted occupational therapy (EAOT) employs horse and human cooperation in activities that facilitate social, emotional, and cognitive development. The potential benefits of equine-assisted activities for students may influence the development of these types of skills in professional occupational therapy practice. This study explored the…
Knowledge, attitude and practice of equine vaccination among ...
African Journals Online (AJOL)
Equine infectious diseases continue to be one of the most important threats to the overall health of domesticated horses and proper vaccination is one the most important preventive measure against such infectious diseases. This study assessed the knowledge, attitude and practice of equine vaccination among horse ...
van Loon, Johannes P A M; Van Dierendonck, Machteld C
2015-01-01
Although recognition of equine pain has been studied extensively over the past decades there is still need for improvement in objective identification of pain in horses with acute colic. This study describes scale construction and clinical applicability of the Equine Utrecht University Scale for
Geospatial analysis based on GIS integrated with LADAR.
Fetterman, Matt R; Freking, Robert; Fernandez-Cull, Christy; Hinkle, Christopher W; Myne, Anu; Relyea, Steven; Winslow, Jim
2013-10-07
In this work, we describe multi-layered analyses of a high-resolution broad-area LADAR data set in support of expeditionary activities. High-level features are extracted from the LADAR data, such as the presence and location of buildings and cars, and then these features are used to populate a GIS (geographic information system) tool. We also apply line-of-sight (LOS) analysis to develop a path-planning module. Finally, visualization is addressed and enhanced with a gesture-based control system that allows the user to navigate through the enhanced data set in a virtual immersive experience. This work has operational applications including military, security, disaster relief, and task-based robotic path planning.
A positioning system for forest diseases and pests based on GIS and PTZ camera
International Nuclear Information System (INIS)
Wang, Z B; Zhao, F F; Wang, C B; Wang, L L
2014-01-01
Forest diseases and pests cause enormous economic losses and ecological damage every year in China. To prevent and control forest diseases and pests, the key is to get accurate information timely. In order to improve monitoring coverage rate and economize on manpower, a cooperative investigation model for forest diseases and pests is put forward. It is composed of video positioning system and manual labor reconnaissance with mobile GIS embedded in PDA. Video system is used to scan the disaster area, and is particularly effective on where trees are withered. Forest diseases prevention and control workers can check disaster area with PDA system. To support this investigation model, we developed a positioning algorithm and a positioning system. The positioning algorithm is based on DEM and PTZ camera. Moreover, the algorithm accuracy is validated. The software consists of 3D GIS subsystem, 2D GIS subsystem, video control subsystem and disaster positioning subsystem. 3D GIS subsystem makes positioning visual, and practically easy to operate. 2D GIS subsystem can output disaster thematic map. Video control subsystem can change Pan/Tilt/Zoom of a digital camera remotely, to focus on the suspected area. Disaster positioning subsystem implements the positioning algorithm. It is proved that the positioning system can observe forest diseases and pests in practical application for forest departments
Directory of Open Access Journals (Sweden)
M. Varga
2016-03-01
Full Text Available This paper introduces a GIS based methodology to generate dynamic process model for the simulation based analysis of a sensitive rural watershed. The Direct Computer Mapping (DCM based solution starts from GIS layers and, via the graph interpretation and graphical edition of the process network, the expert interface is able to integrate the field experts’ knowledge in the computer aided generation of the simulation model. The methodology was applied and tested for the Southern catchment basin of Lake Balaton, Hungary. In the simplified hydrological model the GIS description of nine watercourses, 121 water sections, 57 small lakes and 20 Lake Balaton compartments were mapped through the expert interface to the dynamic databases of the DCM model. The hydrological model involved precipitation, evaporation, transpiration, runoff, infiltration. The COoRdination of INformation on the Environment (CORINE land cover based simplified “land patch” model considered the effect of meteorological and hydrological scenarios on freshwater resources in the land patches, rivers and lakes. The first results show that the applied model generation methodology helps to build complex models, which, after validation can support the analysis of various land use, with the consideration of environmental aspects.
Dell, Colleen Anne; Chalmers, Darlene; Bresette, Nora; Swain, Sue; Rankin, Deb; Hopkins, Carol
2011-01-01
The Nimkee NupiGawagan Healing Centre (NNHC) in Muncey, ON provides residential treatment to First Nations and Inuit youth who abuse solvents. As a complement to its culture-based programming, in 2008 the centre began offering weekly equine-assisted learning (EAL) curriculum to its clients in partnership with the Keystone Equine Centre and the…
Characterization of the infection of equine fibroblasts by equine infectious anemia virus
International Nuclear Information System (INIS)
Klevjer-Anderson, P.; Cheevers, W.P.; Crawford, T.B.
1978-01-01
Equine dermal fibroblasts persistently infected with equine infectious anemia virus (EIAV) show no alterations in cell morphology or growth kinetics when compared to uninfected cells. The percentage of cells immunofluorescent positive for viral proteins fluctuated, depending upon the stage of the cell cycle, while production of extracellular virus was uniform throughout the cell cycle, increasing only as the cell number increased. This was shown in log versus stationary phase cultures as well as in cultures synchronized by serum starvation. The establishment of productive infection did not require host cell DNA synthesis. Normal levels of progeny virus were produced in cultures pretreated with mitomycin C and placed in serum-containing medium. Serum-starved cultures, however, did not support EIAV replication as well as other cultures, presumably because synthesis of provirus was inhibited. (author)
Multimodale trafiknet i GIS (Multimodal Traffic Network in GIS)
DEFF Research Database (Denmark)
Kronbak, Jacob; Brems, Camilla Riff
1996-01-01
The report introduces the use of multi-modal traffic networks within a geographical Information System (GIS). The necessary theory of modelling multi-modal traffic network is reviewed and applied to the ARC/INFO GIS by an explorative example.......The report introduces the use of multi-modal traffic networks within a geographical Information System (GIS). The necessary theory of modelling multi-modal traffic network is reviewed and applied to the ARC/INFO GIS by an explorative example....
Evaluation of treatment of colostrum-deprived kittens with equine IgG.
Crawford, P Cynda; Hanel, Rita M; Levy, Julie K
2003-08-01
To evaluate equine IgG as a treatment for kittens with failure of passive transfer of immunity (FPT). 13 specific pathogen-free queens and their 77 kittens. Kittens were randomized at birth into 9 treatment groups. One group contained colostrum-fed (nursing) kittens; the other groups contained colostrum-deprived kittens that were administered supplemental feline or equine IgG PO or SC during the first 12 hours after birth. Blood samples were collected at serial time points from birth to 56 days of age for determination of serum IgG concentrations. The capacity of equine IgG to opsonize bacteria for phagocytosis by feline neutrophils was determined via flow cytometry. Kittens that received feline or equine IgG SC had significantly higher serum IgG concentrations than those of kittens that received the supplements PO. In kittens that were administered supplemental IgG SC, serum IgG concentrations were considered adequate for protection against infection. The half-life of IgG in kittens treated with equine IgG was shorter than that in kittens treated with feline IgG. Feline IgG significantly enhanced the phagocytosis of bacteria by feline neutrophils, but equine IgG did not. Serum concentrations of equine IgG that are considered protective against infection are easily attained in kittens, but the failure of these antibodies to promote bacterial phagocytosis in vitro suggests that equine IgG may be an inappropriate treatment for FPT in kittens.
Hermans, H.; Spoormakers, T.J.P.; Ensink, J.M.; Boevé, M.H.
2017-01-01
EQUINE KERATOMYCOSIS IN THE NETHERLANDS FROM 2007 TO 2017 (28 CASES) Equine keratomycosis or fungal keratitis is a relatively common sight-threatening corneal disease in horses, particularly in warm, humid climates. Clinical manifestation includes corneal ulceration with or without corneal melting,
Energy Technology Data Exchange (ETDEWEB)
Wisianto, Arie; Sania, Hidayatus [PT PERTAMINA GAS, Bontang (Indonesia); Gumilar, Oki [PT PERTAMINA GAS, Jakarta (Indonesia)
2010-07-01
PT Pertamina Gas operates 3 pipe segments carrying natural gas from producers to PT Pupuk Kaltim in the Kalimantan area. The company wants to build a pipeline data management system consisting of pipeline facilities, inspections and risk assessments which would run on Geographic Information Systems (GIS) platforms. The aim of this paper is to present the integration of the pipeline data management system with GIS. A web based GIS application is developed using the combination of Google maps datasets with local spatial datasets. In addition, Open Layers is used to integrate pipeline data model and Google Map dataset into a single map display on Sharp Map. The GIS based pipeline data management system developed herein constitutes a low cost, powerful and efficient web based GIS solution.
Risk factors for equine fractures in Thoroughbred flat racing in North America
Georgopoulos, Stamatis Panagiotis; Parkin, Tim D.H.
2017-01-01
The aim of this paper is to identify risk factors associated with equine fractures in flat horse racing of Thoroughbreds in North America. Equine fractures were defined as any fracture sustained by a horse during a race. This was a cohort study that made use of all starts from the racecourses reporting injuries. The analysis was based on 2,201,152 racing starts that represent 91% of all official racing starts in the USA and Canada from 1 st January 2009–31 st December 2014. Approximately 3,99...
Adipose tissue as mesenchymal stem cells source in equine tendinitis treatment
Directory of Open Access Journals (Sweden)
Armando de Mattos Carvalho
2016-12-01
Full Text Available Tendinitis is an important high-relapse-rate disease, which compromises equine performance and may result in early athletic life end to affected animals. Many therapies have been set to treat equine tendinitis; however, just few result in improved relapse rates, quality of extracellular matrix (ECM and increased biomechanical resistance of the treated tissue. Due to advances in the regenerative medicine, promising results were initially obtained through the implantation of mesenchymal stem cells (MSC derived from the bone marrow in the equine tendon injury. Since then, many studies have been using MSCs from different sources for therapeutic means in equine. The adipose tissue has appeared as feasible MSC source. There are promising results involving equine tendinitis therapy using mesenchymal stem cells from adipose tissue (AdMSCs.
Technical Potential Assessment for the Renewable Energy Zone (REZ) Process: A GIS-Based Approach
Energy Technology Data Exchange (ETDEWEB)
Lee, Nathan [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Roberts, Billy J [National Renewable Energy Laboratory (NREL), Golden, CO (United States)
2018-04-05
Geographic Information Systems (GIS)-based energy resource and technical potential assessments identify areas capable of supporting high levels of renewable energy (RE) development as part of a Renewable Energy Zone (REZ) Transmission Planning process. This document expands on the REZ Process to aid practitioners in conducting GIS-based RE resource and technical potential assessments. The REZ process is an approach to plan, approve, and build transmission infrastructure that connects REZs - geographic areas that have high-quality RE resources, suitable topography and land-use designations, and demonstrated developer interest - to the power system. The REZ process helps to increase the share of solar photovoltaic (PV), wind, and other resources while also maintaining reliability and economics.
76 FR 16683 - Importation of Horses From Contagious Equine Metritis-Affected Countries
2011-03-25
...-0112] RIN 0579-AD31 Importation of Horses From Contagious Equine Metritis-Affected Countries AGENCY... contagious equine metritis (CEM) by incorporating an additional certification requirement for imported horses... . FOR FURTHER INFORMATION CONTACT: Dr. Ellen Buck, Senior Staff Veterinarian, Equine Imports, National...
Russell, K A; Koch, T G
2016-03-01
Multipotent mesenchymal stromal cells (MSC) are often culture-expanded in vitro. Presently, expansion medium (EM) for MSC is supplemented with fetal bovine serum (FBS). However, increasing cost, variable composition and potential risks associated with bovine antigens call for alternatives. Platelet lysate (PL) has shown promise as an alternative supplement. To determine how equine umbilical cord blood (CB) MSC proliferate in EM enriched with PL or FBS at various concentrations. Randomised dose escalation study. Platelet concentrate was generated from 5 equine whole blood samples through a double centrifugation method and standardised to 1 × 10(12) platelets/l prior to a freeze/thaw cycle to produce PL. Pooled PL or pooled FBS was added to EM at concentrations of 5% to 60%. Proliferation of 4 equine CB-MSC cultures was determined after 4 days using a resazurin semiquantitative assay. Cord blood-MSC proliferated with a dose-dependent response with no significant difference found between PL and FBS up to a 30% concentration. Beyond 30%, proliferation fell in the PL-cultured cells, while continued dose-dependent proliferation was noted in the FBS-cultured cells. Despite reduced cell numbers in high PL concentrations, live/dead staining revealed that adherent cells remained viable. Expansion medium enriched with PL can support short-term equine CB-MSC proliferation at conventional culture concentrations. Based on the unexpected suppression of CB-MSC at higher PL concentrations, an in vivo dose study is indicated to investigate if combinational therapies of CB-MSC and platelet-rich plasma are associated with synergistic or antagonistic effect on CB-MSC function. © 2015 EVJ Ltd.
Design of Mobile Operation and Maintenance System Based on Power GIS and GPS
Directory of Open Access Journals (Sweden)
Jing TAO
2017-01-01
Full Text Available In order to solve the low efficiency of operation and maintenance and the problems of management coordination caused by the coexistence of off-line operation and maintenance and multi system coexistence in current power telecommunication operation and maintenance, this paper proposes a mobile operation and maintenance system based on power GIS and GPS location technology. The system is based on the C/S architecture, and the mobile operation and maintenance terminal is connected with the operation and maintenance management terminal through wireless and wired network. In addition to meeting basic business requirements, the system integrates power GIS functions to visually demonstrate communication resources, personnel, and failures. The staff can use the wireless mobile terminal which integrated GPS module for to operate and maintain, and can locate accurately in real time.
Directory of Open Access Journals (Sweden)
A. Albertella
2017-07-01
Full Text Available The UN Open GIS Initiative is to identify and develop, under UN guidance, an Open Source GIS bundle that meets the requirements of UN operations, taking full advantage of the expertise of mission partners (partner nations, technology contributing countries, international organizations, academia, NGO’s, private sector. The project, started in 2016, is composed by 4 working groups. One of the working group is specifically related to Capacity Building, given its importance for the success of the project. UN Open GIS will be based on some existing open source geospatial software (packages and libraries with many extensions specifically developed. The users of the platform will be the UN staff supporting with mapping and GIS the peacekeeping missions. Therefore, they are generally expert of this specific domain, even if they are currently using proprietary software. UN Open GIS Capacity Building is specifically thought for covering this gap, providing them the suitable background about open source geospatial software in general and the education tailored to the solution that has been being developed within the project itself.
de Rezende, Marcos Paulo Gonçalves; de Souza, Julio Cesar; Carneiro, Paulo Luiz Souza; Bozzi, Riccardo; Jardim, Rodrigo Jose Delgado; Malhado, Carlos Henrique Mendes
2018-06-01
Evaluating phenotypic diversity makes it possible to identify discrepancies in aptitudes among animals of different genetic bases, which is an indicator of adaptive or selective differences between populations. The objective of this work was to evaluate the morphofunctional diversity of 452 male and female adult equines (Arabian, Quarter Mile, Pantaneiro, and Criollo breeds, and undefined crossbreeds of horses and mules) raised in the Pantanal biome (Brazil). Linear measurements were performed to estimate conformation indexes. Initially, a discriminant analysis was performed, regardless of the animal's size, followed by factor analysis. The factors were characterized and used as new variables. The diversity among equines and their relationship with the factors were evaluated using multivariate analysis. The factors were classified according to their decreasing importance: balance, rusticity, and robustness for the measurement factors; and load, ability, conformation, and equilibrium for the index factors. The genetic groups of equines have well-defined morphofunctional characteristics. The main differences are based on the rusticity and ability typologies in relation to those based on performance. Equines introduced to the Pantanal biome presented a more robust and compact body with good conformation. As a result, these horses may have superior athletic performance during equestrian activities when compared to the Pantaneiro local breed. However, this biotype may represent less rusticity (less adaptive capacity). Therefore, the regional breed can be equal or better in equestrian activities than breeds introduced to the Pantanal biome. Thus, breeders may cross horses from local breeds as an alternative to those introduced. Undefined crossbred male equines presented a different profile from the Pantaneiro breed, which may indicate little use of crossbreeds in breeding.
78 FR 9577 - Importation of Horses From Contagious Equine Metritis-Affected Countries
2013-02-11
.... APHIS-2008-0112] RIN 0579-AD31 Importation of Horses From Contagious Equine Metritis-Affected Countries... of horses from countries affected with contagious equine metritis (CEM) by incorporating an... FURTHER INFORMATION CONTACT: Dr. Ellen Buck, Senior Staff Veterinarian, Equine Imports, National Center...
CyberGIS software: a synthetic review and integration roadmap
Energy Technology Data Exchange (ETDEWEB)
Wang, Shaowen [University of Illinois, Urbana-Champaign; Anselin, Luc [Arizona State University; Bhaduri, Budhendra L [ORNL; Cosby, Christopher [University Navstar Consortium, Boulder, CO; Goodchild, Michael [University of California, Santa Barbara; Liu, Yan [University of Illinois, Urbana-Champaign; Nygers, Timothy L. [University of Washington, Seattle
2013-01-01
CyberGIS defined as cyberinfrastructure-based geographic information systems (GIS) has emerged as a new generation of GIS representing an important research direction for both cyberinfrastructure and geographic information science. This study introduces a 5-year effort funded by the US National Science Foundation to advance the science and applications of CyberGIS, particularly for enabling the analysis of big spatial data, computationally intensive spatial analysis and modeling (SAM), and collaborative geospatial problem-solving and decision-making, simultaneously conducted by a large number of users. Several fundamental research questions are raised and addressed while a set of CyberGIS challenges and opportunities are identified from scientific perspectives. The study reviews several key CyberGIS software tools that are used to elucidate a vision and roadmap for CyberGIS software research. The roadmap focuses on software integration and synthesis of cyberinfrastructure, GIS, and SAM by defining several key integration dimensions and strategies. CyberGIS, based on this holistic integration roadmap, exhibits the following key characteristics: high-performance and scalable, open and distributed, collaborative, service-oriented, user-centric, and community-driven. As a major result of the roadmap, two key CyberGIS modalities gateway and toolkit combined with a community-driven and participatory approach have laid a solid foundation to achieve scientific breakthroughs across many geospatial communities that would be otherwise impossible.
Breetzke, Gregory; Eksteen, Sanet; Pretorius, Erika
2011-01-01
Geographical information systems (GIS) were phased into the geography curriculum of South African schools from 2006-2008 as part of the National Curriculum Statement (NCS) for grades 10-12. Since its introduction, GIS education in schools across the country has been met with a number of challenges including the cost of purchasing the hardware and…
76 FR 52547 - Importation of Horses From Contagious Equine Metritis-Affected Countries
2011-08-23
.... APHIS-2008-0112] RIN 0579-AD31 Importation of Horses From Contagious Equine Metritis-Affected Countries... with contagious equine metritis. We are also delaying the enforcement of all provisions of the interim... coming. FOR FURTHER INFORMATION CONTACT: Dr. Ellen Buck, Senior Staff Veterinarian, Equine Imports...
Characterization of Genetic Variability of Venezuelan Equine Encephalitis Viruses.
Directory of Open Access Journals (Sweden)
Shea N Gardner
Full Text Available Venezuelan equine encephalitis virus (VEEV is a mosquito-borne alphavirus that has caused large outbreaks of severe illness in both horses and humans. New approaches are needed to rapidly infer the origin of a newly discovered VEEV strain, estimate its equine amplification and resultant epidemic potential, and predict human virulence phenotype. We performed whole genome single nucleotide polymorphism (SNP analysis of all available VEE antigenic complex genomes, verified that a SNP-based phylogeny accurately captured the features of a phylogenetic tree based on multiple sequence alignment, and developed a high resolution genome-wide SNP microarray. We used the microarray to analyze a broad panel of VEEV isolates, found excellent concordance between array- and sequence-based SNP calls, genotyped unsequenced isolates, and placed them on a phylogeny with sequenced genomes. The microarray successfully genotyped VEEV directly from tissue samples of an infected mouse, bypassing the need for viral isolation, culture and genomic sequencing. Finally, we identified genomic variants associated with serotypes and host species, revealing a complex relationship between genotype and phenotype.
Map-IT! A Web-Based GIS Tool for Watershed Science Education.
Curtis, David H.; Hewes, Christopher M.; Lossau, Matthew J.
This paper describes the development of a prototypic, Web-accessible GIS solution for K-12 science education and citizen-based watershed monitoring. The server side consists of ArcView IMS running on an NT workstation. The client is built around MapCafe. The client interface, which runs through a standard Web browser, supports standard MapCafe…
The Design and Implement of Tourism Information System Based on GIS
Chunchang, Fu; Nan, Zhang
From the geographical information system concept, discusses the main contents of the geographic information system, and the current of the geographic information system key technological measures of tourism information system, the application of tourism information system for specific requirements and goals, and analyzes a relational database model based on the tourist information system in GIS application methods of realization.
The Efficacy of Equine-Assisted Activities and Therapies on Improving Physical Function.
Rigby, B Rhett; Grandjean, Peter W
2016-01-01
To summarize the physical benefits of therapeutic horseback riding and hippotherapy and suggest directions for future research. Review of databases for peer-reviewed articles related to equine-assisted activities and therapies. Databases included MEDLINE via EBSCO, Web of Science, PubMed, Google Scholar, and Academic Search Complete. Articles were limited to those with full-text access published in English since 1987. Acute and residual improvements in physical benefits, such as gross motor function (e.g., walking, running, jumping), spasticity, muscle symmetry, posture, balance, and gait occur in adults and children with varying disabilities. The benefits appear to be greatest following multiweek interventions with one or more sessions per week. Modest acute cardiovascular responses are observed during equine-assisted activities and therapies with little or no evidence for training improvements in heart rate or blood pressure at rest or during riding. The present body of literature provides evidence that equine-assisted activities and therapies are an effective means of improving many measures of physical health. However, more controlled trials are urgently needed to strengthen the current knowledge base, establish dose-response characteristics of equine-assisted activities and therapies, and explore the physiologic basis for the promising results suggested from the literature.
GIS-Based KW-GIUH hydrological model of semiarid catchments: The case of Faria Catchment, Palestine
International Nuclear Information System (INIS)
Shadeed, S.; Shaheen, H.; Jayyousi, A.
2007-01-01
Among the most basic challenges of hydrology are the quantitative understanding of the processes of runoff generation and prediction of flow hydrographs. Traditional techniques have been widely applied for the estimation of runoff hydrographs of gauged catchments using historical rainfall-runoff data and unit hydrographs. Such procedures are questioned as to their reliability and their application to ungauged, arid and semiarid catchments. To overcome such difficulties, the use of physically based rainfall-runoff process of Faria Catchment using the lately developed KW-GIUH. Faria catchment, located in the northeastern part of the West Bank, Palestine, is characterized as a semiarid region with annual rainfall depths ranging on average from 150 to 640 mm at both ends of the catchment. The Geographical Information System (GIS) techniques were used to shape the geomorphological features of the catchment. A GIS based KW-GIUH hydrological model was used to stimulate the rainfall-runoff process in the three sub-catchments of Faria, namely: Al-Badan, Al-Faria and Al-Malaqi. The simulated runoff hydrographs proved that the GIS-based KW-GIUH model is applicable to semiarid regions and can be used to estimate the unit hydrographs in the West Bank catchments. (author)
Paper2GIS: A self-digitising, paper-based PPGIS
Huck, Jonathan; Dunning, Isobel; Lee, Pierre; Lowe, Thomas; Quek, Ervine; Weerasinghe, Sandarau; Wintie, Dominic
2017-01-01
This paper examines two established problems in public participatory GIS: affording participants the flexibility to represent geographical entities in a way that reflects how they think about the world; and the ‘digital divide’ in order to promote representative participation in locations that do not have good access to computing or the Internet. These two issues will be explored through the presentation of a novel prototype public participatory GIS software package, which allows the rapid au...
GIS-based hydrogeological databases and groundwater modelling
Gogu, Radu Constantin; Carabin, Guy; Hallet, Vincent; Peters, Valerie; Dassargues, Alain
2001-12-01
Reliability and validity of groundwater analysis strongly depend on the availability of large volumes of high-quality data. Putting all data into a coherent and logical structure supported by a computing environment helps ensure validity and availability and provides a powerful tool for hydrogeological studies. A hydrogeological geographic information system (GIS) database that offers facilities for groundwater-vulnerability analysis and hydrogeological modelling has been designed in Belgium for the Walloon region. Data from five river basins, chosen for their contrasting hydrogeological characteristics, have been included in the database, and a set of applications that have been developed now allow further advances. Interest is growing in the potential for integrating GIS technology and groundwater simulation models. A "loose-coupling" tool was created between the spatial-database scheme and the groundwater numerical model interface GMS (Groundwater Modelling System). Following time and spatial queries, the hydrogeological data stored in the database can be easily used within different groundwater numerical models. Résumé. La validité et la reproductibilité de l'analyse d'un aquifère dépend étroitement de la disponibilité de grandes quantités de données de très bonne qualité. Le fait de mettre toutes les données dans une structure cohérente et logique soutenue par les logiciels nécessaires aide à assurer la validité et la disponibilité et fournit un outil puissant pour les études hydrogéologiques. Une base de données pour un système d'information géographique (SIG) hydrogéologique qui offre toutes les facilités pour l'analyse de la vulnérabilité des eaux souterraines et la modélisation hydrogéologique a été établi en Belgique pour la région Wallonne. Les données de cinq bassins de rivières, choisis pour leurs caractéristiques hydrogéologiques différentes, ont été introduites dans la base de données, et un ensemble d
76 FR 31220 - Importation of Horses From Contagious Equine Metritis-Affected Countries
2011-05-31
.... APHIS-2008-0112] RIN 0579-AD31 Importation of Horses From Contagious Equine Metritis-Affected Countries... regarding the importation of horses from countries affected with contagious equine metritis (CEM) by..., Equine Imports, National Center for Import and Export, VS, APHIS, 4700 River Road Unit 36, Riverdale, MD...
Towards a Conceptual Framework for WikiGIS
Directory of Open Access Journals (Sweden)
Wided Batita
2014-10-01
Full Text Available As an emerging complex concept, GeoDesign requires an innovative theoretical basis, tools, supports and practices. For this reason, we propose a new concept, “WikiGIS”, designed to answer some dimensions of the GeoDesign process. WikiGIS focuses on the needs of GeoDesign, but we leave the door open for future improvement when tested in other areas that may have additional needs. WikiGIS is built on Web 2.0 technologies—and primarily on wiki—to manage the tracking of participants’ editing (i.e., managing the contributions history. It also offers GIS functions for geoprocessing and a design-based approach for sketching proposals. One of the main strengths of WikiGIS is its ability to manage the traceability of contributions with an easy and dynamical access, data quality and deltification. The core of this paper consists of presenting a conceptual framework for WikiGIS using UML diagrams. A user interface is presented later to show how our WikiGIS proposal works. This interface is simply a means to illustrate the concepts underlying WikiGIS.
An Ontology-Based GIS for Genomic Data Management of Rumen Microbes.
Jelokhani-Niaraki, Saber; Tahmoorespur, Mojtaba; Minuchehr, Zarrin; Nassiri, Mohammad Reza
2015-03-01
During recent years, there has been exponential growth in biological information. With the emergence of large datasets in biology, life scientists are encountering bottlenecks in handling the biological data. This study presents an integrated geographic information system (GIS)-ontology application for handling microbial genome data. The application uses a linear referencing technique as one of the GIS functionalities to represent genes as linear events on the genome layer, where users can define/change the attributes of genes in an event table and interactively see the gene events on a genome layer. Our application adopted ontology to portray and store genomic data in a semantic framework, which facilitates data-sharing among biology domains, applications, and experts. The application was developed in two steps. In the first step, the genome annotated data were prepared and stored in a MySQL database. The second step involved the connection of the database to both ArcGIS and Protégé as the GIS engine and ontology platform, respectively. We have designed this application specifically to manage the genome-annotated data of rumen microbial populations. Such a GIS-ontology application offers powerful capabilities for visualizing, managing, reusing, sharing, and querying genome-related data.
Rossano, M G; Mansfield, L S; Kaneene, J B; Murphy, A J; Brown, C M; Schott, H C; Fox, J C
2000-01-01
Equine protozoal myeloencephalitis (EPM) is a neurological disease of horses and ponies caused by the apicomplexan protozoan parasite Sarcocystis neurona. The purposes of this study were to develop the most stringent criteria possible for a positive test result, to estimate the sensitivity and specificity of the EPM Western blot antibody test, and to assess the ability of bovine antibodies to Sarcocystis cruzi to act as a blocking agent to minimize false-positive results in the western blot test for S. neurona. Sarcocystis neurona merozoites harvested from equine dermal cell culture were heat denatured, and the proteins were separated by sodium dodecyl sulfate-polyacrylamide gel electrophoresis in a 12-20% linear gradient gel. Separated proteins were electrophoretically transferred to polyvinylidene fluoride membranes and blocked in 1% bovine serum albumin and 0.5% Tween-Tris-buffered saline. Serum samples from 6 horses with S. neurona infections (confirmed by culture from neural tissue) and 57 horses without infections (horses from the Eastern Hemisphere, where S. neurona does not exist) were tested by Western blot. Horses from both groups had reactivity to the 62-, 30-, 16-, 13-, 11-, 10.5-, and 10-kD bands. Testing was repeated with another step. Blots were treated with bovine S. cruzi antibodies prior to loading the equine samples. After this modification of the Western blot test, positive infection status was significantly associated with reactivity to the 30- and 16-kD bands (Pblot had a sample sensitivity of 100% and sample specificity of 98%. It is concluded that the specificity of the Western blot test is improved by blocking proteins not specific to S. neurona and using reactivity to the 30- and 16-kD bands as the criterion for a positive test.
Directory of Open Access Journals (Sweden)
Boulos Maged
2004-01-01
Full Text Available Abstract The term "Geographic Information Systems" (GIS has been added to MeSH in 2003, a step reflecting the importance and growing use of GIS in health and healthcare research and practices. GIS have much more to offer than the obvious digital cartography (map functions. From a community health perspective, GIS could potentially act as powerful evidence-based practice tools for early problem detection and solving. When properly used, GIS can: inform and educate (professionals and the public; empower decision-making at all levels; help in planning and tweaking clinically and cost-effective actions, in predicting outcomes before making any financial commitments and ascribing priorities in a climate of finite resources; change practices; and continually monitor and analyse changes, as well as sentinel events. Yet despite all these potentials for GIS, they remain under-utilised in the UK National Health Service (NHS. This paper has the following objectives: (1 to illustrate with practical, real-world scenarios and examples from the literature the different GIS methods and uses to improve community health and healthcare practices, e.g., for improving hospital bed availability, in community health and bioterrorism surveillance services, and in the latest SARS outbreak; (2 to discuss challenges and problems currently hindering the wide-scale adoption of GIS across the NHS; and (3 to identify the most important requirements and ingredients for addressing these challenges, and realising GIS potential within the NHS, guided by related initiatives worldwide. The ultimate goal is to illuminate the road towards implementing a comprehensive national, multi-agency spatio-temporal health information infrastructure functioning proactively in real time. The concepts and principles presented in this paper can be also applied in other countries, and on regional (e.g., European Union and global levels.
A Javascript GIS Platform Based on Invocable Geospatial Web Services
Directory of Open Access Journals (Sweden)
Konstantinos Evangelidis
2018-04-01
Full Text Available Semantic Web technologies are being increasingly adopted by the geospatial community during last decade through the utilization of open standards for expressing and serving geospatial data. This was also dramatically assisted by the ever-increasing access and usage of geographic mapping and location-based services via smart devices in people’s daily activities. In this paper, we explore the developmental framework of a pure JavaScript client-side GIS platform exclusively based on invocable geospatial Web services. We also extend JavaScript utilization on the server side by deploying a node server acting as a bridge between open source WPS libraries and popular geoprocessing engines. The vehicle for such an exploration is a cross platform Web browser capable of interpreting JavaScript commands to achieve interaction with geospatial providers. The tool is a generic Web interface providing capabilities of acquiring spatial datasets, composing layouts and applying geospatial processes. In an ideal form the end-user will have to identify those services, which satisfy a geo-related need and put them in the appropriate row. The final output may act as a potential collector of freely available geospatial web services. Its server-side components may exploit geospatial processing suppliers composing that way a light-weight fully transparent open Web GIS platform.
3D GIS spatial operation based on extended Euler operators
Xu, Hongbo; Lu, Guonian; Sheng, Yehua; Zhou, Liangchen; Guo, Fei; Shang, Zuoyan; Wang, Jing
2008-10-01
The implementation of 3 dimensions spatial operations, based on certain data structure, has a lack of universality and is not able to treat with non-manifold cases, at present. ISO/DIS 19107 standard just presents the definition of Boolean operators and set operators for topological relationship query, and OGC GeoXACML gives formal definitions for several set functions without implementation detail. Aiming at these problems, based mathematical foundation on cell complex theory, supported by non-manifold data structure and using relevant research in the field of non-manifold geometry modeling for reference, firstly, this paper according to non-manifold Euler-Poincaré formula constructs 6 extended Euler operators and inverse operators to carry out creating, updating and deleting 3D spatial elements, as well as several pairs of supplementary Euler operators to convenient for implementing advanced functions. Secondly, we change topological element operation sequence of Boolean operation and set operation as well as set functions defined in GeoXACML into combination of extended Euler operators, which separates the upper functions and lower data structure. Lastly, we develop underground 3D GIS prototype system, in which practicability and credibility of extended Euler operators faced to 3D GIS presented by this paper are validated.
Directory of Open Access Journals (Sweden)
Milevski Ivica
2013-01-01
Full Text Available In this paper, one approach of Geographic Information System (GIS and Remote Sensing (RS assessment of potential natural hazard areas (excess erosion, landslides, flash floods and fires is presented. For that purpose Pehchevo Municipality in the easternmost part of the Republic of Macedonia is selected as a case study area because of high local impact of natural hazards on the environment, social-demographic situation and local economy. First of all, most relevant static factors for each type of natural hazard are selected (topography, land cover, anthropogenic objects and infrastructure. With GIS and satellite imagery, multi-layer calculation is performed based on available traditional equations, clustering or discreditation procedures. In such way suitable relatively “static” natural hazard maps (models are produced. Then, dynamic (mostly climate related factors are included in previous models resulting in appropriate scenarios correlated with different amounts of precipitation, temperature, wind direction etc. Finally, GIS based scenarios are evaluated and tested with field check or very fine resolution Google Earth imagery showing good accuracy. Further development of such GIS models in connection with automatic remote meteorological stations and dynamic satellite imagery (like MODIS will provide on-time warning for coming natural hazard avoiding potential damages or even causalities.
The study of metal contamination in urban soils of Hong Kong using a GIS-based approach
International Nuclear Information System (INIS)
Li Xiangdong; Lee Siulan; Wong Szechung; Shi Wenzhong; Thornton, Iain
2004-01-01
The study of regional variations and the anthropogenic contamination by metals of soils is very important for environmental planning and monitoring in urban areas. An extensive survey was conducted in the highly urbanized Kowloon area (46.9 km 2 ) of Hong Kong, using a systematic sampling strategy with a sampling density of 3-5 composite soil samples (0-15 cm) per km 2 . Geochemical maps of 'total' metals (Cd, Cr, Cu, Ni, Pb and Zn) from strong acid extraction in the surface soils were produced based on geographical information system (GIS) technology. A significant spatial relationship was found for Ni, Cu, Pb and Zn in the soils using a GIS-based analysis, suggesting that these metal contaminants in the soils of the Kowloon area had common sources. Several hot-spot areas of metal contamination were identified from the composite metal geochemical map, mainly in the old industrial and residential areas. A further GIS analysis revealed that road junctions, major roads and industrial buildings were possible sources of heavy metals in the urban soils. The Pb isotope composition of the contaminated soils showed clear anthropogenic origins. - GIS can be used to identify soil contamination hot-spot areas and to assess potential pollutant sources in an urban community
Assessment of Wave Energy in the South China Sea Based on GIS Technology
Directory of Open Access Journals (Sweden)
Gang Lin
2017-01-01
Full Text Available China is now the world’s largest user of coal and also has the highest greenhouse gas emissions associated with the mining and use of coal. Under today’s enormous pressures of the growing shortage of conventional energy sources and the need for emission reductions, the search for clean energy is the most effective strategy to address the energy crisis and global warming. This study utilized satellite remote sensing technology, geographic information system (GIS technology, and simulated wave data for the South China Sea. The characteristic features of the wave energy were obtained by analysis through the wave resource assessment formula and the results were stored in a GIS database. Software for the evaluation of wave energy in the South China Sea was written. The results should provide accurate, efficient references for wave energy researchers and decision-makers. Based on a 24-year WW3 model simulation wave data and GIS technology, this study presented the characteristic of the wave energy in the SCS; results demonstrated that the SCS has the feasibility and viability for wave energy farming.
International Nuclear Information System (INIS)
Moore, Brian D.; Balasuriya, Udeni B.R.; Watson, Johanna L.; Bosio, Catharine M.; MacKay, Robert J.; MacLachlan, N. James
2003-01-01
Equine arteritis virus (EAV) infects endothelial cells (ECs) and macrophages in horses, and many of the clinical manifestations of equine viral arteritis (EVA) reflect vascular injury. To further evaluate the potential role of EAV-induced, macrophage-derived cytokines in the pathogenesis of EVA, we infected cultured equine alveolar macrophages (AMphi), blood monocyte-derived macrophages (BMphi), and pulmonary artery ECs with either a virulent (KY84) or an avirulent (CA95) strain of EAV. EAV infection of equine AMphi, BMphi, and ECs resulted in their activation with increased transcription of genes encoding proinflammatory mediators, including interleukin (IL)-1β, IL-6, IL-8, and tumor necrosis factor (TNF)-α. Furthermore, the virulent KY84 strain of EAV induced significantly higher levels of mRNA encoding proinflammatory cytokines in infected AMphi and BMphi than did the avirulent CA95 strain. Treatment of equine ECs with the culture supernatants of EAV-infected AMphi and BMphi also resulted in EC activation with cell surface expression of E-selectin, whereas infection of ECs with purified EAV alone caused only minimal expression of E-selectin. The presence of TNF-α in the culture supernatants of EAV-infected equine AMphi, BMphi, and ECs was confirmed by bioassay, and the virulent KY84 strain of EAV induced significantly more TNF-α in all cell types than did the avirulent CA95 strain. Thus, the data indicate that EAV-induced, macrophage-derived cytokines may contribute to the pathogenesis of EVA in horses, and that the magnitude of the cytokine response of equine AMphi, BMphi, and ECs to EAV infection reflects the virulence of the infecting virus strain
Nagel, Christina; Ille, Natascha; Aurich, Jörg; Aurich, Christine
2015-10-15
Transrectal palpation and ultrasonography of the genital tract in mares are first-day skills for equine veterinarians. In this study, the learning outcome in equine gynecology after four times training on horses (group H4, n = 8), training on horses once (group H1, n = 9), and four times simulator-based training (group Sim, n = 8) was assessed in third-year veterinary students with two tests in live mares 14 days apart. The students of group H4 always scored better for transrectal palpation than students of group Sim and H1 (P < 0.05). Overall, the students reached better results for palpating the left versus the right ovary (P < 0.001), but group H1 students were least successful in obtaining correct ovarian findings (P < 0.05 vs. both other groups). Students' self-assessment reflected test results with palpation of the right ovary experienced as most difficult for group H1 students (P < 0.01 vs. both other groups). Groups did not score differentially for ultrasound examinations. Sim students were nearly as successful in transrectal palpation of the genital tract in mares as H4 students, and for most parameters assessed, they performed better than H1 students. After training four times on horses, students scored best but nevertheless the overall effect of intensive training was limited. Repeated simulator-based training is a useful tool to prepare veterinary students for transrectal palpation of the genital tract in mares and is more effective than one training session on horses. Copyright © 2015 Elsevier Inc. All rights reserved.
Lifescience Database Archive (English)
Full Text Available hit_id Q306W7 Definition sp|Q306W7|POLS_EEEV8 Structural polyprotein OS=Eastern equine encephalitis virus (s...E Sequences producing significant alignments: (bits) Value sp|Q306W7|POLS_EEEV8 Structural polyprotein OS=Eastern equine...domain-conta... 29 6.3 >sp|Q306W7|POLS_EEEV8 Structural polyprotein OS=Eastern equine encephalitis virus (st
[Ecological environmental quality assessment of Hangzhou urban area based on RS and GIS].
Xu, Pengwei; Zhao, Duo
2006-06-01
In allusion to the shortage of traditional ecological environmental quality assessment, this paper studied the spatial distribution of assessing factors at a mid-small scale, and the conversion of integer character to girding assessing cells. The main assessing factors including natural environmental condition, environmental quality, natural landscape and urbanization pressure, which were classified into four types with about eleven assessing factors, were selected from RS images and GIS-spatial analyzing environmental quality vector graph. Based on GIS, a comprehensive assessment model for the ecological environmental quality in Hangzhou urban area was established. In comparison with observed urban heat island effects, the assessment results were in good agreement with the ecological environmental quality in the urban area of Hangzhou.
GIS-based modelling of odour emitted from the waste processing plant: case study
Directory of Open Access Journals (Sweden)
Sόwka Izabela
2017-01-01
Full Text Available The emission of odours into the atmospheric air from the municipal economy and industrial plants, especially in urbanized areas, causes a serious problem, which the mankind has been struggling with for years. The excessive exposure of people to odours may result in many negative health effects, including, for example, headaches and vomiting. There are many different methods that are used in order to evaluate the odour nuisance. The results obtained through those methods can then be used to carry out a visualization and an analysis of a distribution of the odour concentrations in a given area by using the GIS (Geographic Information System. By their application to the spatial analysis of the impact of odours, we can enable the assessment of the magnitude and likelihood of the occurrence of odour nuisance. Modelling using GIS tools and spatial interpolation like IDW method and kriging can provide an alternative to the standard modelling tools, which generally use the emission values from sources that are identified as major emitters of odours. The work presents the result, based on the odour measurements data from waste processing plant, of the attempt to connect two different tools – the reference model OPERAT FB and GIS-based dispersion modelling performed using IDW method and ordinary kriging to analyse their behaviour in terms of limited observation values.
An Ontology-Based GIS for Genomic Data Management of Rumen Microbes
Directory of Open Access Journals (Sweden)
Saber Jelokhani-Niaraki
2015-03-01
Full Text Available During recent years, there has been exponential growth in biological information. With the emergence of large datasets in biology, life scientists are encountering bottlenecks in handling the biological data. This study presents an integrated geographic information system (GIS-ontology application for handling microbial genome data. The application uses a linear referencing technique as one of the GIS functionalities to represent genes as linear events on the genome layer, where users can define/change the attributes of genes in an event table and interactively see the gene events on a genome layer. Our application adopted ontology to portray and store genomic data in a semantic framework, which facilitates data-sharing among biology domains, applications, and experts. The application was developed in two steps. In the first step, the genome annotated data were prepared and stored in a MySQL database. The second step involved the connection of the database to both ArcGIS and Protégé as the GIS engine and ontology platform, respectively. We have designed this application specifically to manage the genome-annotated data of rumen microbial populations. Such a GIS-ontology application offers powerful capabilities for visualizing, managing, reusing, sharing, and querying genome-related data.
An Ontology-Based GIS for Genomic Data Management of Rumen Microbes
Jelokhani-Niaraki, Saber; Minuchehr, Zarrin; Nassiri, Mohammad Reza
2015-01-01
During recent years, there has been exponential growth in biological information. With the emergence of large datasets in biology, life scientists are encountering bottlenecks in handling the biological data. This study presents an integrated geographic information system (GIS)-ontology application for handling microbial genome data. The application uses a linear referencing technique as one of the GIS functionalities to represent genes as linear events on the genome layer, where users can define/change the attributes of genes in an event table and interactively see the gene events on a genome layer. Our application adopted ontology to portray and store genomic data in a semantic framework, which facilitates data-sharing among biology domains, applications, and experts. The application was developed in two steps. In the first step, the genome annotated data were prepared and stored in a MySQL database. The second step involved the connection of the database to both ArcGIS and Protégé as the GIS engine and ontology platform, respectively. We have designed this application specifically to manage the genome-annotated data of rumen microbial populations. Such a GIS-ontology application offers powerful capabilities for visualizing, managing, reusing, sharing, and querying genome-related data. PMID:25873847
Humblet, M.; Vandeputte, S.; Fecher-Bourgeois, F.; Leonard, P.; Gosset, C.; Balenghien, Thomas; Durand, B.; Saegerman, C.
2016-01-01
This study aimed at estimating, in a prospective scenario, the potential economic impact of a possible epidemic of WNV infection in Belgium, based on 2012 values for the equine and human health sectors, in order to increase preparedness and help decision-makers. Modelling of risk areas, based on the habitat suitable for Culex pipiens, the main vector of the virus, allowed us to determine equine and human populations at risk. Characteristics of the different clinical forms of the disease based...
INTEGRATION OF GIS AND BIM FOR INDOOR GEOVISUAL ANALYTICS
Directory of Open Access Journals (Sweden)
B. Wu
2016-06-01
Full Text Available This paper presents an endeavour of integration of GIS (Geographical Information System and BIM (Building Information Modelling for indoor geovisual analytics. The merits of two types of technologies, GIS and BIM are firstly analysed in the context of indoor environment. GIS has well-developed capabilities of spatial analysis such as network analysis, while BIM has the advantages for indoor 3D modelling and dynamic simulation. This paper firstly investigates the important aspects for integrating GIS and BIM. Different data standards and formats such as the IFC (Industry Foundation Classes and GML (Geography Markup Language are discussed. Their merits and limitations in data transformation between GIS and BIM are analysed in terms of semantic and geometric information. An optimized approach for data exchange between GIS and BIM datasets is then proposed. After that, a strategy of using BIM for 3D indoor modelling, GIS for spatial analysis, and BIM again for visualization and dynamic simulation of the analysis results is presented. Based on the developments, this paper selects a typical problem, optimized indoor emergency evacuation, to demonstrate the integration of GIS and BIM for indoor geovisual analytics. The block Z of the Hong Kong Polytechnic University is selected as a test site. Detailed indoor and outdoor 3D models of the block Z are created using a BIM software Revit. The 3D models are transferred to a GIS software ArcGIS to carry out spatial analysis. Optimized evacuation plans considering dynamic constraints are generated based on network analysis in ArcGIS assuming there is a fire accident inside the building. The analysis results are then transferred back to BIM software for visualization and dynamic simulation. The developed methods and results are of significance to facilitate future development of GIS and BIM integrated solutions in various applications.
Tachykinin receptors in the equine pelvic flexure
International Nuclear Information System (INIS)
Sonea, I.M.; Wilson, D.V.; Bowker, R.M.; Robinson, N.E.
1997-01-01
Tachykinins, of which substance P (SP) is the prototype, are neuropeptides which are widely distributed in the nervous systems. In the equine gut, SP is present in enteric nerves and is a powerful constrictor of enteric muscle; in other species, SP is also known to have potent vasodilatory and pro-inflammatory effects. The specific effects of SP are determined by the subtype of receptor present in the target tissue. There are 3 known subtypes of tachykinin receptors, distinguished by their relative affinities for SP and other tachykinins. The distribution of SP binding sites in the equine pelvic flexure was determined using 125I-Bolton Hunter SP (I-BHSP) autoradiography. Most I-BHSP binding sites were determined to be saturable and specific, therefore presumably representing tachykinin receptors. The greatest degree of I-BHSP binding occurred over very small vessels, and over the muscularis mucosae; I-BHSP binding was also intense over the circular muscle of the muscularis externa and mucosa, and present, although less intense, over the longitudinal muscle of the muscularis externa. Competition of I-BHSP with specific receptor agonists for binding sites in the equine pelvic flexure were used to determine the subtypes of tachykinin receptors present. The neurokinin-1 receptor subtype predominated in the equine pelvic flexure, followed by the neurokinin-3 receptor subtype
National Aeronautics and Space Administration — The Raster Based GIS Coverage of Mexican Population is a gridded coverage (1 x 1 km) of Mexican population. The data were converted from vector into raster. The...
Pirogov, A.
2014-04-01
An optional course, "Geographical Aspects of Business" in the framework of the Bachelor of management program in the Lomonosov Moscow State University Business School is setting the goal to introduce future discipline specialists with geographical topics of current interest for management and provide knowledge, skills and expertise of geospatial analysis and the use of geoinformation technologies in finding solutions to economic and managerial tasks. The students' feedback shows interest and demand for such a course for management students. The course has an interdisciplinary links with the main subjects such as marketing, public administration, visual communication, etc., and is based on the set of business cases dealing with Web-GIS Services, LBS, Geomarketing, Spatial analysis, etc. Open Data and corporate geodata sets are used. The pragmatist approach is selected for successful accomplishment of the course's goal, which is based on using Web-GIS tools. The Geomixer - a free web- GIS product by the company SCANEX - is chosen to be one of them. The principle "I do - I analyze" helps to minimize the theoretic constituent of the course improving the outcome of the classes. Owing to innovative methods of teaching, the educational goal of the course is achieved to the full scope despite the small number of allocated hours. The classes surely improve both the general level of geographic competence of students and provide them with the skills to work with GIS. Such optional courses will undoubtedly contribute to the development of GIS-education in management administration.
Bogaert, Lies; Woodham, Andrew W; Da Silva, Diane M; Martens, Ann; Meyer, Evelyne; Kast, W Martin
2015-09-01
Equine sarcoids are highly recurrent bovine papillomavirus (BPV)-induced fibroblastic neoplasms that are the most common skin tumours in horses. In order to facilitate the study of potential equine sarcoid prophylactics or therapeutics, which can be a slow and costly process in equines, a murine model for BPV-1 protein-expressing equine sarcoid-like tumours was developed in mice through stable transfection of BPV-1 E5 and E6 in a murine fibroblast tumour cell line (K-BALB). Like equine sarcoids, these murine tumour cells (BPV-KB) were of fibroblast origin, were tumorigenic and expressed BPV-1 proteins. As an initial investigation of the preclinical potential of this tumour model for equine sarcoids prophylactics, mice were immunized with BPV-1 E5E6 Venezuelan equine encephalitis virus replicon particles, prior to BPV-KB challenge, which resulted in an increased tumour-free period compared with controls, indicating that the BPV-KB murine model may be a valuable preclinical alternative to equine clinical trials.
Effects of Equine Assisted Activities on Autism Spectrum Disorder
Lanning, Beth A.; Baier, Margaret E. Matyastik; Ivey-Hatz, Julie; Krenek, Nancy; Tubbs, Jack D.
2014-01-01
Quality of life assessments were used in this study to determine the behavioral changes of children diagnosed with autism spectrum disorder (ASD) who participated in equine assisted activities. Behavioral changes of children with ASD participating in 9 weeks of equines assisted activities (EAA) (N = 10) were compared to behavioral changes of…
Autism and Equine-Assisted Interventions: A Systematic Mapping Review
McDaniel Peters, B. Caitlin; Wood, Wendy
2017-01-01
This systematic mapping review mapped current knowledge of equine-assisted interventions for people with autism to help guide future practice and research. Thirty-three studies including children and adolescents with autism, 3 of which confirmed diagnoses, were reviewed. Five types of equine-assisted activities were identified across 25 studies,…
Kharroubi, Adel; Gargouri, Dorra; Baati, Houda; Azri, Chafai
2012-06-01
Concentrations of selected heavy metals (Cd, Pb, Zn, Cu, Mn, and Fe) in surface sediments from 66 sites in both northern and eastern Mediterranean Sea-Boughrara lagoon exchange areas (southeastern Tunisia) were studied in order to understand current metal contamination due to the urbanization and economic development of nearby several coastal regions of the Gulf of Gabès. Multiple approaches were applied for the sediment quality assessment. These approaches were based on GIS coupled with chemometric methods (enrichment factors, geoaccumulation index, principal component analysis, and cluster analysis). Enrichment factors and principal component analysis revealed two distinct groups of metals. The first group corresponded to Fe and Mn derived from natural sources, and the second group contained Cd, Pb, Zn, and Cu originated from man-made sources. For these latter metals, cluster analysis showed two distinct distributions in the selected areas. They were attributed to temporal and spatial variations of contaminant sources input. The geoaccumulation index (I (geo)) values explained that only Cd, Pb, and Cu can be considered as moderate to extreme pollutants in the studied sediments.
Western equine encephalitis with rapid onset of parkinsonism.
Schultz, D R; Barthal, J S; Garrett, G
1977-11-01
A patient with confirmed western equine encephalitis had the rapid onset of postencephalitic parkinsonian sequelae. This observation corroborates similar previous but rare reports. Response to therapy with levodopa, dopa decarboxylase inhibitor, and trihexyphenidyl was dramatic. However, remission maintained for 12 months without medication suggests that the parkinsonism would have remitted spontaneously. In either case, this has not previously been reported with the western equine togavirus.
Principles and Application of Hydrotherapy for Equine Athletes.
King, Melissa R
2016-04-01
Hydrotherapy has become a key element within equine rehabilitation protocols and is used to address range of motion, proprioception, strength, neuromotor control, pain, and inflammation. Various forms of hydrotherapy can be tailored to the individual's injury and the expected return to athletic performance. This article describes the mechanisms of action of hydrotherapies and potential use in the clinical management of equine musculoskeletal injuries. Published by Elsevier Inc.
Shahabi, Himan; Hashim, Mazlan
2015-04-22
This research presents the results of the GIS-based statistical models for generation of landslide susceptibility mapping using geographic information system (GIS) and remote-sensing data for Cameron Highlands area in Malaysia. Ten factors including slope, aspect, soil, lithology, NDVI, land cover, distance to drainage, precipitation, distance to fault, and distance to road were extracted from SAR data, SPOT 5 and WorldView-1 images. The relationships between the detected landslide locations and these ten related factors were identified by using GIS-based statistical models including analytical hierarchy process (AHP), weighted linear combination (WLC) and spatial multi-criteria evaluation (SMCE) models. The landslide inventory map which has a total of 92 landslide locations was created based on numerous resources such as digital aerial photographs, AIRSAR data, WorldView-1 images, and field surveys. Then, 80% of the landslide inventory was used for training the statistical models and the remaining 20% was used for validation purpose. The validation results using the Relative landslide density index (R-index) and Receiver operating characteristic (ROC) demonstrated that the SMCE model (accuracy is 96%) is better in prediction than AHP (accuracy is 91%) and WLC (accuracy is 89%) models. These landslide susceptibility maps would be useful for hazard mitigation purpose and regional planning.
An Overview of GIS-Based Modeling and Assessment of Mining-Induced Hazards: Soil, Water, and Forest
Suh, Jangwon; Kim, Sung-Min; Yi, Huiuk; Choi, Yosoon
2017-01-01
In this study, current geographic information system (GIS)-based methods and their application for the modeling and assessment of mining-induced hazards were reviewed. Various types of mining-induced hazard, including soil contamination, soil erosion, water pollution, and deforestation were considered in the discussion of the strength and role of GIS as a viable problem-solving tool in relation to mining-induced hazards. The various types of mining-induced hazard were classified into two or t...
Chuang, Yi-Ting
The advancement of mobile computing technology has provided diverse way for education. Combination of mobile devices and GIS tools has become a trend in many geospatial technology applications (i.e., Google Maps application on smartphones). This research aims to develop an iBook prototype (a GIS textbook) for GIS education on Apple iPads and to evaluate the effectiveness of adopting the GIS iBook in classes and fieldwork exercises. We conducted the evaluation tests in two GIS courses (GEOG104 and GEOG381) in Fall 2014 at San Diego State University. There are two main research questions in this study: (1) How to assess and evaluate the effectiveness of location-based learning exercises (from iBook) and fieldwork exercises for first-time GIS students? (2) What were major technical challenges and opportunities to utilize mobile device and mobile technology in GIS education? The procedures of developing and evaluating the prototype of the GIS iBook include creating two new chapters (chapter three: Wander the World through Remote Sensing Data and chapter four: Internet and Mobile GIS), interviewing five educators from high schools and community colleges, and improving the contents of the GIS iBook after the interview. There were 31 students who tested the GIS iBook and did a fieldwork exercise with iPads. The 31 students were required to finish five questionnaires after the exercise to express their user experiences and thoughts about the GIS iBook. Based on the result of questionnaires, most students preferred to take GIS classes with the free GIS iBook and thought fieldwork exercise can help their learning. The students also performed better in knowledge oriented survey after reading the GIS iBook. This research also adopts the SWOT analysis method to evaluate the prototype of the GIS iBook. The result of the SWOT analysis indicates that utilizing mobile device in GIS education does have a great potential value in enhancing student's understanding. The strengths of
Use of GIS Tools for Environmental Conflict Resolution at Map Ta Phut Industrial Zone in Thailand
Directory of Open Access Journals (Sweden)
Phattraporn Soytong
2014-04-01
Full Text Available Special industrial zones are favored over scattered industries from an environmental management perspective, but poor management can lead to conflicts. This paper presents an analysis of the environmental conflict that arose between the state, society, and industry stakeholders in an industrial zone of the Eastern Seaboard Development Program of Thailand. This paper seeks to determine the effectiveness of policy measures implemented by the state to resolve the conflict. The purpose of this study is to draw lessons for industrializing nations that adopt the industrial zone model to foster environmentally sustainable industrial development. The study revealed that blatant violation of land-use planning regulations and expansion of the industrial zone into community areas was a root cause of the conflict. Through legal action, civil society has been successful in forcing the state and industries to halt unplanned expansion of industrial areas and practice better environmental governance. However, inadequate commitment by the state and industry stakeholders seems to perpetuate the conflict, threatening the sustainability of economic gains. A Geographic Information Systems (GIS-based analysis confirmed that the policy interventions of the government to resolve the conflict have not produced significant results. This paper highlights the need for GIS-based environmental quality monitoring for guiding industrialization-based urban development towards sustainability.
GIS supported calculations of 137Cs deposition in Sweden based on precipitation data
International Nuclear Information System (INIS)
Almgren, S.; Nilsson, E.; Isaksson, M.; Erlandsson, B.
2005-01-01
137 Cs deposition maps were made using Kriging interpolation in a Geographical Information System (GIS). Quarterly values of 137 Cs deposition density per unit precipitation (Bq/m 2 /mm) at three reference sites and quarterly precipitation at 62 weather stations distributed over Sweden were used in the calculations of Nuclear Weapons Fallout (NWF). The deposition density of 137 Cs, resulting from the Chernobyl accident, was calculated for western Sweden using precipitation data from 46 stations. The lowest levels of NWF 137 Cs deposition density were noted in the northeastern and eastern Sweden and the highest levels in the western parts of Sweden. The Chernobyl 137 Cs deposition density is highest along the coast in the selected area and the lowest in the southeastern part and along the middle. The sum of the calculated deposition density from NWF and Chernobyl in western Sweden was compared to accumulated activities in soil samples at 27 locations. Comparisons between the predicted values of this study show a good agreement with measured values
Online Leader Training Course: Nebraska Equine Extension Leader Certification
Cottle, Lena; D'Angelo, Nicole
2015-01-01
The Nebraska Equine Advancement Level Leader Certification Program is an online learning tool that clarifies principles of the Nebraska 4-H Equine Advancement Programs. Through an online Moodle course through eXtension.org, 4-H leaders and Extension educators are able to fulfill the certification requirement from any location before allowing youth…
Khurelbaatar, Nyamdavaa; Krueger, Whitney S.; Heil, Gary L.; Darmaa, Badarchiin; Ulziimaa, Daramragchaa; Tserennorov, Damdindorj; Baterdene, Ariungerel; Anderson, Benjamin D.; Gray, Gregory C.
2013-01-01
In recent years, Mongolia has experienced recurrent epizootics of equine influenza virus (EIV) among its 2?1 million horses and multiple incursions of highly pathogenic avian influenza (HPAI) virus via migrating birds. No human EIV or HPAI infections have been reported. In 2009, 439 adults in Mongolia were enrolled in a population?based study of zoonotic influenza transmission. Enrollment sera were examined for serological evidence of infection with nine avian, three human, and one equine inf...
GIS-based examination of peats and soils in Surfers Paradise, Australia
Directory of Open Access Journals (Sweden)
Al-Ani Haider
2014-03-01
Full Text Available The subsoil conditions of Surfers Paradise in Southeast Queensland of Australia have been examined in terms of soil stiffness by using geographic information system (GIS. Peat is a highly organic and compressible material. Surfers Paradise (as a study area has problematic peat layer due to its high water content, high compressibility, and low shear strength. This layer has various thicknesses at different locations ranging between R.L. . 10 to R.L. -19.6 m. Buildings in Surfers Paradise are using piled foundations to avoid the high compressibility and low shear strength peat layer. Spatial Analyst extension in the GIS ArcMap10 has been utilised to develop zonation maps for different depths in the study area. Each depth has been interpolated as a surface to create Standard Penetration Test SPT-N value GIS-based zonation maps for each depth. In addition, 8 interpolation techniques have been examined to evaluate which technique gives better representation for the Standard Penetration Test (SPT data. Inverse Distance weighing (IDW method in Spatial Analyst extension gives better representation for the utilised data with certain parameters. Two different cross sections have been performed in the core of the study area to determine the extent and the depth of the peat layer underneath already erected buildings. Physical and engineering properties of the Surfers Paradise peat have been obtained and showed that this peat falls within the category of tropical peat.
Verification of a GIS-based system for identification of potential hydro power plant sites in Uganda
Gimbo, Florence
2015-01-01
Hydropower makes and is expected to continue to make a significant contribution to meeting the electricity demand in many countries. The information on hydropower potential is many places is often incomplete. A GIS based tool is under development is expected to help in quickly identifying possible hydropower plant locations over a large area in a short time. This study is aimed at evaluating how well this GIS tool is able to estimate the hydropower potential from the runoff maps and terrain/e...
[Application of electronic fence technology based on GIS in Oncomelania hupensis snail monitoring].
Zhi-Hua, Chen; Yi-Sheng, Zhu; Zhi-Qiang, Xue; Xue-Bing, Li; Yi-Min, Ding; Li-Jun, Bi; Kai-Min, Gao; You, Zhang
2017-07-27
To study the application of Geographic Information System (GIS) electronic fence technique in Oncomelania hupensis snail monitoring. The electronic fence was set around the history and existing snail environments in the electronic map, the information about snail monitoring and controlling was linked to the electronic fence, and the snail monitoring information system was established on these bases. The monitoring information was input through the computer and smart phone. The electronic fence around the history and existing snail environments was set in the electronic map (Baidu map), and the snail monitoring information system and smart phone APP were established. The monitoring information was input and upload real-time, and the snail monitoring information was demonstrated in real time on Baidu map. By using the electronic fence technology based on GIS, the unique "environment electronic archives" for each snail monitoring environment can be established in the electronic map, and real-time, dynamic monitoring and visual management can be realized.
Huang, Fang; Liu, Dingsheng; Tan, Xicheng; Wang, Jian; Chen, Yunping; He, Binbin
2011-04-01
To design and implement an open-source parallel GIS (OP-GIS) based on a Linux cluster, the parallel inverse distance weighting (IDW) interpolation algorithm has been chosen as an example to explore the working model and the principle of algorithm parallel pattern (APP), one of the parallelization patterns for OP-GIS. Based on an analysis of the serial IDW interpolation algorithm of GRASS GIS, this paper has proposed and designed a specific parallel IDW interpolation algorithm, incorporating both single process, multiple data (SPMD) and master/slave (M/S) programming modes. The main steps of the parallel IDW interpolation algorithm are: (1) the master node packages the related information, and then broadcasts it to the slave nodes; (2) each node calculates its assigned data extent along one row using the serial algorithm; (3) the master node gathers the data from all nodes; and (4) iterations continue until all rows have been processed, after which the results are outputted. According to the experiments performed in the course of this work, the parallel IDW interpolation algorithm can attain an efficiency greater than 0.93 compared with similar algorithms, which indicates that the parallel algorithm can greatly reduce processing time and maximize speed and performance.
Customer service in equine veterinary medicine.
Blach, Edward L
2009-12-01
This article explores customer service in equine veterinary medicine. It begins with a discussion about the differences between customers and clients in veterinary medicine. An overview of the nature of the veterinary-client-patient relationship and its effects on the veterinarian's services sheds light on how to evaluate your customer service. The author reviews a study performed in 2007 that evaluated 24 attributes of customer service and their importance to clients of equine veterinarians in their decision to select a specific veterinarian or hospital. The article concludes with an overview of how to evaluate your customer service in an effort to optimize your service to achieve customer loyalty.
EGG YOLK AND LDL: POSSIBILITIES FOR ARTIFICIAL INSEMINATION IN EQUINES
Directory of Open Access Journals (Sweden)
Igor F. Canisso
2008-12-01
Full Text Available The world horse industry exerts an important role as a job and income generation source. Reproductive technologies arises as an important tool in the service of world equine growth. Artificial insemination (AI is perhaps the biotechnology with greater impact on equine breeding; a stallion can leave hundreds of offsprings over his reproductive life if AI is efficiently used. In some countries, egg yolk is frequently used as part of equine seminal extenders. The egg yolk provides the spermatozoa “resistance factors’’ when it is added. The protective fraction of the egg yolk probably is the low density lipoproteins (LDL. Several studies have reported successful results with the addition and replacement of egg yolk by LDL. There are many citations about the use of egg yolk in seminal extenders for stallion’s cooled and frozen semen, and in the equine reproduction practice. The egg yolk dilutors are used with good fertility results. New research is needed for the better understanding of the protective effects of egg yolk and the LDL for stallion semen. The LDL would be a great solution for dilutors to artificial insemination in horse. This review discusses the use and the advantages of egg yolk and LDL as constituents of equine semen extenders.
Microencapsulated equine mesenchymal stromal cells promote cutaneous wound healing in vitro.
Bussche, Leen; Harman, Rebecca M; Syracuse, Bethany A; Plante, Eric L; Lu, Yen-Chun; Curtis, Theresa M; Ma, Minglin; Van de Walle, Gerlinde R
2015-04-11
The prevalence of impaired cutaneous wound healing is high and treatment is difficult and often ineffective, leading to negative social and economic impacts for our society. Innovative treatments to improve cutaneous wound healing by promoting complete tissue regeneration are therefore urgently needed. Mesenchymal stromal cells (MSCs) have been reported to provide paracrine signals that promote wound healing, but (i) how they exert their effects on target cells is unclear and (ii) a suitable delivery system to supply these MSC-derived secreted factors in a controlled and safe way is unavailable. The present study was designed to provide answers to these questions by using the horse as a translational model. Specifically, we aimed to (i) evaluate the in vitro effects of equine MSC-derived conditioned medium (CM), containing all factors secreted by MSCs, on equine dermal fibroblasts, a cell type critical for successful wound healing, and (ii) explore the potential of microencapsulated equine MSCs to deliver CM to wounded cells in vitro. MSCs were isolated from the peripheral blood of healthy horses. Equine dermal fibroblasts from the NBL-6 (horse dermal fibroblast cell) line were wounded in vitro, and cell migration and expression levels of genes involved in wound healing were evaluated after treatment with MSC-CM or NBL-6-CM. These assays were repeated by using the CM collected from MSCs encapsulated in core-shell hydrogel microcapsules. Our salient findings were that equine MSC-derived CM stimulated the migration of equine dermal fibroblasts and increased their expression level of genes that positively contribute to wound healing. In addition, we found that equine MSCs packaged in core-shell hydrogel microcapsules had similar effects on equine dermal fibroblast migration and gene expression, indicating that microencapsulation of MSCs does not interfere with the release of bioactive factors. Our results demonstrate that the use of CM from MSCs might be a promising
Marion duPont Scott Equine Medical Center uses innovative lameness treatment
Lee, Kate
2009-01-01
Virginia Tech's Marion duPont Scott Equine Medical Center is now offering an equine lameness therapy that prevents further degeneration of the affected joint and offers a longer-lasting benefit than traditional steroid treatment.
Indirect Fluorescent Antibody Technique based Prevalence of Surra in Equines
Directory of Open Access Journals (Sweden)
Ahsan Nadeem, Asim Aslam*, Zafar Iqbal Chaudhary, Kamran Ashraf1, Khalid Saeed1, Nisar Ahmad1, Ishtiaq Ahmed and Habib ur Rehman2
2011-04-01
Full Text Available This project was carried out to find the prevalence of trypanosomiasis in equine in District Gujranwala by using indirect fluorescent antibody technique and thin smear method. Blood samples were collected from a total of 200 horses and donkeys of different ages and either sex. Duplicate thin blood smears were prepared from each sample and remaining blood samples were centrifuged to separate the serum. Smears from each animal were processed for giemsa staining and indirect fluorescent antibody test (IFAT. Giemsa stained smears revealed Trypanosome infection in 4/200 (2.0% samples and IFAT in 12/200 (6.0% animals.
Kim, Minsung; Kim, Kamyoung; Lee, Sang-Il
2013-01-01
This article examines the pedagogical potential of a Web-based GIS application, Population Migration Web Service (PMWS), in which students can examine population geography in an interactive and exploratory manner. This article introduces PMWS, a tailored, unique Internet GIS application that provides functions for visualizing spatial interaction…
Research on evaluation of degree of complexity of mining fault network based on GIS
Energy Technology Data Exchange (ETDEWEB)
Hua Zhang; Yun-jia Wang; Chuan-zhi Liu [China University of Mining and Technology, Jiangsu (China). School of Environment Science and Spatial Informatics
2007-03-15
A large number of spatial and attribute data are involved in coal resource evaluation. Databases are a relatively advanced data management technology, but their major defects are the poor graphic and spatial data functions, from which it is difficult to realize scientific management of evaluation data with spatial characteristics and evaluation result maps. On account of these deficiencies, the evaluation of degree of complexity of mining fault network based on a geographic information system (GIS) is proposed which integrates management of spatial and attribute data. A fractal is an index which can reflect the comprehensive information of faults' number, density, size, composition and dynamics mechanism. A fractal dimension is used as the quantitative evaluation index. Evaluation software has been developed based on a component GIS-MapX, with which the degree of complexity of fault network is evaluated quantitatively using the quantitative index of fractal dimensions in Liuqiao No.2 coal mine as an example. Results show that it is effective in acquiring model parameters and enhancing the definition of data and evaluation results with the application of GIS technology. The fault network is a system with fractal structure and its complexity can be described reasonably and accurately by fractal dimension, which provides an effective method for coal resource evaluation. 9 refs., 6 figs., 2 tabs.
Health risks zonation in megacities vis-à-vis PM using GIS-based ...
African Journals Online (AJOL)
Since the air quality, considering PM2.5 varies over space and time, in this paper, RBF method in a based GIS model was utilized to zone air quality and its health risks upon PM2.5 concentrations dispersion over Tehran, during one year, from 21 March 2013 to 20 March 2014. The RBF method was applied to obtain the ...
Gis-based procedures for hydropower potential spotting
Energy Technology Data Exchange (ETDEWEB)
Larentis, Dante G.; Collischonn, Walter; Tucci, Carlos E.M. [Instituto de Pesquisas Hidraulicas da UFRGS, Av. Bento Goncalves, 9500, CEP 91501-970, Caixa Postal 15029, Porto Alegre, RS (Brazil); Olivera, Francisco (Texas A and M University, Zachry Department of Civil Engineering 3136 TAMU, College Station, TX 77843-3136, US)
2010-10-15
The increasing demand for energy, especially from renewable and sustainable sources, spurs the development of small hydropower plants and encourages investment in new survey studies. Preliminary hydropower survey studies usually carry huge uncertainties about the technical, economic and environmental feasibility of the undeveloped potential. This paper presents a methodology for large-scale survey of hydropower potential sites to be applied in the inception phase of hydroelectric development planning. The sequence of procedures to identify hydropower sites is based on remote sensing and regional streamflow data and was automated within a GIS-based computational program: Hydrospot. The program allows spotting more potential sites along the drainage network than it would be possible in a traditional survey study, providing different types of dam-powerhouse layouts and two types (operating modes) of projects: run-of-the-river and storage projects. Preliminary results from its applications in a hydropower-developed basin in Brazil have shown Hydrospot's limitations and potentialities in giving support to the mid-to-long-term planning of the electricity sector. (author)
Hoane, Jessica S; Morrow, Jennifer K; Saville, William J; Dubey, J P; Granstrom, David E; Howe, Daniel K
2005-09-01
Sarcocystis neurona is the primary causative agent of equine protozoal myeloencephalitis (EPM), a common neurologic disease of horses in the Americas. We have developed a set of enzyme-linked immunosorbent assays (ELISAs) based on the four major surface antigens of S. neurona (SnSAGs) to analyze the equine antibody response to S. neurona. The SnSAG ELISAs were optimized and standardized with a sample set of 36 equine sera that had been characterized by Western blotting against total S. neurona parasite antigen, the current gold standard for S. neurona serology. The recombinant SnSAG2 (rSnSAG2) ELISA showed the highest sensitivity and specificity at 95.5% and 92.9%, respectively. In contrast, only 68.2% sensitivity and 71.4% specificity were achieved with the rSnSAG1 ELISA, indicating that this antigen may not be a reliable serological marker for analyzing antibodies against S. neurona in horses. Importantly, the ELISA antigens did not show cross-reactivity with antisera to Sarcocystis fayeri or Neospora hughesi, two other equine parasites. The accuracy and reliability exhibited by the SnSAG ELISAs suggest that these assays will be valuable tools for examining the equine immune response against S. neurona infection, which may help in understanding the pathobiology of this accidental parasite-host interaction. Moreover, with modification and further investigation, the SnSAG ELISAs have potential for use as immunodiagnostic tests to aid in the identification of horses affected by EPM.
Hoane, Jessica S.; Morrow, Jennifer K.; Saville, William J.; Dubey, J. P.; Granstrom, David E.; Howe, Daniel K.
2005-01-01
Sarcocystis neurona is the primary causative agent of equine protozoal myeloencephalitis (EPM), a common neurologic disease of horses in the Americas. We have developed a set of enzyme-linked immunosorbent assays (ELISAs) based on the four major surface antigens of S. neurona (SnSAGs) to analyze the equine antibody response to S. neurona. The SnSAG ELISAs were optimized and standardized with a sample set of 36 equine sera that had been characterized by Western blotting against total S. neurona parasite antigen, the current gold standard for S. neurona serology. The recombinant SnSAG2 (rSnSAG2) ELISA showed the highest sensitivity and specificity at 95.5% and 92.9%, respectively. In contrast, only 68.2% sensitivity and 71.4% specificity were achieved with the rSnSAG1 ELISA, indicating that this antigen may not be a reliable serological marker for analyzing antibodies against S. neurona in horses. Importantly, the ELISA antigens did not show cross-reactivity with antisera to Sarcocystis fayeri or Neospora hughesi, two other equine parasites. The accuracy and reliability exhibited by the SnSAG ELISAs suggest that these assays will be valuable tools for examining the equine immune response against S. neurona infection, which may help in understanding the pathobiology of this accidental parasite-host interaction. Moreover, with modification and further investigation, the SnSAG ELISAs have potential for use as immunodiagnostic tests to aid in the identification of horses affected by EPM. PMID:16148170
Assessment of bioenergy potential in Sicily: A GIS-based support methodology
International Nuclear Information System (INIS)
Beccali, Marco; D'Alberti, Vincenzo; Franzitta, Vincenzo; Columba, Pietro
2009-01-01
A Geographical Information System (GIS) supported methodology has been developed in order to assess the technical and economic potential of biomass exploitation for energy production in Sicily. The methodology was based on the use of agricultural, economic, climatic, and infrastructural data in a GIS. Data about land use, transportation facilities, urban cartography, regional territorial planning, terrain digital model, lithology, climatic types, and civil and industrial users have been stored in the GIS to define potential areas for gathering the residues coming from the pruning of olive groves, vineyards, and other agricultural crops, and to assess biomass available for energy cultivation. Further, it was possible to assess the potential of biodiesel production, supposing the cultivation of rapeseed in arable crop areas. For the biomass used for direct combustion purposes, the economic availability has been assessed assuming a price of the biomass and comparing it with other fuels. This assessment has shown the strong competitiveness of firewood in comparison with traditional fossil fuels when the collection system is implemented in an efficient way. Moreover, the economic potential of biodiesel was assessed considering the on-going financial regime for fuel. At the same time, the study has shown a significant competitiveness of the finished biomass (pellets), and good potential for a long-term development of this market. An important result was the determination of biofuel production potential in Sicily. An outcome of the study was to show the opportunities stemming from the harmonisation of Energy Policy with the Waste Management System and Rural Development Plan. (author)
MRSA carriage in the equine community: an investigation of horse-caretaker couples.
Van den Eede, A; Martens, A; Floré, K; Denis, O; Gasthuys, F; Haesebrouck, F; Van den Abeele, A; Hermans, K
2013-05-03
Equine methicillin-resistant Staphylococcus aureus (MRSA) carriage entails a risk of both equine and zoonotic transmission and infection. In Europe, CC398, the livestock-associated (LA-)MRSA is highly prevalent in horses and veterinary personnel at equine clinics. The extent of the MRSA reservoir created by healthy horses from the general population and associated health hazard for their daily caretakers is, however, unknown. This study aimed at screening healthy horse-caretaker couples from a broad range of home farms. At five equine gatherings, 166 couples were selected for MRSA screening in the anterior nares and participation in an epidemiologic survey. All MRSA isolates were subjected to genotyping and antimicrobial susceptibility testing. Only 4 humans (2.4%) and 2 of their horses (1.2%) tested MRSA positive. Within the 2 couples where both partners were positive, man and horse carried isolates belonging to identical, livestock-associated spa types (t011 and t2330) and demonstrating equal antimicrobial susceptibility patterns. For all LA-MRSA positive humans (n=3) and animals (n=2) regular (in)direct contact with the veterinary sector was reported. A significant association between the horses' carriage status and transportation to an event could not be demonstrated (P=1.00). In conclusion, outside equine clinics, the extent of the MRSA reservoir in horses and their caretakers was low. Travel to an equine gathering could not be withheld as a risk factor for equine MRSA carriage, whereas indications were found that contact with veterinary care may predispose both healthy horses and their handlers to carriage. Copyright © 2013. Published by Elsevier B.V.
Freeware for GIS and Remote Sensing
Lena Halounová
2007-01-01
Education in remote sensing and GIS is based on software utilization. The software needs to be installed in computer rooms with a certain number of licenses. The commercial software equipment is therefore financially demanding and not only for universities, but especially for students. Internet research brings a long list of free software of various capabilities. The paper shows a present state of GIS, image processing and remote sensing free software.
Directory of Open Access Journals (Sweden)
Pavel Tobiáš
2015-06-01
Full Text Available In the coming years we will most probably watch a significant increase of the BIM (building information model utilization in the AEC (Architecture/Engineering/Construction sector even in the Czech Republic. Therefore, it would be reasonable to consider possible utilization of the well-established geographic information systems within the building information modelling process. This paper is based on the currently existing literature and is focused on the interrelationship between BIM and GIS. The main goal is to reveal potential fields of cooperation and to find possible utilization of GIS in BIM. To provide a theoretical framework, this article briefly introduces and defines the term of BIM and deals with the most important semantic models in AEC and 3D GIS IFC and CityGML. The paper also contains examples of specific efforts recently dealing with the BIM and GIS collaboration.
A fresh look at the anatomy and physiology of equine mastication.
Dixon, Padraic M; du Toit, Nicole; Staszyk, Carsten
2013-08-01
There have been many significant and interesting developments in equine dental anatomy during the past 20 years that are of major clinical significance in better understanding the physiology of equine mastication, the etiopathogenesis of some dental disorders, and their safe treatment. The many recent significant developments include descriptions of the enamel infolding of cheek teeth and of infundibular anatomy, including the frequent absence of cementum infilling in many infundibulae, which can lead to infundibular caries. Many important developments in equine dental anatomy are summarized in this article. Copyright © 2013 Elsevier Inc. All rights reserved.
Primary closure of equine laryngotomy incisions
DEFF Research Database (Denmark)
Lindegaard, C.; Karlsson, L.; Ekstrøm, Claus Thorn
2016-01-01
incision between January 1995 and June 2012 were reviewed. Horses with a laryngotomy incision closed in three layers for primary healing were included. Descriptive data on healing characteristics and complications of laryngotomy wounds were collected from the medical records and via follow......The objective was to report healing characteristics and complications after primary closure of equine laryngotomies and analyse factors potentially associated with complications. This retrospective case series of the medical records of horses (n = 180) undergoing laryngoplasty and laryngotomy...... after primary closure of equine laryngotomy incisions are infrequent and considered of minimal severity and can be performed safely when paying careful attention to the closure of the cricothyroid membrane....
GIS and radiological crisis management
International Nuclear Information System (INIS)
Kacenelen, Y.
2009-01-01
The author reports a new operational exercise performed on September 17, 2009 on the CEA Saclay site. For this purpose, the CEA (the French Atomic Energy Commission) developed M2IRAGE, a tool based on ArcGIS 9.3 technologies. This tool allows an easier data collection and exploitation in order to quickly map the distribution of radioactive particles and thus help the management of the health response and emergency organization within two hours after the warning. This tool notably uses a geographic information system (GIS)
Louis R. Iverson; Martin E. Dale; Charles T. Scott; Anantha Prasad; Anantha Prasad
1997-01-01
A geographic information system (GIS) approach was used in conjunction with forest-plot data to develop an integrated moisture index (IMI), which was then used to predict forest productivity (site index) and species composition for forests in Ohio. In this region, typical of eastern hardwoods across the Midwest and southern Appalachians, topographic aspect and position...
DEFF Research Database (Denmark)
Larsen, Lars Erik; Storgaard, Torben; Holm, Elisabeth
2001-01-01
The study describes for the first time the phylogenetic relationship between equine arteritis virus (EAV) isolated from asymptomatic virus-shedding stallions and fatal cases of equine viral arteritis (EVA) in an European country. EAV was isolated from three dead foals and an aborted foetus during...
Directory of Open Access Journals (Sweden)
M. Landa
2017-07-01
Full Text Available Building a complete free and open source GIS computing and data publication platform can be a relatively easy task. This paper describes an automated deployment of such platform using two open source software projects – GIS.lab and Gisquick. GIS.lab (http: //web.gislab.io is a project for rapid deployment of a complete, centrally managed and horizontally scalable GIS infrastructure in the local area network, data center or cloud. It provides a comprehensive set of free geospatial software seamlessly integrated into one, easy-to-use system. A platform for GIS computing (in our case demonstrated on hydrological data processing requires core components as a geoprocessing server, map server, and a computation engine as eg. GRASS GIS, SAGA, or other similar GIS software. All these components can be rapidly, and automatically deployed by GIS.lab platform. In our demonstrated solution PyWPS is used for serving WPS processes built on the top of GRASS GIS computation platform. GIS.lab can be easily extended by other components running in Docker containers. This approach is shown on Gisquick seamless integration. Gisquick (http://gisquick.org is an open source platform for publishing geospatial data in the sense of rapid sharing of QGIS projects on the web. The platform consists of QGIS plugin, Django-based server application, QGIS server, and web/mobile clients. In this paper is shown how to easily deploy complete open source GIS infrastructure allowing all required operations as data preparation on desktop, data sharing, and geospatial computation as the service. It also includes data publication in the sense of OGC Web Services and importantly also as interactive web mapping applications.
A GIS-based extended fuzzy multi-criteria evaluation for landslide susceptibility mapping.
Feizizadeh, Bakhtiar; Shadman Roodposhti, Majid; Jankowski, Piotr; Blaschke, Thomas
2014-12-01
Landslide susceptibility mapping (LSM) is making increasing use of GIS-based spatial analysis in combination with multi-criteria evaluation (MCE) methods. We have developed a new multi-criteria decision analysis (MCDA) method for LSM and applied it to the Izeh River basin in south-western Iran. Our method is based on fuzzy membership functions (FMFs) derived from GIS analysis. It makes use of nine causal landslide factors identified by local landslide experts. Fuzzy set theory was first integrated with an analytical hierarchy process (AHP) in order to use pairwise comparisons to compare LSM criteria for ranking purposes. FMFs were then applied in order to determine the criteria weights to be used in the development of a landslide susceptibility map. Finally, a landslide inventory database was used to validate the LSM map by comparing it with known landslides within the study area. Results indicated that the integration of fuzzy set theory with AHP produced significantly improved accuracies and a high level of reliability in the resulting landslide susceptibility map. Approximately 53% of known landslides within our study area fell within zones classified as having "very high susceptibility", with the further 31% falling into zones classified as having "high susceptibility".
Ahmad, Sajid Rashid
-term memory processes were indicative of transitory hydrodynamic and other processes. An innovative framework for a spatio-temporal information-based system (STIBS) was developed. STIBS incorporated diverse datasets within a GIS, dynamic computer-based simulation models, and a spatial information query and graphical subsystem. Tests of the STIBS proved that it could be used to simulate and visualize temporal variability in shifting morphological states of the coastline.
[Research on suitable distribution of Paris yunnanensis based on remote sensing and GIS].
Luo, Yao; Dong, Yong-Bo; Zhu, Cong; Peng, Wen-Fu; Fang, Qing-Mao; Xu, Xin-Liang
2017-11-01
Paris yunnanensis is a kind of rare medicinal herb, having a very high medicinal value. Studying its suitable ecological condition can provide a basis for its rational exploitation, artificial cultivation, and sustainable utilization. A practicable method in this paper has been proposed to research the suitable regional distribution of P. yunnanensis in Sichuan province. By the case study of P. yunnanensis in Sichuan province, and according to related literatures, the suitable ecological condition of P. yunnanensis such as altitude, mean annual temperature (MAT), annual precipitation, regional slope, slope ranges, vegetative cover, and soil types was analyzed following remote sensing (RS) and GIS.The appropriate distribution regionof P. yunnanensis and its area were extracted based on RS and GIS technology,combing with the information of the field validation data. The results showed that the concentrated distribution regions in counties of Sichuan province were, Liangshan prefecture, Aba prefecture, Sertar county of Ganzi prefecture, Panzhihua city, Ya'an city, Chengdu city, Meishan city, Leshan city, Yibin city, Neijiang city, Luzhou city, Bazhong city, Nanchong city, Guangyuan city and other cities and counties area.The suitable distribution area in Sichuan is about 7 338 km², accounting for 3.02% of the total study regional area. The analysis result has high consistency with the filed validation data, and the research method for P. yunnanensis distribution region based onspatial overlay analysis and the extracted the information of land usage and ecological factors following the RS and GIS is reliable. Copyright© by the Chinese Pharmaceutical Association.
Directory of Open Access Journals (Sweden)
Philip Juul Pedersen
Full Text Available The KCNH2 and KCNE2 genes encode the cardiac voltage-gated K+ channel KV11.1 and its auxiliary β subunit KCNE2. KV11.1 is critical for repolarization of the cardiac action potential. In humans, mutations or drug therapy affecting the KV11.1 channel are associated with prolongation of the QT intervals on the ECG and increased risk of ventricular tachyarrhythmia and sudden cardiac death--conditions known as congenital or acquired Long QT syndrome (LQTS, respectively. In horses, sudden, unexplained deaths are a well-known problem. We sequenced the cDNA of the KCNH2 and KCNE2 genes using RACE and conventional PCR on mRNA purified from equine myocardial tissue. Equine KV11.1 and KCNE2 cDNA had a high homology to human genes (93 and 88%, respectively. Equine and human KV11.1 and KV11.1/KCNE2 were expressed in Xenopus laevis oocytes and investigated by two-electrode voltage-clamp. Equine KV11.1 currents were larger compared to human KV11.1, and the voltage dependence of activation was shifted to more negative values with V1/2 = -14.2±1.1 mV and -17.3±0.7, respectively. The onset of inactivation was slower for equine KV11.1 compared to the human homolog. These differences in kinetics may account for the larger amplitude of the equine current. Furthermore, the equine KV11.1 channel was susceptible to pharmacological block with terfenadine. The physiological importance of KV11.1 was investigated in equine right ventricular wedge preparations. Terfenadine prolonged action potential duration and the effect was most pronounced at slow pacing. In conclusion, these findings indicate that horses could be disposed to both congenital and acquired LQTS.
Freeware for GIS and Remote Sensing
Directory of Open Access Journals (Sweden)
Lena Halounová
2007-12-01
Full Text Available Education in remote sensing and GIS is based on software utilization. The software needs to be installed in computer rooms with a certain number of licenses. The commercial software equipment is therefore financially demanding and not only for universities, but especially for students. Internet research brings a long list of free software of various capabilities. The paper shows a present state of GIS, image processing and remote sensing free software.
Directory of Open Access Journals (Sweden)
I.H. EL-Gamily
2010-06-01
Full Text Available Wireless GIS services have been evolving from scientific and technological perspectives through the last two decades. These services include both the location-based services (LBS and the mobile field-based GIS. Whereas the former provides the user with the capability to access and query the already established enterprise geo-database, the latter enables the end user not only to access and query but also to update the geo-database by a near real-time spatial and non-spatial data. However, to establish a mobile field-based GIS facility, a concise system architecture should be designed. This architecture includes client-side components, wireless communication facility, and server components. The integration and automation of these components can provide the capability to collect, update, validate, and query the enterprise geo-database remotely in a near real-time mode. One of the potential fields of applications for the mobile field-based GIS is the crisis management process. A prescribed system has been previously defined as emergency response cycle for managing both the natural and the man-made crises. Three phases of the emergency response cycle are outlined which are the response and rescue phase, the recovery and reconstruction phase, and mitigation and preparedness phase. In each phase, various tasks are undertaken based on the type of the event. Selective tasks of the response and the rescue phase of the fire event occurred in the Sheraton Exchange Center have been chosen to check the validity of using the mobile field-based GIS for enhancing the performance of these tasks. These tasks are path selection and quick damage estimates.
Study on Method of Geohazard Change Detection Based on Integrating Remote Sensing and GIS
International Nuclear Information System (INIS)
Zhao, Zhenzhen; Yan, Qin; Liu, Zhengjun; Luo, Chengfeng
2014-01-01
Following a comprehensive literature review, this paper looks at analysis of geohazard using remote sensing information. This paper compares the basic types and methods of change detection, explores the basic principle of common methods and makes an respective analysis of the characteristics and shortcomings of the commonly used methods in the application of geohazard. Using the earthquake in JieGu as a case study, this paper proposes a geohazard change detection method integrating RS and GIS. When detecting the pre-earthquake and post-earthquake remote sensing images at different phases, it is crucial to set an appropriate threshold. The method adopts a self-adapting determination algorithm for threshold. We select a training region which is obtained after pixel information comparison and set a threshold value. The threshold value separates the changed pixel maximum. Then we apply the threshold value to the entire image, which could also make change detection accuracy maximum. Finally, we output the result to the GIS system to make change analysis. The experimental results show that this method of geohazard change detection based on integrating remote sensing and GIS information has higher accuracy with obvious advantages compared with the traditional methods
Application of gis - technology for modelling motion water in the open channels
Venherskyi, Petro; Kokovska, Yaryna
2012-01-01
In this paper technology that would be allowed to use ArcGIS-Extension, that is GIS-components for Webapplications based on ArcGIS Server'a. Such technologies provide simple and easy integration and use of GIS-component on the WEB-site, where a separate layer provided opportunities modeling and solving applied problems of moving water flow in rivers.
Campbell, Madeleine L H
2013-09-01
Veterinarians have a key role in providing medical care for sports horses during and between competitions, but the standard client:veterinarian relationship that exists in companion and production animal medicine is distorted by the involvement of third parties in sports medicine, resulting in distinct ethical dilemmas which warrant focused academic attention. By comparing the existing literature on human sports medicine, this article reviews the ethical dilemmas which face veterinarians treating equine athletes, and the role of regulators in contributing to or resolving those dilemmas. Major ethical dilemmas occur both between and during competitions. These include conflicts of responsibility, conflicts between the need for client confidentiality and the need to share information in order to maximise animal welfare, and the need for an evidence base for treatment. Although many of the ethical problems faced in human and equine sports medicine are similar, the duty conferred upon a veterinarian by the licensing authority to ensure the welfare of animals committed to his or her care requires different obligations to those of a human sports medicine doctor. Suggested improvements to current practice which would help to address ethical dilemmas in equine sports medicine include an enhanced system for recording equine injuries, the use of professional Codes of Conduct and Codes of Ethics to establish acceptable responses to common ethical problems, and insistence that treatment of equine athletes is evidence-based (so far as possible) rather than economics-driven. Copyright © 2013 The Author. Published by Elsevier Ltd.. All rights reserved.
Equine Mesenchymal Stromal Cells Retain a Pericyte-Like Phenotype.
Esteves, Cristina L; Sheldrake, Tara A; Dawson, Lucy; Menghini, Timothy; Rink, Burgunde Elisabeth; Amilon, Karin; Khan, Nusrat; Péault, Bruno; Donadeu, Francesc Xavier
2017-07-01
Mesenchymal stem/stromal cells (MSCs) have been used in human and equine regenerative medicine, and interest in exploiting their potential has increased dramatically over the years. Despite significant effort to characterize equine MSCs, the actual origin of these cells and how much of their native phenotype is maintained in culture have not been determined. In this study, we investigated the relationship between MSCs, derived from adipose tissue (AT) and bone marrow (BM), and pericytes in the horse. Both pericyte (CD146, NG2, and αSMA) and MSC (CD29, CD90, and CD73) markers were detected in equine AT and colocalized around blood vessels. Importantly, as assessed by flow cytometry, both pericyte (CD146, NG2, and αSMA) and MSC (CD29, CD44, CD90, and CD105) markers were present in a majority (≥90%) of cells in cultures of AT-MSCs and BM-MSCs; however, levels of pericyte markers were variable within each of those populations. Moreover, the expression of pericyte markers was maintained for at least eight passages in both AT-MSCs and BM-MSCs. Hematopoietic (CD45) and endothelial (CD144) markers were also detected at low levels in MSCs by quantitative polymerase chain reaction (qPCR). Finally, in coculture experiments, AT-MSCs closely associated with networks produced by endothelial cells, resembling the natural perivascular location of pericytes in vivo. Our results indicate that equine MSCs originate from perivascular cells and moreover maintain a pericyte-like phenotype in culture. Therefore, we suggest that, in addition to classical MSC markers, pericyte markers such as CD146 could be used when assessing and characterizing equine MSCs.
A GIS tool for the economic assessment of renewable technologies
International Nuclear Information System (INIS)
Mahmmud, F.; Woods, J.; Watson, S.; Halliday, J.; Hossain, J.
1997-01-01
A Geographical Information System (GIS) has the potential to analyse a large area for the optimum selection and siting of renewable energy systems. This paper reports on a GIS based scheme for the economic assessment of a selected number of wind and photovoltaic systems in the state of Karnataka, in India. This involved the implementation of an appropriate GIS methodology. The preparation of the GIS database is often the most arduous task in GIS operations. Thus, a description of the GIS methodology and the preparation of the database for the analysis of a selection of wind and photovoltaic systems is given. This approach has enabled the identification of the high potential areas in terms of the levelised electricity costs. An overall assessment of the region for present and future scenarios is also given. (author)
Clinical effects of CO2 laser on equine diseases
Lindholm, Arne; Svensson, Ulf; Collinder, Eje
2002-10-01
CO2 lasers has been used for five years at Malaren Equine Hospital, as an alternative treatment of some equine diseases. The application of CO2 laser has been studied for evaluation of its appropriateness for treatment of the equine diseases sarcoids, lameness in fetlock joints or pulmonary haemorrhage. During the last five years, above 100 equine sarcoids have been removed by laser surgery (CO2 laser) and so far resulting in significantly few recurrences compared with results from usual excision surgery. In one study, acute traumatic arthritis in fetlock joints was treated three times every second day with defocalised CO2 laser. The therapeutic effectiveness of CO2 laser in this study was better than that of the customary therapy with betamethasone plus hyaluronan. During one year, chronic pulmonary bleeders, namely exercise induced pulmonary haemorrhage, has been treated with defocalised CO2 laser. Six race horses have been treated once daily during five days. Until now, three of these horses have subsequently been successfully racing and no symptoms of pulmonary haemorrhage have been observed. These studies indicate that CO2 laser might be an appropriate therapy on sarcoids and traumatic arthritis, and probably also on exercise induced pulmonary haemorrhage. Other treatments for this pulmonary disease are few.
Human and equine cardiovascular endocrinology
DEFF Research Database (Denmark)
Vekens, Nicky Van Der; Hunter, Ingrid; Gøtze, Jens Peter
2013-01-01
Cardiac biomarkers such as troponins and natriuretic peptides are routinely used in human medicine for the evaluation of myocardial damage and heart failure. Recently, these markers have also been introduced in veterinary medicine. Comparison between human and equine cardiac biomarker studies sho...
Vector ecology of equine piroplasmosis
Equine piroplasmosis (EP) is a disease of equidae including horses, donkeys, mules and zebras caused by either of two protozoan parasites, Theileria equi or Babesia caballi. These parasites are biologically transmitted between hosts via tick-vectors and although they have inherent differences, they ...
Application of GIS from the multifunctionality aspect
Directory of Open Access Journals (Sweden)
Mirko A. Borisov
2011-04-01
Full Text Available Application of computer technology in the Earth science has led to the creation and development of new scientific disciplines, particularly digital cartography and GIS. This paper describes the application of GIS from several points of view such as: multi-scale, multi-thematic, multi-viewing, accommodation to standard software platforms and multi-user data accesses. Introduction The premise of a successful usage of topographic data nowadays implies their disposal in a digital form and organisation in a modern way, suitable for further computer processing. It is a unanimous opinion that it can be successfully completed only through creating data basis of space developing GIS. The theme of the written work is the development and application of GIS, and management of topographic data in accordance with international standards and users' needs. Moving to digital technology of creating and using topographic data should not be literal translation of the analogue map into a digital picture or just the automation of the map making using digital technology. The new method implies the formation of the central topographic data base which would generate displays of arbitrary scales, desired volumes of content, changeable sheet dimensions, various thematic displays, altogether in accordance with users' demands and needs. Digital cartography and GIS The development and application of computers in the area of earth sciences caused the creation of new definitions and disciplines among which are noticeable computer supported cartography and GIS. The computer-supported cartography was in its later phase called digital cartography and it can be used in two ways: like modern technology of date processing about space and like a new discipline. The main principle on which digital cartography as a discipline is based represents the processing and visualization of data about space but with computer supported technology. Application of GIS from various aspects
Risk of equine infectious disease transmission by non-race horse movements in Japan.
Hayama, Yoko; Kobayashi, Sota; Nishida, Takeshi; Nishiguchi, Akiko; Tsutsui, Toshiyuki
2010-07-01
For determining surveillance programs or infectious disease countermeasures, risk evaluation approaches have been recently undertaken in the field of animal health. In the present study, to help establish efficient and effective surveillance and countermeasures for equine infectious diseases, we evaluated the potential risk of equine infectious disease transmission in non-race horses from the viewpoints of horse movements and health management practices by conducting a survey of non-race horse holdings. From the survey, the non-race horse population was classified into the following five sectors based on their purposes: the equestrian sector, private owner sector, exhibition sector, fattening sector and others. Our survey results showed that the equestrian and private owner sectors had the largest population sizes, and movements between and within these sectors occurred quite frequently, while there was little movement in the other sectors. Qualitative evaluation showed that the equestrian and private owner sectors had relatively high risks of equine infectious disease transmission through horse movements. Therefore, it would be effective to concentrate on these two sectors when implementing surveillance or preventative measures. Special priority should be given to the private owner sector because this sector has not implemented inspection and vaccination well compared with the equestrian sector, which possesses a high compliance rate for these practices. This qualitative risk evaluation focused on horse movements and health management practices could provide a basis for further risk evaluation to establish efficient and effective surveillance and countermeasures for equine infectious diseases.
Cryptic etiopathological conditions of equine nervous system with special emphasis on viral diseases
Directory of Open Access Journals (Sweden)
Rakesh Kumar
2017-12-01
Full Text Available The importance of horse (Equus caballus to equine practitioners and researchers cannot be ignored. An unevenly distributed population of equids harbors numerous diseases, which can affect horses of any age and breed. Among these, the affections of nervous system are potent reason for death and euthanasia in equids. Many episodes associated with the emergence of equine encephalitic conditions have also pose a threat to human population as well, which signifies their pathogenic zoonotic potential. Intensification of most of the arboviruses is associated with sophisticated interaction between vectors and hosts, which supports their transmission. The alphaviruses, bunyaviruses, and flaviviruses are the major implicated groups of viruses involved with equines/humans epizootic/epidemic. In recent years, many outbreaks of deadly zoonotic diseases such as Nipah virus, Hendra virus, and Japanese encephalitis in many parts of the globe addresses their alarming significance. The equine encephalitic viruses differ in their global distribution, transmission and main vector species involved, as discussed in this article. The current review summarizes the status, pathogenesis, pathology, and impact of equine neuro-invasive conditions of viral origin. A greater understanding of these aspects might be able to provide development of advances in neuro-protective strategies in equine population.
Using a Web GIS Plate Tectonics Simulation to Promote Geospatial Thinking
Bodzin, Alec M.; Anastasio, David; Sharif, Rajhida; Rutzmoser, Scott
2016-01-01
Learning with Web-based geographic information system (Web GIS) can promote geospatial thinking and analysis of georeferenced data. Web GIS can enable learners to analyze rich data sets to understand spatial relationships that are managed in georeferenced data visualizations. We developed a Web GIS plate tectonics simulation as a capstone learning…
[Early warning for various internal faults of GIS based on ultraviolet spectroscopy].
Zhao, Yu; Wang, Xian-pei; Hu, Hong-hong; Dai, Dang-dang; Long, Jia-chuan; Tian, Meng; Zhu, Guo-wei; Huang, Yun-guang
2015-02-01
As the basis of accurate diagnosis, fault early-warning of gas insulation switchgear (GIS) focuses on the time-effectiveness and the applicability. It would be significant to research the method of unified early-warning for partial discharge (PD) and overheated faults in GIS. In the present paper, SO2 is proposed as the common and typical by-product. The unified monitoring could be achieved through ultraviolet spectroscopy (UV) detection of SO2. The derivative method and Savitzky-Golay filtering are employed for baseline correction and smoothing. The wavelength range of 290-310 nm is selected for quantitative detection of SO2. Through UV method, the spectral interference of SF6 and other complex by-products, e.g., SOF2 and SOF2, can be avoided and the features of trace SO2 in GIS can be extracted. The detection system is featured by compacted structure, low maintenance and satisfactory suitability in filed surveillance. By conducting SF6 decomposition experiments, including two types of PD faults and the overheated faults between 200-400 degrees C, the feasibility of proposed UV method has been verified. Fourier transform infrared spectroscopy and gas chromatography methods can be used for subsequent fault diagnosis. The different decomposition features in two kinds of faults are confirmed and the diagnosis strategy has been briefly analyzed. The main by-products under PD are SOF2 and SO2F2. The generated SO2 is significantly less than SOF2. More carbonous by-products will be generated when PD involves epoxy. By contrast, when the material of heater is stainless steel, SF6 decomposes at about 300 "C and the main by-products in overheated faults are SO2 and SO2F2. When heated over 350 degrees C, SO2 is generated much faster. SOz content stably increases when the GIS fault lasts. The faults types could be preliminarily identified based on the generation features of SO2.
Effect of dietary starch source and concentration on equine fecal microbiota
Starch from corn is less susceptible to equine small intestinal digestion than starch from oats, and starch that reaches the hindgut can be utilized by the microbiota. The objective of the current study was to examine the effects of starch source on equine fecal microbiota. Thirty horses were assig...
A Web-Based GIS for Reporting Water Usage in the High Plains Underground Water Conservation District
Jia, M.; Deeds, N.; Winckler, M.
2012-12-01
The High Plains Underground Water Conservation District (HPWD) is the largest and oldest of the Texas water conservation districts, and oversees approximately 1.7 million irrigated acres. Recent rule changes have motivated HPWD to develop a more automated system to allow owners and operators to report well locations, meter locations, meter readings, the association between meters and wells, and contiguous acres. INTERA, Inc. has developed a web-based interactive system for HPWD water users to report water usage and for the district to better manage its water resources. The HPWD web management system utilizes state-of-the-art GIS techniques, including cloud-based Amazon EC2 virtual machine, ArcGIS Server, ArcSDE and ArcGIS Viewer for Flex, to support web-based water use management. The system enables users to navigate to their area of interest using a well-established base-map and perform a variety of operations and inquiries against their spatial features. The application currently has six components: user privilege management, property management, water meter registration, area registration, meter-well association and water use report. The system is composed of two main databases: spatial database and non-spatial database. With the help of Adobe Flex application at the front end and ArcGIS Server as the middle-ware, the spatial feature geometry and attributes update will be reflected immediately in the back end. As a result, property owners, along with the HPWD staff, collaborate together to weave the fabric of the spatial database. Interactions between the spatial and non-spatial databases are established by Windows Communication Foundation (WCF) services to record water-use report, user-property associations, owner-area associations, as well as meter-well associations. Mobile capabilities will be enabled in the near future for field workers to collect data and synchronize them to the spatial database. The entire solution is built on a highly scalable cloud
GIS-based Multi-criteria land suitability analysis for sustainable ...
Indian Academy of Sciences (India)
43
of Tadla plain (Morocco) using geographic information system (GIS) and analytical ... clean water and air, reducing greenhouse gas emissions, preserving natural ... criteria decision making (MCDM) methods allowed having information from ...
Venezuelan Equine Encephalitis Virus Activity in the Gulf Coast Region of Mexico, 2003–2010
Adams, A. Paige; Navarro-Lopez, Roberto; Ramirez-Aguilar, Francisco J.; Lopez-Gonzalez, Irene; Leal, Grace; Flores-Mayorga, Jose M.; Travassos da Rosa, Amelia P. A.; Saxton-Shaw, Kali D.; Singh, Amber J.; Borland, Erin M.; Powers, Ann M.; Tesh, Robert B.; Weaver, Scott C.; Estrada-Franco, Jose G.
2012-01-01
Venezuelan equine encephalitis virus (VEEV) has been the causative agent for sporadic epidemics and equine epizootics throughout the Americas since the 1930s. In 1969, an outbreak of Venezuelan equine encephalitis (VEE) spread rapidly from Guatemala and through the Gulf Coast region of Mexico, reaching Texas in 1971. Since this outbreak, there have been very few studies to determine the northward extent of endemic VEEV in this region. This study reports the findings of serologic surveillance in the Gulf Coast region of Mexico from 2003–2010. Phylogenetic analysis was also performed on viral isolates from this region to determine whether there have been substantial genetic changes in VEEV since the 1960s. Based on the findings of this study, the Gulf Coast lineage of subtype IE VEEV continues to actively circulate in this region of Mexico and appears to be responsible for infection of humans and animals throughout this region, including the northern State of Tamaulipas, which borders Texas. PMID:23133685
The antimicrobial activity of bupivacaine, lidocaine and mepivacaine against equine pathogens
DEFF Research Database (Denmark)
Adler, D. M. T.; Damborg, P.; Verwilghen, D. R.
2017-01-01
Lameness is the most commonly reported health problem in horses, and lameness investigations which include local anaesthetic injections are routinely performed by equine practitioners. Through this process, bacteria can enter the tissues perforated by the needle and may cause local infections...... the antimicrobial activity of the local anaesthetics bupivacaine, lidocaine and mepivacaine against 40 equine clinical bacterial isolates of the Actinobacillus, Corynebacterium, Enterobacter, Escherichia, Pseudomonas, Rhodococcus, Staphylococcus and Streptococcus genera. Minimum inhibitory and minimum bactericidal...... also bactericidal. The tested local anaesthetics possessed antimicrobial activity against equine pathogens at concentrations that are routinely applied in clinical cases. However, this antimicrobial activity should not discourage antiseptic preparation prior to local anaesthetic injections....
Johnson, Jay K.
1991-01-01
Data recovered as the result of a recent field project designed to test a model of the distribution of protohistoric settlement in an unusual physiographic zone in eastern Mississippi are examined using GIS based techniques to manipulate soil and stream distance information. Significant patterning is derived. The generally thin soils and uniform substratum of the Black Prairie in combination with a distinctive settlement pattern offer a promising opportunity for the search for site specific characteristics within airborne imagery. Landsat TM data provide information on modern ground cover which is used as a mask to select areas in which a multivariate search for archaeological site signatures within a TIMS image is most likely to prove fruitful.
Lindgren, A.; Hugelius, G.; Kuhry, P.; Christensen, T.R.; Vandenberghe, J.F.
2016-01-01
This study presents GIS-based estimates of permafrost extent in the northern circumpolar region during the Last Glacial Maximum (LGM), based on a review of previously published maps and compilations of field evidence in the form of ice-wedge pseudomorphs and relict sand wedges. We focus on field
9 CFR 312.3 - Official marks and devices to identify inspected and passed equine products.
2010-01-01
... inspected and passed equine products. 312.3 Section 312.3 Animals and Animal Products FOOD SAFETY AND... § 312.3 Official marks and devices to identify inspected and passed equine products. (a) The official... § 317.2 of this subchapter to identify inspected and passed mule and other (nonhorse) equine carcasses...
Induction of Pluripotency in Adult Equine Fibroblasts without c-MYC
Directory of Open Access Journals (Sweden)
Khodadad Khodadadi
2012-01-01
Full Text Available Despite tremendous efforts on isolation of pluripotent equine embryonic stem (ES cells, to date there are few reports about successful isolation of ESCs and no report of in vivo differentiation of this important companion species. We report the induction of pluripotency in adult equine fibroblasts via retroviral transduction with three transcription factors using OCT4, SOX2, and KLF4 in the absence of c-MYC. The cell lines were maintained beyond 27 passages (more than 11 months and characterized. The equine iPS (EiPS cells stained positive for alkaline phosphatase by histochemical staining and expressed OCT4, NANOG, SSEA1, and SSEA4. Gene expression analysis of the cells showed the expression of OCT4, SOX2 NANOG, and STAT3. The cell lines retained a euploid chromosome count of 64 after long-term culture cryopreservation. The EiPS demonstrated differentiation capacity for the three embryonic germ layers both in vitro by embryoid bodies (EBs formation and in vivo by teratoma formation. In conclusion, we report the derivation of iPS cells from equine adult fibroblasts and long-term maintenance using either of the three reprogramming factors.
A GIS-based extended fuzzy multi-criteria evaluation for landslide susceptibility mapping
Feizizadeh, Bakhtiar; Shadman Roodposhti, Majid; Jankowski, Piotr; Blaschke, Thomas
2014-01-01
Landslide susceptibility mapping (LSM) is making increasing use of GIS-based spatial analysis in combination with multi-criteria evaluation (MCE) methods. We have developed a new multi-criteria decision analysis (MCDA) method for LSM and applied it to the Izeh River basin in south-western Iran. Our method is based on fuzzy membership functions (FMFs) derived from GIS analysis. It makes use of nine causal landslide factors identified by local landslide experts. Fuzzy set theory was first integrated with an analytical hierarchy process (AHP) in order to use pairwise comparisons to compare LSM criteria for ranking purposes. FMFs were then applied in order to determine the criteria weights to be used in the development of a landslide susceptibility map. Finally, a landslide inventory database was used to validate the LSM map by comparing it with known landslides within the study area. Results indicated that the integration of fuzzy set theory with AHP produced significantly improved accuracies and a high level of reliability in the resulting landslide susceptibility map. Approximately 53% of known landslides within our study area fell within zones classified as having “very high susceptibility”, with the further 31% falling into zones classified as having “high susceptibility”. PMID:26089577
Public participatory GIS in community-based disaster risk reduction
Directory of Open Access Journals (Sweden)
Randall B. Kemp
2008-12-01
Introducing PPGIS tools into community-based DRR is not a neutral effort. The information and communication technologies (ICT embedded in GIS can both aid the DRR efforts as well as impact the community in unintended ways. ICTs may be common in communities engaged in DRR efforts so the introduction of PPGIS may have minimal impact. What are the societal ramifications, however, of PPGIS methods in DRR efforts when ICTs are a relatively new aspect of a given community? What are the communication methods pertinent to PPGIS in the DRR context? How does the ICT literature address PPGIS methods? The paper addresses these and other influences of ICT on societies prone to natural hazards.
Khurelbaatar, Nyamdavaa; Krueger, Whitney S; Heil, Gary L; Darmaa, Badarchiin; Ulziimaa, Daramragchaa; Tserennorov, Damdindorj; Baterdene, Ariungerel; Anderson, Benjamin D; Gray, Gregory C
2013-11-01
In recent years, Mongolia has experienced recurrent epizootics of equine influenza virus (EIV) among its 2·1 million horses and multiple incursions of highly pathogenic avian influenza (HPAI) virus via migrating birds. No human EIV or HPAI infections have been reported. In 2009, 439 adults in Mongolia were enrolled in a population-based study of zoonotic influenza transmission. Enrollment sera were examined for serological evidence of infection with nine avian, three human, and one equine influenza virus strains. Seroreactivity was sparse among participants suggesting little human risk of zoonotic influenza infection. © 2013 John Wiley & Sons Ltd.
Feizizadeh, Bakhtiar; Jankowski, Piotr; Blaschke, Thomas
2014-01-01
GIS multicriteria decision analysis (MCDA) techniques are increasingly used in landslide susceptibility mapping for the prediction of future hazards, land use planning, as well as for hazard preparedness. However, the uncertainties associated with MCDA techniques are inevitable and model outcomes are open to multiple types of uncertainty. In this paper, we present a systematic approach to uncertainty and sensitivity analysis. We access the uncertainty of landslide susceptibility maps produced with GIS-MCDA techniques. A new spatially-explicit approach and Dempster–Shafer Theory (DST) are employed to assess the uncertainties associated with two MCDA techniques, namely Analytical Hierarchical Process (AHP) and Ordered Weighted Averaging (OWA) implemented in GIS. The methodology is composed of three different phases. First, weights are computed to express the relative importance of factors (criteria) for landslide susceptibility. Next, the uncertainty and sensitivity of landslide susceptibility is analyzed as a function of weights using Monte Carlo Simulation and Global Sensitivity Analysis. Finally, the results are validated using a landslide inventory database and by applying DST. The comparisons of the obtained landslide susceptibility maps of both MCDA techniques with known landslides show that the AHP outperforms OWA. However, the OWA-generated landslide susceptibility map shows lower uncertainty than the AHP-generated map. The results demonstrate that further improvement in the accuracy of GIS-based MCDA can be achieved by employing an integrated uncertainty–sensitivity analysis approach, in which the uncertainty of landslide susceptibility model is decomposed and attributed to model's criteria weights. PMID:25843987
Feizizadeh, Bakhtiar; Jankowski, Piotr; Blaschke, Thomas
2014-03-01
GIS multicriteria decision analysis (MCDA) techniques are increasingly used in landslide susceptibility mapping for the prediction of future hazards, land use planning, as well as for hazard preparedness. However, the uncertainties associated with MCDA techniques are inevitable and model outcomes are open to multiple types of uncertainty. In this paper, we present a systematic approach to uncertainty and sensitivity analysis. We access the uncertainty of landslide susceptibility maps produced with GIS-MCDA techniques. A new spatially-explicit approach and Dempster-Shafer Theory (DST) are employed to assess the uncertainties associated with two MCDA techniques, namely Analytical Hierarchical Process (AHP) and Ordered Weighted Averaging (OWA) implemented in GIS. The methodology is composed of three different phases. First, weights are computed to express the relative importance of factors (criteria) for landslide susceptibility. Next, the uncertainty and sensitivity of landslide susceptibility is analyzed as a function of weights using Monte Carlo Simulation and Global Sensitivity Analysis. Finally, the results are validated using a landslide inventory database and by applying DST. The comparisons of the obtained landslide susceptibility maps of both MCDA techniques with known landslides show that the AHP outperforms OWA. However, the OWA-generated landslide susceptibility map shows lower uncertainty than the AHP-generated map. The results demonstrate that further improvement in the accuracy of GIS-based MCDA can be achieved by employing an integrated uncertainty-sensitivity analysis approach, in which the uncertainty of landslide susceptibility model is decomposed and attributed to model's criteria weights.
A simplified GIS-based model for large wood recruitment and connectivity in mountain basins
Lucía, Ana; Antonello, Andrea; Campana, Daniela; Cavalli, Marco; Crema, Stefano; Franceschi, Silvia; Marchese, Enrico; Niedrist, Martin; Schneiderbauer, Stefan; Comiti, Francesco
2014-05-01
The mobilization of large wood (LW) elements in mountain rivers channels during floods may increase their hazard potential, especially by clogging narrow sections such as bridges. However, the prediction of LW transport magnitude during flood events is a challenging topic. Although some models on LW transport have been recently developed, the objective of this work was to generate a simplified GIS-based model to identify along the channel network the most likely LW-related critical sections during high-magnitude flood events in forested mountain basins. Potential LW contribution generated by landsliding occurring on hillslopes is assessed using SHALSTAB stability model coupled to a GIS-based connectivity index, developed as a modification of the index proposed by Cavalli et al (2013). Connected slope-derived LW volumes are then summed at each raster cell to LW volumes generated by bank erosion along the erodibile part of river corridors, where bank erosion processes are estimated based on user-defined channel widening ratios stemming from observations following recent extreme events in mountain basins. LW volume in the channel is then routed through the stream network applying simple Boolean rules meant to capture the most important limiting transport condition in these high-energy systems at flood stage, i.e. flow width relative to log length. In addition, the role of bridges and retention check-dams in blocking floating logs is accounted for in the model, in particular bridge length and height are used to characterize their clogging susceptibility for different levels of expected LW volumes and size. The model has been tested in the Rienz and Ahr basins (about 630 km2 each), located in the Eastern Italian Alps. Sixty percent of the basin area is forested, and elevations range from 811 m a.s.l. to 3488 m a.s.l.. We used a 2.5 m resolution DTM and DSM, and their difference was used to calculate the canopy height. Data from 35 plots of the National Forest Inventory
The benefits of GIS to land use planning
Strielko, Irina; Pereira, Paulo
2014-05-01
The development of information technologies has significantly changed the approach to land use and spatial planning, management of natural resources. GIS considerably simplifies territorial planning operating analyzing necessary data concerning their spatial relationship that allows carrying out complex assessment of the situation and creates a basis for adoption of more exact and scientifically reasonable decisions in the course of land use. To assess the current land use situation and the possibility of modeling possible future changes associated with complex of adopted measures GIS allows the integration of diverse spatial data, for example, data about soils, climate, vegetation, and other and also to visualize available information in the form of maps, graphs or charts, 3D models. For the purposes of land use GIS allow using data of remote sensing, which allows to make monitoring of anthropogenic influence in a particular area and estimate scales and rates of degradation of green cover, flora and fauna. Assessment of land use can be made in complex or componentwise, indicating the test sites depending on the goals. GIS make it easy to model spatial distribution of various types of pollution of stationary and mobile sources in soil, atmosphere and the hydrological network. Based on results of the analysis made by GIS choose the optimal solutions of land use that provide the minimum impact on environment, make optimal decisions of conflict associated with land use and control of their using. One of the major advantages of using GIS is possibility of the complex analysis in concrete existential aspect. Analytical opportunities of GIS define conditionality of spatial distribution of objects and interrelation communication between them. For a variety of land management objectives analysis method is chosen based on the parameters of the problem and parameters of use of its results.
Fundamentals of equine podiatry: balanced trimming and physiological shoeing
Estrada, Manuel
2014-01-01
The concepts of balanced trimming and physiological shoeing of the equine hoof as a way to prevent asymmetrical weight bearing and related orthopedic problems are discussed in this paper. Suggestions are given for the technical training of the personnel involved. Considering the quantity and quality of the existing equine herd in Costa Rica, it is recommended to create a Farrier School as well as to coordinate the necessary efforts with other educational institutions related to the animal in...
GIS-based two-dimensional numerical simulation of rainfall-induced debris flow
Directory of Open Access Journals (Sweden)
C. Wang
2008-02-01
Full Text Available This paper aims to present a useful numerical method to simulate the propagation and deposition of debris flow across the three dimensional complex terrain. A depth-averaged two-dimensional numerical model is developed, in which the debris and water mixture is assumed to be continuous, incompressible, unsteady flow. The model is based on the continuity equations and Navier-Stokes equations. Raster grid networks of digital elevation model in GIS provide a uniform grid system to describe complex topography. As the raster grid can be used as the finite difference mesh, the continuity and momentum equations are solved numerically using the finite difference method. The numerical model is applied to simulate the rainfall-induced debris flow occurred in 20 July 2003, in Minamata City of southern Kyushu, Japan. The simulation reproduces the propagation and deposition and the results are in good agreement with the field investigation. The synthesis of numerical method and GIS makes possible the solution of debris flow over a realistic terrain, and can be used to estimate the flow range, and to define potentially hazardous areas for homes and road section.
Environmental applications based on GIS and GRID technologies
Demontis, R.; Lorrai, E.; Marrone, V. A.; Muscas, L.; Spanu, V.; Vacca, A.; Valera, P.
2009-04-01
In the last decades, the collection and use of environmental data has enormously increased in a wide range of applications. Simultaneously, the explosive development of information technology and its ever wider data accessibility have made it possible to store and manipulate huge quantities of data. In this context, the GRID approach is emerging worldwide as a tool allowing to provision a computational task with administratively-distant resources. The aim of this paper is to present three environmental applications (Land Suitability, Desertification Risk Assessment, Georesources and Environmental Geochemistry) foreseen within the AGISGRID (Access and query of a distributed GIS/Database within the GRID infrastructure, http://grida3.crs4.it/enginframe/agisgrid/index.xml) activities of the GRIDA3 (Administrator of sharing resources for data analysis and environmental applications, http://grida3.crs4.it) project. This project, co-funded by the Italian Ministry of research, is based on the use of shared environmental data through GRID technologies and accessible by a WEB interface, aimed at public and private users in the field of environmental management and land use planning. The technologies used for AGISGRID include: - the client-server-middleware iRODS⢠(Integrated Rule-Oriented Data System) (https://irods.org); - the EnginFrame system (http://www.nice-italy.com/main/index.php?id=32), the grid portal that supplies a frame to make available, via Intranet/Internet, the developed GRID applications; - the software GIS GRASS (Geographic Resources Analysis Support System) (http://grass.itc.it); - the relational database PostgreSQL (http://www.posgresql.org) and the spatial database extension PostGis; - the open source multiplatform Mapserver (http://mapserver.gis.umn.edu), used to represent the geospatial data through typical WEB GIS functionalities. Three GRID nodes are directly involved in the applications: the application workflow is implemented at the CRS4 (Pula
GIS-based integrated groundwater potential assessment of Osun ...
African Journals Online (AJOL)
Topographic parameters including surface curvatures, slope and elevation were derived from SPOT DEM and used to generate landform and relief maps for the study area. Spatial Analysis Module of ArcGIS 10.3 software was used to generate lineament proximity, hydrolineament density and drainage density maps for the ...
Characteristics of the Equine Degree Department: Budgeting and the Department Chairperson.
Matte, Grace E.
This study examined characteristics of 73 equine degree programs in the United States, the training and duties of their department chairpersons, and their budgetary processes. Analysis of data from questionnaire responses revealed a large variety of equine degree and minor programs, with annual budgets ranging from $2,000 to $757,200. Public…
Open Source GIS based integrated watershed management
Byrne, J. M.; Lindsay, J.; Berg, A. A.
2013-12-01
Optimal land and water management to address future and current resource stresses and allocation challenges requires the development of state-of-the-art geomatics and hydrological modelling tools. Future hydrological modelling tools should be of high resolution, process based with real-time capability to assess changing resource issues critical to short, medium and long-term enviromental management. The objective here is to merge two renowned, well published resource modeling programs to create an source toolbox for integrated land and water management applications. This work will facilitate a much increased efficiency in land and water resource security, management and planning. Following an 'open-source' philosophy, the tools will be computer platform independent with source code freely available, maximizing knowledge transfer and the global value of the proposed research. The envisioned set of water resource management tools will be housed within 'Whitebox Geospatial Analysis Tools'. Whitebox, is an open-source geographical information system (GIS) developed by Dr. John Lindsay at the University of Guelph. The emphasis of the Whitebox project has been to develop a user-friendly interface for advanced spatial analysis in environmental applications. The plugin architecture of the software is ideal for the tight-integration of spatially distributed models and spatial analysis algorithms such as those contained within the GENESYS suite. Open-source development extends knowledge and technology transfer to a broad range of end-users and builds Canadian capability to address complex resource management problems with better tools and expertise for managers in Canada and around the world. GENESYS (Generate Earth Systems Science input) is an innovative, efficient, high-resolution hydro- and agro-meteorological model for complex terrain watersheds developed under the direction of Dr. James Byrne. GENESYS is an outstanding research and applications tool to address
Marion duPont Scott Equine Medical Center offers new treatment for lameness
Musick, Marjorie
2006-01-01
The Virginia-Maryland Regional College of Veterinary Medicine's Marion duPont Scott Equine Medical Center has begun offering a new therapy for treating lameness associated with osteoarthritis and cartilage damage in horses, a problem that affects all segments of the equine industry.
Characterization of mesenchymal stem cells derived from equine adipose tissue
Directory of Open Access Journals (Sweden)
A.M. Carvalho
2013-08-01
Full Text Available Stem cell therapy has shown promising results in tendinitis and osteoarthritis in equine medicine. The purpose of this work was to characterize the adipose-derived mesenchymal stem cells (AdMSCs in horses through (1 the assessment of the capacity of progenitor cells to perform adipogenic, osteogenic and chondrogenic differentiation; and (2 flow cytometry analysis using the stemness related markers: CD44, CD90, CD105 and MHC Class II. Five mixed-breed horses, aged 2-4 years-old were used to collect adipose tissue from the base of the tail. After isolation and culture of AdMSCs, immunophenotypic characterization was performed through flow cytometry. There was a high expression of CD44, CD90 and CD105, and no expression of MHC Class II markers. The tri-lineage differentiation was confirmed by specific staining: adipogenic (Oil Red O, osteogenic (Alizarin Red, and chondrogenic (Alcian Blue. The equine AdMSCs are a promising type of adult progenitor cell for tissue engineering in veterinary medicine.
URBAN RAIN GAUGE SITING SELECTION BASED ON GIS-MULTICRITERIA ANALYSIS
Directory of Open Access Journals (Sweden)
Y. Fu
2016-06-01
Full Text Available With the increasingly rapid growth of urbanization and climate change, urban rainfall monitoring as well as urban waterlogging has widely been paid attention. In the light of conventional siting selection methods do not take into consideration of geographic surroundings and spatial-temporal scale for the urban rain gauge site selection, this paper primarily aims at finding the appropriate siting selection rules and methods for rain gauge in urban area. Additionally, for optimization gauge location, a spatial decision support system (DSS aided by geographical information system (GIS has been developed. In terms of a series of criteria, the rain gauge optimal site-search problem can be addressed by a multicriteria decision analysis (MCDA. A series of spatial analytical techniques are required for MCDA to identify the prospective sites. With the platform of GIS, using spatial kernel density analysis can reflect the population density; GIS buffer analysis is used to optimize the location with the rain gauge signal transmission character. Experiment results show that the rules and the proposed method are proper for the rain gauge site selection in urban areas, which is significant for the siting selection of urban hydrological facilities and infrastructure, such as water gauge.
International Nuclear Information System (INIS)
Seel, K.
1997-01-01
A GIS model was built to predict the climax vegetation habitat types on reclaimed mine surfaces in the Fort McMurray region of the Mid-Boreal Mixedwood Ecoregion of northwestern Alberta. Regional vegetation habitat types were classified by digital remote sensing using Landsat Thematic Mapper satellite data. Terrain data was derived from a high-resolution digital elevation model. The validated model was applied to the GIS database of Syncrude Canada's Mildred Lake Mine to predict future vegetation patterns based on the final closure mine surface. The results were compared to revegetation and closure plans created by experts to analyze performance and sustainability of reclamation efforts
Lifescience Database Archive (English)
Full Text Available _EEEV8 Non-structural polyprotein OS=Eastern equine encephalitis virus (strain PE-3.0815) PE=2 SV=2 Length =...bjct: 1186 PGPQCTYKADLDLGIPSTIGKYDIIFVNVRTPYKHHH 1222 >sp|Q306W6|POLN_EEEV1 Non-structural polyprotein OS=Eastern equine
UniProt search blastx result: AK289029 [KOME
Lifescience Database Archive (English)
Full Text Available protein 3' (nsP3'); RNA-directed RNA polymerase nsP4 (EC 2.7.7.48) (Non-structural protein 4) (nsP4)] - Eastern equine... encephalitis virus (strain PE-0.0155) (EEEV) (Eastern equine encephalomyelitis virus) 0 ...
UniProt search blastx result: AK289029 [KOME
Lifescience Database Archive (English)
Full Text Available protein 3' (nsP3'); RNA-directed RNA polymerase nsP4 (EC 2.7.7.48) (Non-structural protein 4) (nsP4)] - Eastern equine... encephalitis virus (strain PE-3.0815) (EEEV) (Eastern equine encephalomyelitis virus) 0 ...
Demesouka, O E; Vavatsikos, A P; Anagnostopoulos, K P
2014-04-01
Multicriteria spatial decision support systems (MC-SDSS) have emerged as an integration of the geographical information systems (GIS) and multiple criteria decision analysis (MCDA) methods. GIS-based MCDA allows the incorporation of conflicting objectives and decision maker (DM) preferences into spatial decision models. During recent decades, a variety of research articles have been published regarding the implementation of methods and/or tools in a variety of real-world case studies. The article discusses, in detail, the criteria and methods that are implemented in GIS-based landfill siting suitability analysis and especially the exclusionary and non-exclusionary criteria that can be considered when selecting sites for municipal solid waste (MSW) landfills. This paper reviews 36 seminal articles in which the evaluation of candidate landfill sites is conducted using MCDA methods. After a brief description of the main components of a MC-SDSS and the applied decision rules, the review focuses on the criteria incorporated into the decision models. The review provides a comprehensive guide to the landfill siting analysis criteria, providing details regarding the utilization methods, their decision or exclusionary nature and their monotonicity.
L’analisi spaziale tramite GIS a supporto di filiere agroenergetiche
Directory of Open Access Journals (Sweden)
Flavio Lupia
2008-03-01
Full Text Available GIS spatial analysis in support of agroenergy developmentA feasibility study for an agro-energy district in the Latium region has been carried out using GIS tools to evaluate suitable areas for the cultivation of new energy crops for biofuel. This paper briefly describes the results of the sunflower land suitability analysis. The methodology used is based on crop suitability factors, cultivation constraints and GIS processing.The core processing is based on a multi-criteria analysis. The final result is a crop land suitability map.
Molecular identification of tick-borne hemoparasites in equines from Northwestern Colombia
Directory of Open Access Journals (Sweden)
Yeison Agudelo-Ruíz
2017-05-01
Full Text Available Objetive. To detect and identify Anaplasmataceae agents and piroplasms in equines from the slaughterhouse “La Rinconada” at Rionegro municipality in Antioquia. Materials and Methods. A descriptive cross-sectional study was carried out on equines selected by convenience during a period of 2015. Information about species, sex, age and origin of the animals. Whole blood was collected for DNA extraction procedure, and a PCR targeting a 360bp of Anaplasmataceae 16S ribosomal gene and 450bp of 18S ribosomal gene of Piroplasm were used for detection. PCR amplicons selected were submitted to direct sequencing for identification of hemoparasites through genetic analysis. Results. 135 equine samples from Antioquia, Cordoba y Sucre were analyzed. 78% were horses, 16% were donkeys and 6% were mules. Anaplasmataceae agents were not detected in any sample, meanwhile 13% were positive to piroplasm PCR. Sequence analysis reveals the circulation of Theileria equi in northwestern Colombia. Conclusion. This work presents the first molecular evidence of at least three genotypes of T. equi in equines of northwestern Colombia.
HiGIS: An Open Framework for High Performance Geographic Information System
Directory of Open Access Journals (Sweden)
XIONG, W.
2015-08-01
Full Text Available Big data era expose many challenges to geospatial data management, geocomputation and cartography. There is no exception in geographic information systems (GIS community. Technologies and facilities of high performance computing (HPC become more and more feasible to researchers, while mobile computing, ubiquitous computing, and cloud computing are emerging. But traditional GIS need to be improved to take advantages of all these evolutions. We proposed and implemented a GIS married with high performance computing, which is called HiGIS. The goal of HiGIS is to promote the performance of geocomputation by leveraging the power of HPC, and to build an open framework for geospatial data storing, processing, displaying and sharing. In this paper the architecture, data model and modules of the HiGIS system are introduced. A geocomputation scheduling engine based on communicating sequential process was designed to exploit spatial analysis and processing. Parallel I/O strategy using file view was proposed to improve the performance of geospatial raster data access. In order to support web-based online mapping, an interactive cartographic script was provided to represent a map. A demostration of locating house was used to manifest the characteristics of HiGIS. Parallel and concurrency performance experiments show the feasibility of this system.
Extraction, radioiodination, and in vivo catabolism of equine fibrinogen
International Nuclear Information System (INIS)
Coyne, C.P.; Hornof, W.J.; Kelly, A.B.; O'Brien, T.R.; DeNardo, S.J.
1985-01-01
Equine fibrinogen was isolated and aliquots were stored frozen at -70 C before radiolabeling with 125I (half-life = 60.2 days; gamma = 35 keV, using monochloroiodine reagent. Radioiodination efficiencies were 49% to 53%, resulting in a labeled product with 98% protein-bound activity and 91% clottable radioactivity. In 6 equine in vivo investigations, plasma half-lives of 125I-labeled fibrinogen were from 4.1 to 5.2 days, corresponding to a mean daily plasma elimination rate of approximately 15%
Hartnack, Sonja; Bettschart-Wolfensberger, Regula; Driessen, Bernd; Pang, Daniel; Wohlfender, Franziska
2013-11-01
To provide a brief introduction into Critical Incident Reporting Systems (CIRS) as used in human medicine, and to report the discussion from a recent panel meeting discussion with 23 equine anaesthetists in preparation for a new CEPEF-4 (Confidential Enquiry into Perioperative Equine Fatalities) study. Moderated group discussions, and review of literature. The first group discussion focused on the definition of 'preventable critical incidents' and/or 'near misses' in the context of equine anaesthesia. The second group discussion focused on categorizing critical incidents according to an established framework for analysing risk and safety in clinical medicine. While critical incidents do occur in equine anaesthesia, no critical incident reporting system including systematic collection and analysis of critical incidents is in place. Critical incident reporting systems could be used to improve safety in equine anaesthesia - in addition to other study types such as mortality studies. © 2013 Association of Veterinary Anaesthetists and the American College of Veterinary Anesthesia and Analgesia.
Padalino, B; Raidal, S L; Hall, E; Knight, P; Celi, P; Jeffcott, L; Muscatello, G
2017-07-01
Transportation can affect equine health and is a potential source of economic loss to the industry. To identify journey (duration, vehicle, commercial or noncommercial) and horse (sex, age, breed, use, amateur or professional status) characteristics associated with the development of transport-related health problems in horses. Cross-sectional online survey. An online survey was conducted targeting amateur and professional participants in the Australian equine industry; eligible respondents were required to organise horse movements at least monthly. Respondents provided details of the last case of a transport-related health problem that had affected their horse(s). Associations between type of health problem, journey and horse characteristics were examined with multivariable multinomial regression analysis. Based on 214 responses, health problems were classified as injuries, muscular problems, heat stroke, gastrointestinal and respiratory problems, and death or euthanasia. Respiratory problems were reported most frequently (33.7%), followed by gastrointestinal problems (23.8%) and traumatic injuries (16.3%). The type of health problem was associated with journey duration (Pproblems, and death or euthanasia) were more likely to occur on long journeys. Using Standardbreds as the reference group, Thoroughbreds, Arabians and Warmbloods were more likely to experience a severe illness than an injury. Self-selected participation in the study and the self-reported nature of transport-related problems. Horses undertaking journeys of longer than 24 h are at greater risk for the development of severe disease or death. Further studies on long-haul transportation effects are required to safeguard the welfare of horses moved over long distances. © 2016 EVJ Ltd.
Directory of Open Access Journals (Sweden)
Abdul Salam Soomro
2012-10-01
Full Text Available The terrible tsunami disaster, on 26 December 2004 hit Krabi, one of the ecotourist and very fascinating provinces of southern Thailand including its various regions e.g. Phangna and Phuket by devastating the human lives, coastal communications and the financially viable activities. This research study has been aimed to generate the tsunami hazard preventing based lands use planning model using GIS (Geographical Information Systems based on the hazard suitability analysis approach. The different triggering factors e.g. elevation, proximity to shore line, population density, mangrove, forest, stream and road have been used based on the land use zoning criteria. Those criteria have been used by using Saaty scale of importance one, of the mathematical techniques. This model has been classified according to the land suitability classification. The various techniques of GIS, namely subsetting, spatial analysis, map difference and data conversion have been used. The model has been generated with five categories such as high, moderate, low, very low and not suitable regions illustrating with their appropriate definition for the decision makers to redevelop the region.
Tsunami hazard preventing based land use planing model using GIS technique in Muang Krabi, Thailand
International Nuclear Information System (INIS)
Soormo, A.S.
2012-01-01
The terrible tsunami disaster, on 26 December 2004 hit Krabi, one of the ecotourist and very fascinating provinces of southern Thailand including its various regions e.g. Phangna and Phuket by devastating the human lives, coastal communications and the financially viable activities. This research study has been aimed to generate the tsunami hazard preventing based lands use planning model using GIS (Geographical Information Systems) based on the hazard suitability analysis approach. The different triggering factors e.g. elevation, proximity to shore line, population density, mangrove, forest, stream and road have been used based on the land use zoning criteria. Those criteria have been used by using Saaty scale of importance one, of the mathematical techniques. This model has been classified according to the land suitability classification. The various techniques of GIS, namely subsetting, spatial analysis, map difference and data conversion have been used. The model has been generated with five categories such as high, moderate, low, very low and not suitable regions illustrating with their appropriate definition for the decision makers to redevelop the region. (author)
Object-Based Change Detection Using High-Resolution Remotely Sensed Data and GIS
Sofina, N.; Ehlers, M.
2012-08-01
High resolution remotely sensed images provide current, detailed, and accurate information for large areas of the earth surface which can be used for change detection analyses. Conventional methods of image processing permit detection of changes by comparing remotely sensed multitemporal images. However, for performing a successful analysis it is desirable to take images from the same sensor which should be acquired at the same time of season, at the same time of a day, and - for electro-optical sensors - in cloudless conditions. Thus, a change detection analysis could be problematic especially for sudden catastrophic events. A promising alternative is the use of vector-based maps containing information about the original urban layout which can be related to a single image obtained after the catastrophe. The paper describes a methodology for an object-based search of destroyed buildings as a consequence of a natural or man-made catastrophe (e.g., earthquakes, flooding, civil war). The analysis is based on remotely sensed and vector GIS data. It includes three main steps: (i) generation of features describing the state of buildings; (ii) classification of building conditions; and (iii) data import into a GIS. One of the proposed features is a newly developed 'Detected Part of Contour' (DPC). Additionally, several features based on the analysis of textural information corresponding to the investigated vector objects are calculated. The method is applied to remotely sensed images of areas that have been subjected to an earthquake. The results show the high reliability of the DPC feature as an indicator for change.
Wu, Xiaofang; Jiang, Liushi
2011-02-01
Usually in the traditional science and technology information system, the only text and table form are used to manage the data, and the mathematic statistics method is applied to analyze the data. It lacks for the spatial analysis and management of data. Therefore, GIS technology is introduced to visualize and analyze the information data on science and technology industry. Firstly, by using the developed platform-microsoft visual studio 2005 and ArcGIS Engine, the information visualization system on science and technology industry based on GIS is built up, which implements various functions, such as data storage and management, inquiry, statistics, chart analysis, thematic map representation. It can show the change of science and technology information from the space and time axis intuitively. Then, the data of science and technology in Guangdong province are taken as experimental data and are applied to the system. And by considering the factors of humanities, geography and economics so on, the situation and change tendency of science and technology information of different regions are analyzed and researched, and the corresponding suggestion and method are brought forward in order to provide the auxiliary support for development of science and technology industry in Guangdong province.
Penetration of equine leukocytes by merozoites of Sarcocystis neurona.
Lindsay, David S; Mitchell, Sheila M; Yang, Jibing; Dubey, J P; Gogal, Robert M; Witonsky, Sharon G
2006-06-15
Horses are considered accidental hosts for Sarcocystis neurona and they often develop severe neurological disease when infected with this parasite. Schizont stages develop in the central nervous system (CNS) and cause the neurological lesions associated with equine protozoal myeloencephalitis. The present study was done to examine the ability of S. neurona merozoites to penetrate and develop in equine peripheral blood leukocytes. These infected host cells might serve as a possible transport mechanism into the CNS. S. neurona merozoites penetrated equine leukocytes within 5 min of co-culture. Infected leukocytes were usually monocytes. Infected leukocytes were present up to the final day of examination at 3 days. Up to three merozoites were present in an infected monocyte. No development to schizont stages was observed. All stages observed were in the host cell cytoplasm. We postulate that S. neurona merozoites may cross the blood brain barrier hidden inside leukocytes. Once inside the CNS these merozoites can egress and invade additional cells and cause encephalitis.
Equine-Facilitated Therapy and Trauma: Current Knowledge, Future Needs
Directory of Open Access Journals (Sweden)
Marlys Staudt
2017-09-01
Full Text Available Equine-facilitated therapy (EFT is a relatively new treatment for trauma and PTSD. EFT as well as animal assisted interventions in general have been introduced and implemented in mental health treatment for children and adults, though the research in support of these interventions has not kept up with practice. The purpose of this review is to examine the use of EFT for clients suffering from trauma/PTSD. Studies were included if PTSD/trauma was assessed and/or was measured as an outcome. A search of relevant databases resulted in nine peer-reviewed studies that met criteria. Studies are summarized and implications for future research are discussed. In general, findings suggest that EFT is a promising intervention for trauma/PTSD. Recommendations include a call for more research that includes veterans as well as for research that explicates the mechanisms by which EFT may be effective. Key words: trauma, PTSD, equine, equine therapy
Lifescience Database Archive (English)
Full Text Available L LIM domain-containing protein pin-2 OS=Caen... 30 6.9 sp|Q4QXJ8|POLN_EEEVF Non-structural polyprotein OS=Easter...n equin... 26 8.0 sp|Q306W8|POLN_EEEV8 Non-structural polyprotein OS=Eastern equin... 26 8.0 sp|Q306W6|...POLN_EEEV1 Non-structural polyprotein OS=Eastern equin... 26 8.0 >sp|P43236|CATK_
GIS-based Approach to Estimate Surface Runoff in Small Catchments: A Case Study
Directory of Open Access Journals (Sweden)
Vojtek Matej
2016-09-01
Full Text Available The issue of surface runoff assessment is one of the important and relevant topics of hydrological as well as geographical research. The aim of the paper is therefore to estimate and assess surface runoff on the example of Vyčoma catchment which is located in the Western Slovakia. For this purpose, SCS runoff curve number method, modeling in GIS and remote sensing were used. An important task was the creation of a digital elevation model (DEM, which enters the surface runoff modeling and affects its accuracy. Great attention was paid to the spatial interpretation of land use categories applying aerial imagery from 2013 and hydrological soil groups as well as calculation of maximum daily rainfall with N-year return periods as partial tasks in estimating surface runoff. From the methodological point of view, the importance of the paper can be seen in the use of a simple GIS-based approach to assess the surface runoff conditions in a small catchment.
Research of Ancient Architectures in Jin-Fen Area Based on GIS&BIM Technology
Jia, Jing; Zheng, Qiuhong; Gao, Huiying; Sun, Hai
2017-05-01
The number of well-preserved ancient buildings located in Shanxi Province, enjoying the absolute maximum proportion of ancient architectures in China, is about 18418, among which, 9053 buildings have the structural style of wood frame. The value of the application of BIM (Building Information Modeling) and GIS (Geographic Information System) is gradually probed and testified in the corresponding fields of ancient architecture’s spatial distribution information management, routine maintenance and special conservation & restoration, the evaluation and simulation of related disasters, such as earthquake. The research objects are ancient architectures in JIN-FEN area, which were first investigated by Sicheng LIANG and recorded in his work of “Chinese ancient architectures survey report”. The research objects, i.e. the ancient architectures in Jin-Fen area include those in Sicheng LIANG’s investigation, and further adjustments were made through authors’ on-site investigation and literature searching & collection. During this research process, the spatial distributing Geodatabase of research objects is established utilizing GIS. The BIM components library for ancient buildings is formed combining on-site investigation data and precedent classic works, such as “Yingzao Fashi”, a treatise on architectural methods in Song Dynasty, “Yongle Encyclopedia” and “Gongcheng Zuofa Zeli”, case collections of engineering practice, by the Ministry of Construction of Qing Dynasty. A building of Guangsheng temple in Hongtong county is selected as an example to elaborate the BIM model construction process based on the BIM components library for ancient buildings. Based on the foregoing work results of spatial distribution data, attribute data of features, 3D graphic information and parametric building information model, the information management system for ancient architectures in Jin-Fen Area, utilizing GIS&BIM technology, could be constructed to support the
Testing the Sarcocystis neurona vaccine using an equine protozoal myeloencephalitis challenge model
Equine protozoal myeloencephalitis (EPM) is an important equine neurologic disorder, and treatments for the disease are often unrewarding. Prevention of the disease is the most important aspect for EPM, and a killed vaccine was developed for just that purpose. Evaluation of the vaccine has been hamp...
International Nuclear Information System (INIS)
Elliott Campbell, J.; Moen, Jeremie C.; Ney, Richard A.; Schnoor, Jerald L.
2008-01-01
Estimates of forest soil organic carbon (SOC) have applications in carbon science, soil quality studies, carbon sequestration technologies, and carbon trading. Forest SOC has been modeled using a regression coefficient methodology that applies mean SOC densities (mass/area) to broad forest regions. A higher resolution model is based on an approach that employs a geographic information system (GIS) with soil databases and satellite-derived landcover images. Despite this advancement, the regression approach remains the basis of current state and federal level greenhouse gas inventories. Both approaches are analyzed in detail for Wisconsin forest soils from 1983 to 2001, applying rigorous error-fixing algorithms to soil databases. Resulting SOC stock estimates are 20% larger when determined using the GIS method rather than the regression approach. Average annual rates of increase in SOC stocks are 3.6 and 1.0 million metric tons of carbon per year for the GIS and regression approaches respectively. - Large differences in estimates of soil organic carbon stocks and annual changes in stocks for Wisconsin forestlands indicate a need for validation from forthcoming forest surveys
Application of GIS-based SCS-CN method in West Bank catchments, Palestine
Sameer Shadeed; Mohammad Almasri
2010-01-01
Among the most basic challenges of hydrology are the prediction and quantification of catchment surface runoff. The runoff curve number (CN) is a key factor in determining runoff in the SCS (Soil Conservation Service) based hydrologic modeling method. The traditional SCS-CN method for calculating the composite curve number is very tedious and consumes a major portion of the hydrologic modeling time. Therefore, geographic information systems (GIS) are now being used in combination with the SCS...
International Nuclear Information System (INIS)
Han Shaoyang; Ke Dan; Hou Huiqun
2005-01-01
The weak information extraction is one of the important research contents in the current sandstone-type uranium prospecting in China. This paper introduces the connotation of aeroradiometric weak information extraction, and discusses the formation theories of aeroradiometric weak information extraction, and discusses the formation theories of aeroradiometric weak information and establishes some effective mathematic models for weak information extraction. Models for weak information extraction are realized based on GIS software platform. Application tests of weak information extraction are realized based on GIS software platform. Application tests of weak information extraction are completed in known uranium mineralized areas. Research results prove that the prospective areas of sandstone-type uranium deposits can be rapidly delineated by extracting aeroradiometric weak information. (authors)
Gkatzoflias, Dimitrios; Mellios, Giorgos; Samaras, Zissis
2013-03-01
Combining emission inventory methods and geographic information systems (GIS) remains a key issue for environmental modelling and management purposes. This paper examines the development of a web GIS application as part of an emission inventory system that produces maps and files with spatial allocated emissions in a grid format. The study is not confined in the maps produced but also presents the features and capabilities of a web application that can be used by every user even without any prior knowledge of the GIS field. The development of the application was based on open source software tools such as MapServer for the GIS functions, PostgreSQL and PostGIS for the data management and HTML, PHP and JavaScript as programming languages. In addition, background processes are used in an innovative manner to handle the time consuming and computational costly procedures of the application. Furthermore, a web map service was created to provide maps to other clients such as the Google Maps API v3 that is used as part of the user interface. The output of the application includes maps in vector and raster format, maps with temporal resolution on daily and hourly basis, grid files that can be used by air quality management systems and grid files consistent with the European Monitoring and Evaluation Programme Grid. Although the system was developed and validated for the Republic of Cyprus covering a remarkable wide range of pollutant and emissions sources, it can be easily customized for use in other countries or smaller areas, as long as geospatial and activity data are available.
Ames, D. P.; Osorio-Murillo, C.; Over, M. W.; Rubin, Y.
2012-12-01
The Method of Anchored Distributions (MAD) is an inverse modeling technique that is well-suited for estimation of spatially varying parameter fields using limited observations and Bayesian methods. This presentation will discuss the design, development, and testing of a free software implementation of the MAD technique using the open source DotSpatial geographic information system (GIS) framework, R statistical software, and the MODFLOW groundwater model. This new tool, dubbed MAD-GIS, is built using a modular architecture that supports the integration of external analytical tools and models for key computational processes including a forward model (e.g. MODFLOW, HYDRUS) and geostatistical analysis (e.g. R, GSLIB). The GIS-based graphical user interface provides a relatively simple way for new users of the technique to prepare the spatial domain, to identify observation and anchor points, to perform the MAD analysis using a selected forward model, and to view results. MAD-GIS uses the Managed Extensibility Framework (MEF) provided by the Microsoft .NET programming platform to support integration of different modeling and analytical tools at run-time through a custom "driver." Each driver establishes a connection with external programs through a programming interface, which provides the elements for communicating with core MAD software. This presentation gives an example of adapting the MODFLOW to serve as the external forward model in MAD-GIS for inferring the distribution functions of key MODFLOW parameters. Additional drivers for other models are being developed and it is expected that the open source nature of the project will engender the development of additional model drivers by 3rd party scientists.
Energy Technology Data Exchange (ETDEWEB)
NONE
2000-03-01
The purpose of this survey is to construct a comprehensive coal field assessment technology system which can promptly cope with any natural conditions/geological situations of coal field. As to the GIS (geographical information system) which can unifiedly manage/analyze various data being used in other fields, survey was conducted of present situations/technology trends of the resource related GIS, and at the same time the survey is aimed at applying it to the coal resource field. In the survey in this fiscal year, based on the survey made in FY 1998, applicability of GIS function was verified for Australia where the coal GIS is prepared. And the fundamental design was made to construct a coal GIS considered of concrete application in the stage of coal resource exploration and resource assessment. In the fundamental design, prototypes of individual functions of the system were made. Making the analysis using the actual data, expansion and complication of the system size were advanced step by step toward the completion of the system. Such prototypical development method was adopted. (NEDO)
Gülci, Sercan; Akay, Abdullah Emin
2015-12-01
Major roads cause barrier effect and fragmentation on wildlife habitats that are suitable places for feeding, mating, socializing, and hiding. Due to wildlife collisions (Wc), human-wildlife conflicts result in lost lives and loss of biodiversity. Geographical information system (GIS)-based multi criteria evaluation (MCE) methods have been successfully used in short-term planning of road networks considering wild animals. Recently, wildlife passages have been effectively utilized as road engineering structures provide quick and certain solutions for traffic safety and wildlife conservation problems. GIS-based MCE methods provide decision makers with optimum location for ecological passages based on habitat suitability models (HSMs) that classify the areas based on ecological requirements of target species. In this study, ecological passages along Motorway 52 within forested areas in Mediterranean city of Osmaniye in Turkey were evaluated. Firstly, HSM coupled with nine eco-geographic decision variables were developed based on ecological requirements of roe deer (Capreolus capreolus) that were chosen as target species. Then specified decision variables were evaluated using GIS-based weighted linear combination (WLC) method to estimate movement corridors and mitigation points along the motorway. In the solution process, two linkage nodes were evaluated for eco-passages which were determined based on the least-cost movement corridor intersecting with the motorway. One of the passages was identified as a natural wildlife overpass while the other was suggested as underpass construction. The results indicated that computer-based models provide accurate and quick solutions for positioning ecological passages to reduce environmental effects of road networks on wild animals.
Szcześniak, Katarzyna A; Ciecierska, Anna; Ostaszewski, Piotr; Sadkowski, Tomasz
2016-10-01
β-Hydroxy-β-methylbutyrate (HMB) is a popular ergogenic aid used by human athletes and as a supplement to sport horses, because of its ability to aid muscle recovery, improve performance and body composition. Recent findings suggest that HMB may stimulate satellite cells and affect expressions of genes regulating skeletal muscle cell growth. Despite the scientific data showing benefits of HMB supplementation in horses, no previous study has explained the mechanism of action of HMB in this species. The aim of this study was to reveal the molecular background of HMB action on equine skeletal muscle by investigating the transcriptomic profile changes induced by HMB in equine satellite cells in vitro. Upon isolation from the semitendinosus muscle, equine satellite cells were cultured until the 2nd day of differentiation. Differentiating cells were incubated with HMB for 24 h. Total cellular RNA was isolated, amplified, labelled and hybridised to microarray slides. Microarray data validation was performed with real-time quantitative PCR. HMB induced differential expressions of 361 genes. Functional analysis revealed that the main biological processes influenced by HMB in equine satellite cells were related to muscle organ development, protein metabolism, energy homoeostasis and lipid metabolism. In conclusion, this study demonstrated for the first time that HMB has the potential to influence equine satellite cells by controlling global gene expression. Genes and biological processes targeted by HMB in equine satellite cells may support HMB utility in improving growth and regeneration of equine skeletal muscle; however, the overall role of HMB in horses remains equivocal and requires further proteomic, biochemical and pharmacokinetic studies.
EpiScanGIS: an online geographic surveillance system for meningococcal disease
Directory of Open Access Journals (Sweden)
Albert Jürgen
2008-07-01
Full Text Available Abstract Background Surveillance of infectious diseases increasingly relies on Geographic Information Systems (GIS. The integration of pathogen fine typing data in dynamic systems and visualization of spatio-temporal clusters are a technical challenge for system development. Results An online geographic information system (EpiScanGIS based on open source components has been launched in Germany in May 2006 for real time provision of meningococcal typing data in conjunction with demographic information (age, incidence, population density. Spatio-temporal clusters of disease detected by computer assisted cluster analysis (SaTScan™ are visualized on maps. EpiScanGIS enables dynamic generation of animated maps. The system is based on open source components; its architecture is open for other infectious agents and geographic regions. EpiScanGIS is available at http://www.episcangis.org, and currently has 80 registered users, mostly from the public health service in Germany. At present more than 2,900 cases of invasive meningococcal disease are stored in the database (data as of June 3, 2008. Conclusion EpiScanGIS exemplifies GIS applications and early-warning systems in laboratory surveillance of infectious diseases.
Applications and issues of GIS as tool for civil engineering modeling
Miles, S.B.; Ho, C.L.
1999-01-01
A tool that has proliferated within civil engineering in recent years is geographic information systems (GIS). The goal of a tool is to supplement ability and knowledge that already exists, not to serve as a replacement for that which is lacking. To secure the benefits and avoid misuse of a burgeoning tool, engineers must understand the limitations, alternatives, and context of the tool. The common benefits of using GIS as a supplement to engineering modeling are summarized. Several brief case studies of GIS modeling applications are taken from popular civil engineering literature to demonstrate the wide use and varied implementation of GIS across the discipline. Drawing from the case studies, limitations regarding traditional GIS data models find the implementation of civil engineering models within current GIS are identified and countered by discussing the direction of the next generation of GIS. The paper concludes by highlighting the potential for the misuse of GIS in the context of engineering modeling and suggests that this potential can be reduced through education and awareness. The goal of this paper is to promote awareness of the issues related to GIS-based modeling and to assist in the formulation of questions regarding the application of current GIS. The technology has experienced much publicity of late, with many engineers being perhaps too excited about the usefulness of current GIS. An undoubtedly beneficial side effect of this, however, is that engineers are becoming more aware of GIS and, hopefully, the associated subtleties. Civil engineers must stay informed of GIS issues and progress, but more importantly, civil engineers must inform the GIS community to direct the technology development optimally.
Directory of Open Access Journals (Sweden)
Brittany L. Adams-Pope
2014-12-01
Full Text Available Interesting and innovative youth development programs are important to further youth education. Programs focused on developing leadership skills in youth, specifically at-risk youth, are important when thinking of the future of our communities. The primary purpose of the study was to determine the impact of an equine facilitated, authentic leadership program on at-risk youth. Youth participated in a three-day equine facilitated learning program based on authentic leadership with focus groups conducted three days before and three days after the program. In this article, we describe the development and methodology of the program and specific implications for practice.
Radiographic examination of the equine foot
International Nuclear Information System (INIS)
Park, R.D.
1989-01-01
A complete radiographic examination of the equine foot consists of properly exposed, processed, and positioned radiographs. For radiographic interpretation, in addition to knowing radiographic signs of disease, a knowledge of normal radiographic anatomy and possible insignificant anatomic variations is necessary
New Approaches in Accountancy of the Romanian Equine Growth Sector
Violeta Isai
2015-01-01
The activity of equine growth puts many problems regarding the way of recognition, registration and valuation of equines as biological assets, but also regarding the way of calculation for the auction prices. Taking into consideration the ascendant trend of this sector, and also the diversification of its activities, accountancy faces new situations, which require to be solved in the conditions of the existent International Accounting Standards. In this respect, Romania came with certain impr...
Advances in equine computed tomography and use of contrast media.
Puchalski, Sarah M
2012-12-01
Advances in equine computed tomography have been made as a result of improvements in software and hardware and an increasing body of knowledge. Contrast media can be administered intravascularly or intrathecally. Contrast media is useful to differentiate between tissues of similar density. Equine computed tomography can be used for many different clinical conditions, including lameness diagnosis, fracture identification and characterization, preoperative planning, and characterization of skull diseases. Copyright © 2012 Elsevier Inc. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Klaerle, Martina (ed.)
2012-11-01
The author of the book under consideration reports on the support of renewable energy sources by Geographical Information Systems (GIS) and land management. The first part of this book is addressed to actual land political and planning legal fundamentals of the energy policy turnaround as well as on future developments of the planning instruments. The second part of this book presents GIS based tools and concrete application examples which are very valuable for regional authorities in the implementation of the energy policy turnaround: solar plant cadastre, holistic potential analysis for all forms of renewable energy systems, visibility studies, flexible power grids and so forth.
Programming ArcGIS with Python cookbook
Pimpler, Eric
2015-01-01
Programming ArcGIS with Python Cookbook, Second Edition, is written for GIS professionals who wish to revolutionize their ArcGIS workflow with Python. Whether you are new to ArcGIS or a seasoned professional, you almost certainly spend time each day performing various geoprocessing tasks. This book will teach you how to use the Python programming language to automate these geoprocessing tasks and make you a more efficient and effective GIS professional.
Lifescience Database Archive (English)
Full Text Available ructural polyprotein OS=Eastern equine en... 29 9.9 sp|Q6NVM6|NOL10_XENTR Nucleolar protein 10 OS=Xenopus tr...ct: 166 KVPDDEIQALQQHGHWTVERI-EPLVVPALDA 196 >sp|Q306W7|POLS_EEEV8 Structural polyprotein OS=Eastern equine
Design and Implementation of High-Performance GIS Dynamic Objects Rendering Engine
Zhong, Y.; Wang, S.; Li, R.; Yun, W.; Song, G.
2017-12-01
Spatio-temporal dynamic visualization is more vivid than static visualization. It important to use dynamic visualization techniques to reveal the variation process and trend vividly and comprehensively for the geographical phenomenon. To deal with challenges caused by dynamic visualization of both 2D and 3D spatial dynamic targets, especially for different spatial data types require high-performance GIS dynamic objects rendering engine. The main approach for improving the rendering engine with vast dynamic targets relies on key technologies of high-performance GIS, including memory computing, parallel computing, GPU computing and high-performance algorisms. In this study, high-performance GIS dynamic objects rendering engine is designed and implemented for solving the problem based on hybrid accelerative techniques. The high-performance GIS rendering engine contains GPU computing, OpenGL technology, and high-performance algorism with the advantage of 64-bit memory computing. It processes 2D, 3D dynamic target data efficiently and runs smoothly with vast dynamic target data. The prototype system of high-performance GIS dynamic objects rendering engine is developed based SuperMap GIS iObjects. The experiments are designed for large-scale spatial data visualization, the results showed that the high-performance GIS dynamic objects rendering engine have the advantage of high performance. Rendering two-dimensional and three-dimensional dynamic objects achieve 20 times faster on GPU than on CPU.
Quantum GIS: il desktop GIS più potente, amichevole e libero
Directory of Open Access Journals (Sweden)
Otto Dassau
2009-03-01
Full Text Available QuantumGIS is a free and open source GISIt has an intuitive graphical interface, suitable also for first time GIS users, and thanks to the integration with other free software (e.g. GRASS, PostGIS, GDAL can read dozens of different formats, both raster and vector, link to OGC standard web services (WMS, WFS, SF and run complex analysis and modeling. Many plugins make it easy to extend its functionality. It is used throughout the world, by thousands of users, and its development is fast, with new functions continuously added.
Kinesio Taping Fundamentals for the Equine Athlete.
Molle, Sybille
2016-04-01
The Kinesio taping method was developed in Japan for use in humans in 1979. The use of complementary therapies is becoming common in equine athletes and the discovery of Kinesio taping potential brought it into the animal world. Kinesio taping can be used to treat a wide range of clinical conditions, from tendon injuries to neurologic disorders and from muscle contractures to postural insufficiencies. Its use in veterinary medicine is promising, but relies heavily on evidence-based clinical reports. Further scientific research is needed to fully understand the real effectiveness of application. Copyright © 2016 Elsevier Inc. All rights reserved.
EPIDEMIOLOGICAL STUDY ON THE PREVALENCE OF ENDOPARASITES OF EQUINES IN ALBANIA
Directory of Open Access Journals (Sweden)
Rezart Postoli
2013-03-01
Full Text Available The objective of the study was to investigate the prevalence of parasites in equines in Albania, where there is still a considerable number of working equines, particularly the donkeys. A total of 336 (68 horses, 190 donkeys and 78 mules faecal samples were tested using standard coprological methods. The results showed that an average of about 47.8% of animals used to obtain faecal samples, were infected with one or more parasitic elements. In particular, amongst the examined equines, 60.3% of the horses, 44.2% of the donkeys and 46.2% of the mules were infected. Strongylus spp. was found in 47.3%, Anoplocephala spp. in 3.8%, Dictyocaulus arnfieldi in 7.6% and Parascaris equorum in 1.9% of the animals. Strongyles were significantly more prevalent between October and December compared to the rest of the year. Examination of larval cultures according to geographical distribution, showed that 41%, 43% and 44% of individuals were found positive for small strongyles. A total of 11 (8.9, 15 (16.9 and 19 (15.3 individuals according to above geographical distribution were found infected with Strongylus vulgaris.Key words: equine, epidemiology, strongyles, blood parasites, serology
Angier, Heather; Likumahuwa, Sonja; Finnegan, Sean; Vakarcs, Trisha; Nelson, Christine; Bazemore, Andrew; Carrozza, Mark; DeVoe, Jennifer E
2014-01-01
Our practice-based research network (PBRN) is conducting an outreach intervention to increase health insurance coverage for patients seen in the network. To assist with outreach site selection, we sought an understandable way to use electronic health record (EHR) data to locate uninsured patients. Health insurance information was displayed within a web-based mapping platform to demonstrate the feasibility of using geographic information systems (GIS) to visualize EHR data. This study used EHR data from 52 clinics in the OCHIN PBRN. We included cross-sectional coverage data for patients aged 0 to 64 years with at least 1 visit to a study clinic during 2011 (n = 228,284). Our PBRN was successful in using GIS to identify intervention sites. Through use of the maps, we found geographic variation in insurance rates of patients seeking care in OCHIN PBRN clinics. Insurance rates also varied by age: The percentage of adults without insurance ranged from 13.2% to 86.8%; rates of children lacking insurance ranged from 1.1% to 71.7%. GIS also showed some areas of households with median incomes that had low insurance rates. EHR data can be imported into a web-based GIS mapping tool to visualize patient information. Using EHR data, we were able to observe smaller areas than could be seen using only publicly available data. Using this information, we identified appropriate OCHIN PBRN clinics for dissemination of an EHR-based insurance outreach intervention. GIS could also be used by clinics to visualize other patient-level characteristics to target clinic outreach efforts or interventions. © Copyright 2014 by the American Board of Family Medicine.
A paper-based scaffold for enhanced osteogenic differentiation of equine adipose-derived stem cells.
Petersen, Gayle F; Hilbert, Bryan J; Trope, Gareth D; Kalle, Wouter H J; Strappe, Padraig M
2015-11-01
We investigated the applicability of single layer paper-based scaffolds for the three-dimensional (3D) growth and osteogenic differentiation of equine adipose-derived stem cells (EADSC), with comparison against conventional two-dimensional (2D) culture on polystyrene tissue culture vessels. Viable culture of EADSC was achieved using paper-based scaffolds, with EADSC grown and differentiated in 3D culture retaining high cell viability (>94 %), similarly to EADSC in 2D culture. Osteogenic differentiation of EADSC was significantly enhanced in 3D culture, with Alizarin Red S staining and quantification demonstrating increased mineralisation (p < 0.0001), and an associated increase in expression of the osteogenic-specific markers alkaline phosphatase (p < 0.0001), osteopontin (p < 0.0001), and runx2 (p < 0.01). Furthermore, scanning electron microscopy revealed a spherical morphology of EADSC in 3D culture, compared to a flat morphology of EADSC in 2D culture. Single layer paper-based scaffolds provide an enhanced environment for the in vitro 3D growth and osteogenic differentiation of EADSC, with high cell viability, and a spherical morphology.
Directory of Open Access Journals (Sweden)
M. Ghadiry
2012-06-01
Full Text Available The movements of the sand dunes are considered as a threat for roads, irrigation networks, water resources, urban areas, agriculture and infrastructures. The main objectives of this study are to develop a new GIS-based model for automated extraction of sand dune encroachment using remote sensing data and to assess the rate of sand dune movement. To monitor and assess the movements of sand dunes in Dakhla oases area, multi-temporal satellite images and a GIS-developed model, using Python script in Arc GIS, were used. The satellite images (SPOT images, 1995 and 2007 were geo-rectified using Erdas Imagine. Image subtraction was performed using spatial analyst in Arc GIS, the result of image subtraction obtains the sand dune movement between the two dates. The raster and vector shape of sand dune migration was automatically extracted using spatial analyst tools. The frontiers of individual dunes were measured at different dates and movement rates were analyzed in GIS. The ModelBuilder in Arc GIS was used in order to create a user friendly tool. The custom built model window is easy to handle by any user who wishes to adapt the model in his work. It was found that the rate of sand dune movement ranged between 3 and 9 m per year. The majority of sand dunes have a rate movement between 0 and 6 m and very few dunes had a movement rate between 6 and 9 m. Integrating remote sensing and GIS provided the necessary information for determining the minimum, maximum, mean, rate and area of sand dune migration.
DEFF Research Database (Denmark)
Winstrup, Mie; Levin, Gregor
2011-01-01
Fragmentering af naturen er en trussel mod biodiversiteten, og etablering af økologiske forbindelser/korridorer mellem naturområderne er én måde hvorved nedgangen i biodiversitet kan stoppes. Med Næstved Kommune som case-område har jeg undersøgt, hvordan analyser i GIS kan bruges til at udvælge...... omdannet til reelle korridorer, hvor bredden afhænger af arealdækket som forbindelserne krydser. I implementerings øjemed er det anvendeligt at vide om nogle forbindelser er særlig vigtige for at skabe mere sammenhængende natur. GIS er anvendeligt hertil, idet GIS kan bruges til at bestemme den enkelte...
Directory of Open Access Journals (Sweden)
Kopke Susan
2012-09-01
Full Text Available Abstract Background Recent studies reported on the very complex morphology of the pulp system in equine cheek teeth. The continuous production of secondary dentine leads to distinct age-related changes of the endodontic cavity. Detailed anatomical knowledge of the dental cavities in all ages is required to explain the aetiopathology of typical equine endodontic diseases. Furthermore, data on mandibular and maxillary pulp systems is in high demand to provide a basis for the development of endodontic therapies. However, until now examination of the pulp cavity has been based on either sectioned teeth or clinical computed tomography. More precise results were expected by using micro-computed tomography with a resolution of about 0.1 mm and three-dimensional reconstructions based on previous greyscale analyses and histological verification. The aim of the present study was to describe the physiological configurations of the pulp system within a wide spectrum of tooth ages. Results Maxillary teeth: All morphological constituents of the endodontic cavity were present in teeth between 4 and 16 years: Triadan 06s displayed six pulp horns and five root canals, Triadan 07-10s five pulp horns and four root canals and Triadan 11s seven pulp horns and four to six root canals. A common pulp chamber was most frequent in teeth ≤5 years, but was found even in a tooth of 9 years. A large variety of pulp configurations was observed within 2.5 and 16 years post eruption, but most commonly a separation into mesial and distal pulp compartments was seen. Maxillary cheek teeth showed up to four separate pulp compartments but the frequency of two, three and four pulp compartments was not related to tooth age (P > 0.05. In Triadan 06s, pulp horn 6 was always connected to pulp horns 1 and 3 and root canal I. In Triadan 11s, pulp horns 7 and 8 were present in variable constitutions. Mandibular teeth: A common pulp chamber was present in teeth up to 15 years, but most
International Nuclear Information System (INIS)
Peters, L.M.; Demmel, S.; Pusch, G.; Buters, J.T.M.; Thormann, W.; Zielinski, J.; Leeb, T.; Mevissen, M.; Schmitz, A.
2013-01-01
Ketamine is an anesthetic and analgesic regularly used in veterinary patients. As ketamine is almost always administered in combination with other drugs, interactions between ketamine and other drugs bear the risk of either adverse effects or diminished efficacy. Since cytochrome P450 enzymes (CYPs) play a pivotal role in the phase I metabolism of the majority of all marketed drugs, drug–drug interactions often occur at the active site of these enzymes. CYPs have been thoroughly examined in humans and laboratory animals, but little is known about equine CYPs. The characterization of equine CYPs is essential for a better understanding of drug metabolism in horses. We report annotation, cloning and heterologous expression of the equine CYP2B6 in V79 Chinese hamster fibroblasts. After computational annotation of all CYP2B genes, the coding sequence (CDS) of equine CYP2B6 was amplified by RT-PCR from horse liver total RNA and revealed an amino acid sequence identity of 77% and a similarity of 93.7% to its human ortholog. A non-synonymous variant c.226G>A in exon 2 of the equine CYP2B6 was detected in 97 horses. The mutant A-allele showed an allele frequency of 82%. Two further variants in exon 3 were detected in one and two horses of this group, respectively. Transfected V79 cells were incubated with racemic ketamine and norketamine as probe substrates to determine metabolic activity. The recombinant equine CYP2B6 N-demethylated ketamine to norketamine and produced metabolites of norketamine, such as hydroxylated norketamines and 5,6-dehydronorketamine. V max for S-/and R-norketamine formation was 0.49 and 0.45 nmol/h/mg cellular protein and K m was 3.41 and 2.66 μM, respectively. The N-demethylation of S-/R-ketamine was inhibited concentration-dependently with clopidogrel showing an IC 50 of 5.63 and 6.26 μM, respectively. The functional importance of the recorded genetic variants remains to be explored. Equine CYP2B6 was determined to be a CYP enzyme involved in
Energy Technology Data Exchange (ETDEWEB)
Peters, L.M.; Demmel, S. [Division Veterinary Pharmacology and Toxicology, Vetsuisse Faculty, University Bern, Laenggassstr. 124, 3012 Bern (Switzerland); Pusch, G.; Buters, J.T.M. [ZAUM — Center of Allergy and Environment, Helmholtz Zentrum München/Technische Universität München, Biedersteiner Str. 29, 80802 München (Germany); Thormann, W. [Clinical Pharmacology Laboratory, Institute for Infectious Diseases, University of Bern, Murtenstrasse 35, 3010 Bern (Switzerland); Zielinski, J. [Division Veterinary Pharmacology and Toxicology, Vetsuisse Faculty, University Bern, Laenggassstr. 124, 3012 Bern (Switzerland); Leeb, T. [Institute of Genetics, Vetsuisse Faculty, University Bern, Bremgartenstr. 109, 3012 Bern (Switzerland); Mevissen, M. [Division Veterinary Pharmacology and Toxicology, Vetsuisse Faculty, University Bern, Laenggassstr. 124, 3012 Bern (Switzerland); Schmitz, A., E-mail: andrea.schmitz@vetsuisse.unibe.ch [Division Veterinary Pharmacology and Toxicology, Vetsuisse Faculty, University Bern, Laenggassstr. 124, 3012 Bern (Switzerland)
2013-01-01
Ketamine is an anesthetic and analgesic regularly used in veterinary patients. As ketamine is almost always administered in combination with other drugs, interactions between ketamine and other drugs bear the risk of either adverse effects or diminished efficacy. Since cytochrome P450 enzymes (CYPs) play a pivotal role in the phase I metabolism of the majority of all marketed drugs, drug–drug interactions often occur at the active site of these enzymes. CYPs have been thoroughly examined in humans and laboratory animals, but little is known about equine CYPs. The characterization of equine CYPs is essential for a better understanding of drug metabolism in horses. We report annotation, cloning and heterologous expression of the equine CYP2B6 in V79 Chinese hamster fibroblasts. After computational annotation of all CYP2B genes, the coding sequence (CDS) of equine CYP2B6 was amplified by RT-PCR from horse liver total RNA and revealed an amino acid sequence identity of 77% and a similarity of 93.7% to its human ortholog. A non-synonymous variant c.226G>A in exon 2 of the equine CYP2B6 was detected in 97 horses. The mutant A-allele showed an allele frequency of 82%. Two further variants in exon 3 were detected in one and two horses of this group, respectively. Transfected V79 cells were incubated with racemic ketamine and norketamine as probe substrates to determine metabolic activity. The recombinant equine CYP2B6 N-demethylated ketamine to norketamine and produced metabolites of norketamine, such as hydroxylated norketamines and 5,6-dehydronorketamine. V{sub max} for S-/and R-norketamine formation was 0.49 and 0.45 nmol/h/mg cellular protein and K{sub m} was 3.41 and 2.66 μM, respectively. The N-demethylation of S-/R-ketamine was inhibited concentration-dependently with clopidogrel showing an IC{sub 50} of 5.63 and 6.26 μM, respectively. The functional importance of the recorded genetic variants remains to be explored. Equine CYP2B6 was determined to be a CYP
Advanced three-dimensional culture of equine intestinal epithelial stem cells.
Stewart, A Stieler; Freund, J M; Gonzalez, L M
2018-03-01
Intestinal epithelial stem cells are critical to epithelial repair following gastrointestinal injury. The culture of intestinal stem cells has quickly become a cornerstone of a vast number of new research endeavours that range from determining tissue viability to testing drug efficacy for humans. This study aims to describe the methods of equine stem cell culture and highlights the future benefits of these techniques for the advancement of equine medicine. To describe the isolation and culture of small intestinal stem cells into three-dimensional (3D) enteroids in horses without clinical gastrointestinal abnormalities. Descriptive study. Intestinal samples were collected by sharp dissection immediately after euthanasia. Intestinal crypts containing intestinal stem cells were dissociated from the underlying tissue layers, plated in a 3D matrix and supplemented with growth factors. After several days, resultant 3D enteroids were prepared for immunofluorescent imaging and polymerase chain reaction (PCR) analysis to detect and characterise specific cell types present. Intestinal crypts were cryopreserved immediately following collection and viability assessed. Intestinal crypts were successfully cultured and matured into 3D enteroids containing a lumen and budding structures. Immunofluorescence and PCR were used to confirm the existence of stem cells and all post mitotic, mature cell types, described to exist in the horse intestinal epithelium. Previously frozen crypts were successfully cultured following a freeze-thaw cycle. Tissues were all derived from normal horses. Application of this technique for the study of specific disease was not performed at this time. The successful culture of equine intestinal crypts into 3D "mini-guts" allows for in vitro studies of the equine intestine. Additionally, these results have relevance to future development of novel therapies that harness the regenerative potential of equine intestine in horses with gastrointestinal disease
Microbial quality of equine frozen semen.
Corona, A; Cherchi, R
2009-10-01
Bacteriological surveillance is little applied in management of equine frozen semen but it is quite important to verify the microbial contamination in order to find out the chance of transmission of pathology to the mare in AI. Authors describe a qualitative and quantitative analysis for bacterial contamination on long time (3-17 years) equine frozen semen stored in liquid nitrogen. The semen checked, produced in Italy and in another Europe country, was cryopreserved in liquid nitrogen inside sealed plastic straws. One hundred and ten straws were checked out for pathogenic and no pathogenic bacteria, aerobes and anaerobes and fungi (moulds and yeasts). The Total Microbial Charge was quite variable with an average of about 1.4 x 10(5)CFU/ml. Mostly the microbial agents identified were fungi (17.5%), Enterobacter-coccus spp. (15%), Pseudomonas spp. (6.25%), Stenothophomonas maltophila (6.25%) and anaerobic bacteria like Propionibacterium granulosum (7.5%) and Clostridium spp. (3.75%). 3.75% were unidentified Gram-negative rod and cocci. Streptococcus spp., Staph. aureus, E. coli, Th. equigenitalis and Mycoplasma spp. were not detected. The most represented species were Enterobacter-coccus spp. (1.1 x 10(5)CFU/ml), St. maltophila (8 x 10(4)CFU/ml) and Pr. granulosum (7 x 10(4)CFU/ml) while yeast and even more moulds were little abundant (4.7 x 10(4) and 3.4 x 10(4)CFU/ml respectively). The knowledge of equine frozen semen microbial quality is essential to check out transmission of venereal disease and improve the quality of cryopreserved germplasm.
Effect of calcium, bicarbonate, and albumin on capacitation-related events in equine sperm.
Macías-García, B; González-Fernández, L; Loux, S C; Rocha, A M; Guimarães, T; Peña, F J; Varner, D D; Hinrichs, K
2015-01-01
Repeatable methods for IVF have not been established in the horse, reflecting the failure of standard capacitating media to induce changes required for fertilization capacity in equine sperm. One important step in capacitation is membrane cholesterol efflux, which in other species is triggered by cholesterol oxidation and is typically enhanced using albumin as a sterol acceptor. We incubated equine sperm in the presence of calcium, BSA, and bicarbonate, alone or in combination. Bicarbonate induced an increase in reactive oxygen species (ROS) that was abolished by the addition of calcium or BSA. Bicarbonate induced protein tyrosine phosphorylation (PY), even in the presence of calcium or BSA. Incubation at high pH enhanced PY but did not increase ROS production. Notably, no combination of these factors was associated with significant cholesterol efflux, as assessed by fluorescent quantitative cholesterol assay and confirmed by filipin staining. By contrast, sperm treated with methyl-β-cyclodextrin showed a significant reduction in cholesterol levels, but no significant increase in PY or ROS. Presence of BSA increased sperm binding to bovine zonae pellucidae in all three stallions. These results show that presence of serum albumin is not associated with a reduction in membrane cholesterol levels in equine sperm, highlighting the failure of equine sperm to exhibit core capacitation-related changes in a standard capacitating medium. These data indicate an atypical relationship among cholesterol efflux, ROS production, and PY in equine sperm. Our findings may help to elucidate factors affecting failure of equine IVF under standard conditions. © 2015 Society for Reproduction and Fertility.
Polymorphism at Expressed DQ and DR Loci in Five Common Equine MHC Haplotypes
Miller, Donald; Tallmadge, Rebecca L.; Binns, Matthew; Zhu, Baoli; Mohamoud, Yasmin Ali; Ahmed, Ayeda; Brooks, Samantha A.; Antczak, Douglas F.
2016-01-01
The polymorphism of Major Histocompatibility Complex (MHC) class II DQ and DR genes in five common Equine Leukocyte Antigen (ELA) haplotypes was determined through sequencing of mRNA transcripts isolated from lymphocytes of eight ELA homozygous horses. Ten expressed MHC class II genes were detected in horses of the ELA-A3 haplotype carried by the donor horses of the equine Bacterial Artificial Chromosome (BAC) library and the reference genome sequence: four DR genes and six DQ genes. The other four ELA haplotypes contained at least eight expressed polymorphic MHC class II loci. Next Generation Sequencing (NGS) of genomic DNA of these four MHC haplotypes revealed stop codons in the DQA3 gene in the ELA-A2, ELA-A5, and ELA-A9 haplotypes. Few NGS reads were obtained for the other MHC class II genes that were not amplified in these horses. The amino acid sequences across haplotypes contained locus-specific residues, and the locus clusters produced by phylogenetic analysis were well supported. The MHC class II alleles within the five tested haplotypes were largely non-overlapping between haplotypes. The complement of equine MHC class II DQ and DR genes appears to be well conserved between haplotypes, in contrast to the recently described variation in class I gene loci between equine MHC haplotypes. The identification of allelic series of equine MHC class II loci will aid comparative studies of mammalian MHC conservation and evolution and may also help to interpret associations between the equine MHC class II region and diseases of the horse. PMID:27889800
Trends in GIS: an environmental perspective
International Nuclear Information System (INIS)
Ringrose, S.
1992-01-01
Trends in the Geographic Information System (GIS) have long been difficult to assess comprehensively because of the different perspective of the large number of players in the GIS game. This work represents an overview intended as background to the Workshop Proceedings. As the term GIS means different things to different people the intent is to start with definitions followed by a discussion of data models and inherent functionality of GIS systems. Recent trends are also considered in the context of environmental analyses. Problems arise when considering environmental monitoring due to the paucity of explicit functions dealing with change detection through time. Here parallels are drawn with recent studies which have used the integration of GIS and remotely sensed data. Reasons behind the functional limitations of GIS because apparent as the historical evolution of present day GIS systems is considered, although to some extent these are mitigated by future trends. Finally consideration is given to the role of GIS in assisting with mine site development and especially mine site rehabilitation. 23 refs
Directory of Open Access Journals (Sweden)
El Fahchouch A. N.
2018-01-01
Full Text Available The evaluation of the degree of susceptibility to landslides has become a major concern in mountainous areas, it is a key component of manager policies efforts in disaster prevention, mitigate risk and manage the consequences. The region of Al Hoceima is one of most mountain regions in Morocco, and is highly exposed landslides events. For this reason, the area was selected in order to determine its susceptibility to landslides using two methods. The purpose of this study is to evaluate and to compare the results of multivariate (logical regression and bivariate (landslide susceptibility methods in Geographical Information System (GIS based landslide susceptibility assessment procedures. In order to achieve this goal, the selected methods were compared by the Seed Cell Area Indexes (SCAI and by the spatial locations of the resultant susceptibility pixels. We found that both of the methods converge in 80% of the area; however, the weighting algorithm in the bivariate technique (landslide susceptibility method had some severe deficiencies, as the resultant hazard classes in overweighed areas did not converge with the factual landslide inventory map. The result of the multivariate technique (logical regression was more sensitive to the different local features of the test zone and it resulted in more accurate and homogeneous susceptibility maps. This information may have direct applications in landslides susceptibility research programs and can assist decision-makers in the implementation of preventive management strategies in the most sensitive areas.
GIS/RS-based Rapid Reassessment for Slope Land Capability Classification
Chang, T. Y.; Chompuchan, C.
2014-12-01
Farmland resources in Taiwan are limited because about 73% is mountainous and slope land. Moreover, the rapid urbanization and dense population resulted in the highly developed flat area. Therefore, the utilization of slope land for agriculture is more needed. In 1976, "Slope Land Conservation and Utilization Act" was promulgated to regulate the slope land utilization. Consequently, slope land capability was categorized into Class I-IV according to 4 criteria, i.e., average land slope, effective soil depth, degree of soil erosion, and parent rock. The slope land capability Class I-VI are suitable for cultivation and pasture. Whereas, Class V should be used for forestry purpose and Class VI should be the conservation land which requires intensive conservation practices. The field survey was conducted to categorize each land unit as the classification scheme. The landowners may not allow to overuse land capability limitation. In the last decade, typhoons and landslides frequently devastated in Taiwan. The rapid post-disaster reassessment of the slope land capability classification is necessary. However, the large-scale disaster on slope land is the constraint of field investigation. This study focused on using satellite remote sensing and GIS as the rapid re-evaluation method. Chenyulan watershed in Nantou County, Taiwan was selected to be a case study area. Grid-based slope derivation, topographic wetness index (TWI) and USLE soil loss calculation were used to classify slope land capability. The results showed that GIS-based classification give an overall accuracy of 68.32%. In addition, the post-disaster areas of Typhoon Morakot in 2009, which interpreted by SPOT satellite imageries, were suggested to classify as the conservation lands. These tools perform better in the large coverage post-disaster update for slope land capability classification and reduce time-consuming, manpower and material resources to the field investigation.
GIS-based poverty and population distribution analysis in China
Cui, Jing; Wang, Yingjie; Yan, Hong
2009-07-01
Geographically, poverty status is not only related with social-economic factors but also strongly affected by geographical environment. In the paper, GIS-based poverty and population distribution analysis method is introduced for revealing their regional differences. More than 100000 poor villages and 592 national key poor counties are chosen for the analysis. The results show that poverty distribution tends to concentrate in most of west China and mountainous rural areas of mid China. Furthermore, the fifth census data are overlaid to those poor areas in order to gain its internal diversity of social-economic characteristics. By overlaying poverty related social-economic parameters, such as sex ratio, illiteracy, education level, percentage of ethnic minorities, family composition, finding shows that poverty distribution is strongly correlated with high illiteracy rate, high percentage minorities, and larger family member.
The Architecture of a Complex GIS & Spreadsheet Based DSS
Directory of Open Access Journals (Sweden)
Dinu Airinei
2010-01-01
Full Text Available The decision support applications available on today market use to combine the decision analysis of historical databased on On-Line Analytical Processing (OLAP products or spreadsheet pivot tables with some new reporting facilities as alerts or key performance indicators available in portal dashboards or in complex spreadsheet-like reports, both corresponding to a new approach of the field called Business Intelligence. Moreover the geographical features of GIS added to DSS applications become more and more required by many kinds of businesses. In fact they are more useful this way than as distinctive parts.The paper tries to present a certain DSS architecture based on the association between such approaches and technologies. The particular examples are meant to support all the theoretical arguments and to complete the understanding of the interaction schemas available.
Using Multi-criteria Evaluation and GIS for Flood Risk Analysis in ...
African Journals Online (AJOL)
New Win User
were then mapped in the GIS to show the spatial disparities in risk. ..... Ayalew, L. & Yamagishi, H 2005, 'The application of GIS-based logistic regression for landslide .... Saaty, TL 1980, The analytic hierarchy process, Mcgraw-Hill, New York.
The Project-Approach to GIS as an Integrative Classroom Technology: An Environmental Case Study.
Gatrell, Jay D.; Oshiro, Kenji K.
2001-01-01
Explains how Geographic Information Systems (GIS) influences geography curricula and how project-based learning can be applied to GIS experiences. Introduces a project investigating non-geography college students' design and implementation of a environmental GIS application. (Contains 16 references.) (YDS)
From BIM to GIS at the Smithsonian Institution
Günther-Diringer, Detlef
2018-05-01
BIM-files (Building Information Models) are in modern architecture and building management a basic prerequisite for successful creation of construction engineering projects. At the facilities department of the Smithsonian Institution more than six hundred buildings were maintained. All facilities were digital available in an ESRI ArcGIS-environment with connection to the database information about single rooms with the usage and further maintenance information. These data are organization wide available by an intranet viewer, but only in a two-dimensional representation. Goal of the carried out project was the development of a workflow from available BIM-models to the given GIS-structure. The test-environment were the BIM-models of the buildings of the Smithsonian museums along the Washington Mall. Based on new software editions of Autodesk Revit, FME and ArcGIS Pro the workflow from BIM to the GIS-data structure of the Smithsonian was successfully developed and may be applied for the setup of the future 3D intranet viewer.
GIS-based biomass resource utilization for rice straw cofiring in the Taiwanese power market
International Nuclear Information System (INIS)
Hu, Ming-Che; Huang, An-Lei; Wen, Tzai-Hung
2013-01-01
Rice straw, a rich agricultural byproduct in Taiwan, can be used as biomass feedstock for cofiring systems. In this study, we analyzed the penetration of rice straw cofiring systems in the Taiwanese power market. In the power generation system, rice straw is cofired with fossil fuel in existing electricity plants. The benefits of cofiring systems include increasing the use of renewable energy, decreasing the fuel cost, and lowering greenhouse gas emissions. We established a linear complementarity model to simulate the power market equilibrium with cofiring systems in Taiwan. GIS-based analysis was then used to analyze the geospatial relationships between paddy rice farms and power plants to assess potential biomass for straw-power generation. Additionally, a sensitivity analysis of the biomass feedstock supply system was conducted for various cofiring scenarios. The spatial maps and equilibrium results of rice straw cofiring in Taiwanese power market are presented in the paper. - Highlights: ► The penetration of straw cofiring systems in the power market is analyzed. ► GIS-based analysis assesses potential straw-power generation. ► The spatial maps and equilibrium results of rice straw cofiring are presented
SAGA GIS based processing of spatial high resolution temperature data
International Nuclear Information System (INIS)
Gerlitz, Lars; Bechtel, Benjamin; Kawohl, Tobias; Boehner, Juergen; Zaksek, Klemen
2013-01-01
Many climate change impact studies require surface and near surface temperature data with high spatial and temporal resolution. The resolution of state of the art climate models and remote sensing data is often by far to coarse to represent the meso- and microscale distinctions of temperatures. This is particularly the case for regions with a huge variability of topoclimates, such as mountainous or urban areas. Statistical downscaling techniques are promising methods to refine gridded temperature data with limited spatial resolution, particularly due to their low demand for computer capacity. This paper presents two downscaling approaches - one for climate model output and one for remote sensing data. Both are methodically based on the FOSS-GIS platform SAGA. (orig.)
Managing the GPS/GIS function in an electric utility
International Nuclear Information System (INIS)
Michelsen, M.W. Jr.
1999-01-01
A new period of higher significance has arrived for the GPS/GIS function at electric utilities such that to a degree never seen before, utility managers are looking to their GIS programs, filled with increasingly accurate data collected by GPS technology, before making many decisions. With this capability comes an expectation for GPS/GIS professionals to provide higher levels of planning and management of their data collection process. At Duke Power in Charlotte, North Carolina, managers rely on GPS mapping to fill their data collection equipment needs. When the city of Charlotte requested a more detailed billing system, Duke Power co-sponsored the street lighting inventory project, a comprehensive program implemented to fully account for street lighting facilities within the billing area. One of the key projects to be kept in mind was the creation of a common data base viewable by GIS from which a bill could be created and as well reveal data. A billing calculation routine can be run against the data base to generate a bill or use MapInfo to see a graphical picture. Prior to the creation of this data base capability, the difference between the data base as a display tool and billing system was a potential source of discrepancy, which is eliminated now. Creating the data base allows more than just creating a bill for the city, it allows Duke Power to work better with the city by improving its billing accountability and provides better service as well
Lost in the Cloud - New Challenges for Teaching GIS
Bellman, C. J.; Pupedis, G.
2016-06-01
As cloud based services move towards becoming the dominant paradigm in many areas of information technology, GIS has also moved into `the Cloud', creating a new opportunities for professionals and students alike, while at the same time presenting a range of new challenges and opportunities for GIS educators. Learning for many students in the geospatial science disciplines has been based on desktop software for GIS, building their skills from basic data handling and manipulation to advanced spatial analysis and database storage. Cloud-based systems challenge this paradigm in many ways, with some of the skills being replaced by clever and capable software tools, while the ubiquitous nature of the computing environment offers access and processing from anywhere, on any device. This paper describes our experiences over the past two years in developing and delivering a new course incorporating cloud based technologies for GIS and illustrates the many benefits and pitfalls of a cloud based approach to teaching. Throughout the course, students were encouraged to provide regular feedback on the course through the use of online journals. This allowed students to critique the approach to teaching, the learning materials available and to describe their own level of comfort and engagement with the material in an honest and non-confrontational manner. Many of the students did not have a strong information technology background and the journals provided great insight into the views of the students and the challenges they faced in mastering this technology.
Scaini, C.; Felpeto, A.; Martí, J.; Carniel, R.
2014-05-01
This paper presents a GIS-based methodology to estimate damages produced by volcanic eruptions. The methodology is constituted by four parts: definition and simulation of eruptive scenarios, exposure analysis, vulnerability assessment and estimation of expected damages. Multi-hazard eruptive scenarios are defined for the Teide-Pico Viejo active volcanic complex, and simulated through the VORIS tool. The exposure analysis identifies the elements exposed to the hazard at stake and focuses on the relevant assets for the study area. The vulnerability analysis is based on previous studies on the built environment and complemented with the analysis of transportation and urban infrastructures. Damage assessment is performed associating a qualitative damage rating to each combination of hazard and vulnerability. This operation consists in a GIS-based overlap, performed for each hazardous phenomenon considered and for each element. The methodology is then automated into a GIS-based tool using an ArcGIS® program. Given the eruptive scenarios and the characteristics of the exposed elements, the tool produces expected damage maps. The tool is applied to the Icod Valley (North of Tenerife Island) which is likely to be affected by volcanic phenomena in case of eruption from both the Teide-Pico Viejo volcanic complex and North-West basaltic rift. Results are thematic maps of vulnerability and damage that can be displayed at different levels of detail, depending on the user preferences. The aim of the tool is to facilitate territorial planning and risk management in active volcanic areas.
Directory of Open Access Journals (Sweden)
Hust Michael
2008-09-01
Full Text Available Abstract Background Venezuelan equine encephalitis virus (VEEV belongs to the Alphavirus group. Several species of this family are also pathogenic to humans and are recognized as potential agents of biological warfare and terrorism. The objective of this work was the generation of recombinant antibodies for the detection of VEEV after a potential bioterrorism assault or an natural outbreak of VEEV. Results In this work, human anti-VEEV single chain Fragments variable (scFv were isolated for the first time from a human naïve antibody gene library using optimized selection processes. In total eleven different scFvs were identified and their immunological specificity was assessed. The specific detection of the VEEV strains TC83, H12/93 and 230 by the selected antibody fragments was proved. Active as well as formalin inactivated virus particles were recognized by the selected antibody fragments which could be also used for Western blot analysis of VEEV proteins and immunohistochemistry of VEEV infected cells. The anti-VEEV scFv phage clones did not show any cross-reactivity with Alphavirus species of the Western equine encephalitis virus (WEEV and Eastern equine encephalitis virus (EEEV antigenic complex, nor did they react with Chikungunya virus (CHIKV, if they were used as detection reagent. Conclusion For the first time, this study describes the selection of antibodies against a human pathogenic virus from a human naïve scFv antibody gene library using complete, active virus particles as antigen. The broad and sensitive applicability of scFv-presenting phage for the immunological detection and diagnosis of Alphavirus species was demonstrated. The selected antibody fragments will improve the fast identification of VEEV in case of a biological warfare or terroristic attack or a natural outbreak.
Steenhuis, T. S.; Mendoza, G.; Lyon, S. W.; Gerard Marchant, P.; Walter, M. T.; Schneiderman, E.
2003-04-01
Because the traditional Soil Conservation Service Curve Number (SCS-CN) approach continues to be ubiquitously used in GIS-BASED water quality models, new application methods are needed that are consistent with variable source area (VSA) hydrological processes in the landscape. We developed within an integrated GIS modeling environment a distributed approach for applying the traditional SCS-CN equation to watersheds where VSA hydrology is a dominant process. Spatial representation of hydrologic processes is important for watershed planning because restricting potentially polluting activities from runoff source areas is fundamental to controlling non-point source pollution. The methodology presented here uses the traditional SCS-CN method to predict runoff volume and spatial extent of saturated areas and uses a topographic index to distribute runoff source areas through watersheds. The resulting distributed CN-VSA method was incorporated in an existing GWLF water quality model and applied to sub-watersheds of the Delaware basin in the Catskill Mountains region of New York State. We found that the distributed CN-VSA approach provided a physically-based method that gives realistic results for watersheds with VSA hydrology.
Department of Housing and Urban Development — This tool provides a no-cost downloadable software tool that allows users to interact with professional quality GIS maps. Users access pre-compiled projects through...
Applications of GIS for the cadaster of dumpsites and the dumpsites evaluation
Directory of Open Access Journals (Sweden)
Igor Šebenik
1992-12-01
necessaru for qualitative remediation programes. There's no documentation data, they are usually lost and only contradictorg oral data are accessable. Technology of GIS seems to be very convenient for dumpsites data managing. The 'dumpsites lager' has to be fully used in environmental GIS. Well developed atribute data base and maps in scale 1:5000 or 1:1OOOO are a good base for a lager construction. A pilot GIS with this data was developed for water protection area of spring Rižana in year 1991. This year an application for data retrieval was developed for the needs of Mininstry for environmental protection and physical planning. Next step in establishing of system for dumpsites monitoring is a development of an expert sgstem for the prioritisation of hazards dumpsites cause, based on the data collected in GIS.
Application of GIS Rapid Mapping Technology in Disaster Monitoring
Wang, Z.; Tu, J.; Liu, G.; Zhao, Q.
2018-04-01
With the rapid development of GIS and RS technology, especially in recent years, GIS technology and its software functions have been increasingly mature and enhanced. And with the rapid development of mathematical statistical tools for spatial modeling and simulation, has promoted the widespread application and popularization of quantization in the field of geology. Based on the investigation of field disaster and the construction of spatial database, this paper uses remote sensing image, DEM and GIS technology to obtain the data information of disaster vulnerability analysis, and makes use of the information model to carry out disaster risk assessment mapping.Using ArcGIS software and its spatial data modeling method, the basic data information of the disaster risk mapping process was acquired and processed, and the spatial data simulation tool was used to map the disaster rapidly.
Michau, Tammy Miller
2017-12-01
Glaucoma is a multifactorial neurodegenerative ocular disease leading to progressive loss of retinal ganglion cells and their axons that form the optic nerve, causing blindness. Knowledge of the pathogenesis and development of equine glaucoma is in its infancy compared with human glaucoma. Glaucoma occurs most commonly secondary to uveitis and may be underdiagnosed or misdiagnosed in horses suffering from uveitis. Recognition and clinical diagnosis of glaucoma in the horse is improved with clinician awareness and the availability of handheld tonometers. Therapy for glaucoma is aimed at decreasing aqueous humor production through medical and surgical means. Even with therapy, long-term prognosis for vision is poor. Copyright © 2017 Elsevier Inc. All rights reserved.
Conjugated equine estrogen enhances rats' cognitive, anxiety, and social behavior
Walf, Alicia A.; Frye, Cheryl A.
2008-01-01
The ovarian hormone, 17β-estradiol (E2), has numerous targets in the body and brain, and can influence cognitive, affective, and social behavior. However, functional effects of commonly prescribed E2-based hormone therapies are less known. The effects of conjugated equine estrogen (CEE) on middle-aged female rats for cognitive (object recognition), anxiety (open field, plus maze), and social (social interaction, lordosis) behavior were compared-with vehicle. Our hypothesis that CEE would enha...
DEFF Research Database (Denmark)
Koch, Thomas Gadegaard; Berg, Lise Charlotte; Betts, Dean H.
2009-01-01
This paper provides a bird's-eye perspective of the general principles of stem-cell therapy and tissue engineering; it relates comparative knowledge in this area to the current and future status of equine regenerative medicine.The understanding of equine stem cell biology, biofactors, and scaffolds...... mesenchymal stromal cells, unless there is proof that they exhibit the fundamental in vivo characteristics of pluripotency and the ability to self-renew. That said, these cells from various tissues hold great promise for therapeutic use in horses. The 3 components of tissue engineering - cells, biological...... factors, and biomaterials - are increasingly being applied in equine medicine, fuelled by better scaffolds and increased understanding of individual biofactors and cell sources.The effectiveness of stem cell-based therapies and most tissue engineering concepts has not been demonstrated sufficiently...
An open source GIS-based tool to integrate the fragmentation mechanism in rockfall propagation
Matas, Gerard; Lantada, Nieves; Gili, Josep A.; Corominas, Jordi
2015-04-01
Rockfalls are frequent instability processes in road cuts, open pit mines and quarries, steep slopes and cliffs. Even though the stability of rock slopes can be determined using analytical approaches, the assessment of large rock cliffs require simplifying assumptions due to the difficulty of working with a large amount of joints, the scattering of both the orientations and strength parameters. The attitude and persistency of joints within the rock mass define the size of kinematically unstable rock volumes. Furthermore the rock block will eventually split in several fragments during its propagation downhill due its impact with the ground surface. Knowledge of the size, energy, trajectory… of each block resulting from fragmentation is critical in determining the vulnerability of buildings and protection structures. The objective of this contribution is to present a simple and open source tool to simulate the fragmentation mechanism in rockfall propagation models and in the calculation of impact energies. This tool includes common modes of motion for falling boulders based on the previous literature. The final tool is being implemented in a GIS (Geographic Information Systems) using open source Python programming. The tool under development will be simple, modular, compatible with any GIS environment, open source, able to model rockfalls phenomena correctly. It could be used in any area susceptible to rockfalls with a previous adjustment of the parameters. After the adjustment of the model parameters to a given area, a simulation could be performed to obtain maps of kinetic energy, frequency, stopping density and passing heights. This GIS-based tool and the analysis of the fragmentation laws using data collected from recent rockfall have being developed within the RockRisk Project (2014-2016). This project is funded by the Spanish Ministerio de Economía y Competitividad and entitled "Rockfalls in cliffs: risk quantification and its prevention"(BIA2013-42582-P).
Research of Ancient Architectures in Jin-Fen Area Based on GIS and BIM Technology
International Nuclear Information System (INIS)
Jia, Jing; Zheng, Qiuhong; Gao, Huiying; Sun, Hai
2017-01-01
The number of well-preserved ancient buildings located in Shanxi Province, enjoying the absolute maximum proportion of ancient architectures in China, is about 18418, among which, 9053 buildings have the structural style of wood frame. The value of the application of BIM (Building Information Modeling) and GIS (Geographic Information System) is gradually probed and testified in the corresponding fields of ancient architecture’s spatial distribution information management, routine maintenance and special conservation and restoration, the evaluation and simulation of related disasters, such as earthquake. The research objects are ancient architectures in JIN-FEN area, which were first investigated by Sicheng LIANG and recorded in his work of “Chinese ancient architectures survey report”. The research objects, i.e. the ancient architectures in Jin-Fen area include those in Sicheng LIANG’s investigation, and further adjustments were made through authors’ on-site investigation and literature searching and collection. During this research process, the spatial distributing Geodatabase of research objects is established utilizing GIS. The BIM components library for ancient buildings is formed combining on-site investigation data and precedent classic works, such as “Yingzao Fashi”, a treatise on architectural methods in Song Dynasty, “Yongle Encyclopedia” and “Gongcheng Zuofa Zeli”, case collections of engineering practice, by the Ministry of Construction of Qing Dynasty. A building of Guangsheng temple in Hongtong county is selected as an example to elaborate the BIM model construction process based on the BIM components library for ancient buildings. Based on the foregoing work results of spatial distribution data, attribute data of features, 3D graphic information and parametric building information model, the information management system for ancient architectures in Jin-Fen Area, utilizing GIS and BIM technology, could be constructed to support
Kenneth A. Baerenklau; Armando González-Cabán; Catrina I. Páez; Edgard Chávez
2009-01-01
The U.S. Forest Service is responsible for developing tools to facilitate effective and efficient fire management on wildlands and urban-wildland interfaces. Existing GIS-based fire modeling software only permits estimation of the costs of fire prevention and mitigation efforts as well as the effects of those efforts on fire behavior. This research demonstrates how the...
Regional planning and modelling of nitrate leaching in Denmark using DaisyGIS
DEFF Research Database (Denmark)
Veihe, Anita; Jensen, Niels H.; Boegh, Eva
Spatial deterministic simulation models such as DaisyGIS are increasingly being used for decision-making in European planning and there is a growing interest in using DaisyGIS as an administrative tool at the regional level in Denmark. This study evaluates the use of Daisy-GIS for nitrate leaching...... assessments based on nitrate leaching experiments carried out at the Marbjerg experimental site at Roskilde University....
Development of a web based GIS for health facilities mapping ...
African Journals Online (AJOL)
Hilary Mushonga
Key Words: Spatial Decision Support System, Web GIS, Mapping, Health geography. 1. Introduction ... Health geography is an area of medical research that incorporates geographic techniques into the study of ... street water pump. Once the ...
Epidermal growth factor-mediated effects on equine vascular smooth muscle cells
International Nuclear Information System (INIS)
Grosenbaugh, D.A.; Amoss, M.S.; Hood, D.M.; Morgan, S.J.; Williams, J.D.
1988-01-01
Epidermal growth factor (EGF) receptor binding kinetics and EGF-mediated stimulation of DNA synthesis and cellular proliferation were studied in cultured vascular smooth muscle cells (VSMC) from the equine thoracic aorta. Binding studies, using murine 125 I-labeled EGF, indicate the presence of a single class of high-affinity binding sites, with an estimated maximal binding capacity of 5,800 sites/cells. EGF stimulated [ 3 H]thymidine uptake in confluent quiescent monolayers in a dose-dependent fashion, half-maximal stimulation occurring at 7.5 x 10 -11 M. Likewise, EGF-mediated cellular proliferation was dose dependent under reduced serum concentrations. Equine VSMC contain specific receptors for EGF, and EGF can stimulate DNA synthesis and proliferation in these cultured cells, which suggests that EGF may participate in the proliferative changes observed in equine distal digital peripheral vascular disease
The Coastal Area Development Using GIS (Review of GIS Application Models
Directory of Open Access Journals (Sweden)
Prastowo Sutanto
2004-01-01
Full Text Available GIS, Geographical Information System, is a means that an be used to plan and to develop the coastal area because in carrying out the analysis this system combines the space data and their attributes. The activities done among others the prototype development of algae cultivation and tourism ativities, the development of fish pond location, the reclamation of the Jakarta Bay, and the concept of development the floating “Keramba” for pearl oysters and white sea fish similar to sole. GIS analysis with heaviness and overlay mapping yields the appropriate map to plan and to develop the coastal area. The result of GIS analysis can be used to plan and to develop the coastal area.
The portable GIS applied to geotechnical inspections; O GIS portatil para inspecoes geotecnicas
Energy Technology Data Exchange (ETDEWEB)
Rabaco, Lis M.; Lins, Alexandre F. [PETROBRAS S.A., Rio de Janeiro, RJ (Brazil); Costa, Rogerio M.; Freitas, Carlos F. [CONCREMAT, Rio de Janeiro, RJ (Brazil)
2005-07-01
The purpose of this paper is to implement an interface using tool to pack the GIS application to carry out a field inspection. The solution was implemented on pocket equipment using a simplified map and database integrated with the GIS Corporative. The main objective is to avoid paper work in field inspections. The emphases are on geotechnical inspections in order to assist the recuperation of information about points with geotechnical risk. There are interfaces with external device as GPS for insertion of points of risk. A set of tools are developed for bidirectional synchronization among the Corporative GIS and the pocket devices. The project focused geotechnical inspections on field, in order to synchronize automatically the information collected with the pocket GIS application with a Web server, packing all information from field operation to managers. (author)
Takodjou Wambo, Jonas Didero; Ganno, Sylvestre; Djonthu Lahe, Yannick Sthopira; Kouankap Nono, Gus Djibril; Fossi, Donald Hermann; Tchouatcha, Milan Stafford; Nzenti, Jean Paul
2018-06-01
Linear and nonlinear geostatistic is commonly used in ore grade estimation and seldom used in Geographical Information System (GIS) technology. In this study, we suggest an approach based on geostatistic linear ordinary kriging (OK) and Geographical Information System (GIS) techniques to investigate the spatial distribution of alluvial gold content, mineralized and gangue layers thicknesses from 73 pits at the Ngoura-Colomines area with the aim to determine controlling factors for the spatial distribution of mineralization and delineate the most prospective area for primary gold mineralization. Gold content varies between 0.1 and 4.6 g/m3 and has been broadly grouped into three statistical classes. These classes have been spatially subdivided into nine zones using ordinary kriging model based on physical and topographical characteristics. Both mineralized and barren layer thicknesses show randomly spatial distribution, and there is no correlation between these parameters and the gold content. This approach has shown that the Ngoura-Colomines area is located in a large shear zone compatible with the Riedel fault system composed of P and P‧ fractures oriented NE-SW and NNE-SSW respectively; E-W trending R fractures and R‧ fractures with NW-SE trends that could have contributed significantly to the establishment of this gold mineralization. The combined OK model and GIS analysis have led to the delineation of Colomines, Tissongo, Madubal and Boutou villages as the most prospective areas for the exploration of primary gold deposit in the study area.
On-line applications of numerical models in the Black Sea GIS
Zhuk, E.; Khaliulin, A.; Zodiatis, G.; Nikolaidis, A.; Nikolaidis, M.; Stylianou, Stavros
2017-09-01
The Black Sea Geographical Information System (GIS) is developed based on cutting edge information technologies, and provides automated data processing and visualization on-line. Mapserver is used as a mapping service; the data are stored in MySQL DBMS; PHP and Python modules are utilized for data access, processing, and exchange. New numerical models can be incorporated in the GIS environment as individual software modules, compiled for a server-based operational system, providing interaction with the GIS. A common interface allows setting the input parameters; then the model performs the calculation of the output data in specifically predefined files and format. The calculation results are then passed to the GIS for visualization. Initially, a test scenario of integration of a numerical model into the GIS was performed, using software, developed to describe a two-dimensional tsunami propagation in variable basin depth, based on a linear long surface wave model which is legitimate for more than 5 m depth. Furthermore, the well established oil spill and trajectory 3-D model MEDSLIK (http://www.oceanography.ucy.ac.cy/medslik/) was integrated into the GIS with more advanced GIS functionality and capabilities. MEDSLIK is able to forecast and hind cast the trajectories of oil pollution and floating objects, by using meteo-ocean data and the state of oil spill. The MEDSLIK module interface allows a user to enter all the necessary oil spill parameters, i.e. date and time, rate of spill or spill volume, forecasting time, coordinates, oil spill type, currents, wind, and waves, as well as the specification of the output parameters. The entered data are passed on to MEDSLIK; then the oil pollution characteristics are calculated for pre-defined time steps. The results of the forecast or hind cast are then visualized upon a map.
Zhang, Jing; Zhang, Jia; Du, Xiangyang; Kang, Hou; Qiao, Minjuan
2017-11-01
Due to the rapid development of human economy and society, the resulting ecological problems are becoming more and more prominent, and the dynamic monitoring of the various elements in the ecosystem has become the focus of the current research. For the complex structure and function of the ecological environment monitoring, advanced technical means should be adopted. With the development of spatial information technology, the ecological monitoring technology based on GIS and RS is becoming more and more perfect, and spatial analysis will play an important role in the field of environmental protection. Based on the GIS and RS technology, this paper analyzes the general centralized ecological monitoring model, and makes an objective analysis of the current ecological monitoring trend of China. These are important for the protection and management of ecological environment in China.
GIS Based System for Post-Earthquake Crisis Managment Using Cellular Network
Raeesi, M.; Sadeghi-Niaraki, A.
2013-09-01
Earthquakes are among the most destructive natural disasters. Earthquakes happen mainly near the edges of tectonic plates, but they may happen just about anywhere. Earthquakes cannot be predicted. Quick response after disasters, like earthquake, decreases loss of life and costs. Massive earthquakes often cause structures to collapse, trapping victims under dense rubble for long periods of time. After the earthquake and destroyed some areas, several teams are sent to find the location of the destroyed areas. The search and rescue phase usually is maintained for many days. Time reduction for surviving people is very important. A Geographical Information System (GIS) can be used for decreasing response time and management in critical situations. Position estimation in short period of time time is important. This paper proposes a GIS based system for post-earthquake disaster management solution. This system relies on several mobile positioning methods such as cell-ID and TA method, signal strength method, angel of arrival method, time of arrival method and time difference of arrival method. For quick positioning, the system can be helped by any person who has a mobile device. After positioning and specifying the critical points, the points are sent to a central site for managing the procedure of quick response for helping. This solution establishes a quick way to manage the post-earthquake crisis.
GIS BASED SYSTEM FOR POST-EARTHQUAKE CRISIS MANAGMENT USING CELLULAR NETWORK
Directory of Open Access Journals (Sweden)
M. Raeesi
2013-09-01
Full Text Available Earthquakes are among the most destructive natural disasters. Earthquakes happen mainly near the edges of tectonic plates, but they may happen just about anywhere. Earthquakes cannot be predicted. Quick response after disasters, like earthquake, decreases loss of life and costs. Massive earthquakes often cause structures to collapse, trapping victims under dense rubble for long periods of time. After the earthquake and destroyed some areas, several teams are sent to find the location of the destroyed areas. The search and rescue phase usually is maintained for many days. Time reduction for surviving people is very important. A Geographical Information System (GIS can be used for decreasing response time and management in critical situations. Position estimation in short period of time time is important. This paper proposes a GIS based system for post–earthquake disaster management solution. This system relies on several mobile positioning methods such as cell-ID and TA method, signal strength method, angel of arrival method, time of arrival method and time difference of arrival method. For quick positioning, the system can be helped by any person who has a mobile device. After positioning and specifying the critical points, the points are sent to a central site for managing the procedure of quick response for helping. This solution establishes a quick way to manage the post–earthquake crisis.
Yeargan, Michelle R; Howe, Daniel K
2011-02-28
Equine protozoal myeloencephalitis (EPM) is a common neurologic disease of horses that is caused by the apicomplexan pathogen Sarcocystis neurona. To help improve serologic diagnosis of S. neurona infection, we have modified existing enzyme-linked immunosorbent assays (ELISAs) based on the immunogenic parasite surface antigens SnSAG2, SnSAG3, and SnSAG4 to make the assays polyvalent, thereby circumventing difficulties associated with parasite antigenic variants and diversity in equine immune responses. Two approaches were utilized to achieve polyvalence: (1) mixtures of the individual recombinant SnSAGs (rSnSAGs) were included in single ELISAs; (2) a collection of unique SnSAG chimeras that fused protein domains from different SnSAG surface antigens into a single recombinant protein were generated for use in the ELISAs. These new assays were assessed using a defined sample set of equine sera and cerebrospinal fluids (CSFs) that had been characterized by Western blot and/or were from confirmed EPM horses. While all of the polyvalent ELISAs performed relatively well, the highest sensitivity and specificity (100%/100%) were achieved with assays containing the rSnSAG4/2 chimera (Domain 1 of SnSAG4 fused to SnSAG2) or using a mixture of rSnSAG3 and rSnSAG4. The rSnSAG4 antigen alone and the rSnSAG4/3 chimera (Domain 1 of SnSAG4 fused to Domain 2 of SnSAG3) exhibited the next best accuracy at 95.2% sensitivity and 100% specificity. Binding ratios and percent positivity (PP) ratios, determined by comparing the mean values for positive versus negative samples, showed that the most advantageous signal to noise ratios were provided by rSnSAG4 and the rSnSAG4/3 chimera. Collectively, our results imply that a polyvalent ELISA based on SnSAG4 and SnSAG3, whether as a cocktail of two proteins or as a single chimeric protein, can give optimal results in serologic testing of serum or CSF for the presence of antibodies against S. neurona. The use of polyvalent SnSAG ELISAs will
Directory of Open Access Journals (Sweden)
A. R. Abdul Rasam
2016-09-01
Full Text Available Development of an innovative method to enhance the detection of tuberculosis (TB in Malaysia is the latest agenda of the Ministry of Health. Therefore, a geographical information system (GIS based index model is proposed as an alternative method for defining potential high-risk areas of local TB cases at Section U19, Shah Alam. It is adopted a spatial multi-criteria decision making (MCDM method for ranking environmental risk factors of the disease in a standardised five-score scale. Scale 1 and 5 illustrate the lowest and the highest risk of the TB spread respectively, while scale from 3 to 5 is included as a potential risk level. These standardised scale values are then combined with expert normalised weights (0 to 1 to calculate the overall index values and produce a TB ranked map using a GIS overlay analysis and weighted linear combination. It is discovered that 71.43% of the Section is potential as TB high risk areas particularly at urban and densely populated settings. This predictive result is also reliable with the current real cases in 2015 by 76.00% accuracy. A GIS based MCDM method has demonstrated analytical capabilities in targeting high-risk spots and TB surveillance monitoring system of the country, but the result could be strengthened by applying other uncertainty assessment method.
GIS TECHNOLOGY AND TERRAIN ORTHOPHOTOMAP MAKING FOR MILITARY APPLICATION
Directory of Open Access Journals (Sweden)
Elshan Hashimov
2017-11-01
Full Text Available In this paper, it is shown that GIS and photogrammetry technologiyes, determination of searching target coordinates for the operational desicion making are very important for the military application, for the combat control. With aim of orthophotomap making of the terrain and identification of terrain supervision there has been constructed 3D model for choosen mountainous terrain of Azerbaijan Republic using GIS technology. Based on this model there has been obtained a terrain profile and carried out mapping. Using ArcGis software there has been investigated possibility remain control on obserbvable and unobservable parties of terrain on supervision line from supervision point to target point.
Patterson-Kane, Janet C; Rich, Tina
2014-01-01
Superficial digital flexor tendon (SDFT) injury in equine athletes is one of the most well-accepted, scientifically supported companion animal models of human disease (i.e., exercise-induced Achilles tendon [AT] injury). The SDFT and AT are functionally and clinically equivalent (and important) energy-storing structures for which no equally appropriate rodent, rabbit, or other analogues exist. Access to equine tissues has facilitated significant advances in knowledge of tendon maturation and aging, determination of specific exercise effects (including early life), and definition of some of the earliest stages of subclinical pathology. Access to human surgical biopsies has provided complementary information on more advanced phases of disease. Importantly, equine SDFT injuries are only a model for acute ruptures in athletes, not the entire spectrum of human tendonopathy (including chronic tendon pain). In both, pathology begins with a potentially prolonged phase of accumulation of (subclinical) microdamage. Recent work has revealed remarkably similar genetic risk factors, including further evidence that tenocyte dysfunction plays an active role. Mice are convenient but not necessarily accurate models for multiple diseases, particularly at the cellular level. Mechanistic studies, including tendon cell responses to combinations of exercise-associated stresses, require a more thorough investigation of cross-species conservation of key stress pathway auditors. Molecular evidence has provided some context for the poor performance of mouse models; equines may provide better systems at this level. The use of horses may be additionally justifiable based on comparable species longevity, lifestyle factors, and selection pressure by similar infectious agents (e.g., herpesviruses) on general cell stress pathway evolution. © The Author 2014. Published by Oxford University Press on behalf of the Institute for Laboratory Animal Research. All rights reserved. For permissions
Tsume, Yasuhiro; Takeuchi, Susumu; Matsui, Kazuki; Amidon, Gregory E; Amidon, Gordon L
2015-08-30
USP apparatus I and II are gold standard methodologies for determining the in vitro dissolution profiles of test drugs. However, it is difficult to use in vitro dissolution results to predict in vivo dissolution, particularly the pH-dependent solubility of weak acid and base drugs, because the USP apparatus contains one vessel with a fixed pH for the test drug, limiting insight into in vivo drug dissolution of weak acid and weak base drugs. This discrepancy underscores the need to develop new in vitro dissolution methodology that better predicts in vivo response to assure the therapeutic efficacy and safety of oral drug products. Thus, the development of the in vivo predictive dissolution (IPD) methodology is necessitated. The major goals of in vitro dissolution are to ensure the performance of oral drug products and the support of drug formulation design, including bioequivalence (BE). Orally administered anticancer drugs, such as dasatinib and erlotinib (tyrosine kinase inhibitors), are used to treat various types of cancer. These drugs are weak bases that exhibit pH-dependent and high solubility in the acidic stomach and low solubility in the small intestine (>pH 6.0). Therefore, these drugs supersaturate and/or precipitate when they move from the stomach to the small intestine. Also of importance, gastric acidity for cancer patients may be altered with aging (reduction of gastric fluid secretion) and/or co-administration of acid-reducing agents. These may result in changes to the dissolution profiles of weak base and the reduction of drug absorption and efficacy. In vitro dissolution methodologies that assess the impact of these physiological changes in the GI condition are expected to better predict in vivo dissolution of oral medications for patients and, hence, better assess efficacy, toxicity and safety concerns. The objective of this present study is to determine the initial conditions for a mini-Gastrointestinal Simulator (mGIS) to assess in vivo
Directory of Open Access Journals (Sweden)
Derdous Oussama
2015-12-01
Full Text Available The construction of dams in rivers can offer many advantages, however the consequences resulting from their failure could result in major damage, including loss of life and property destruction. To mitigate the threats of dam break it is essential to appreciate the characteristics of the potential flood in realistic manner. In this study an approach based on the integration of hydraulic modelling and GIS has been used to assess the risks resulting from a potential failure of Zardezas dam, a concrete dam located in Skikda, in the North East of Algeria. HEC-GeoRAS within GIS was used to extract geometric information from a digital elevation model and then imported into HEC-RAS. Flow simulation of the dam break was performed using HEC-RAS and results were mapped using the GIS. Finally, a flood hazard map based on water depth and flow velocity maps was created in GIS environment. According to this map the potential failure of Zardezas dam will place a large number in people in danger. The present study has shown that Application of Geographical Information System (GIS techniques in integration with hydraulic modelling can significantly reduce the time and the resources required to forecast potential dam break flood hazard which can play a crucial role in improving both flood disaster management and land use planning downstream of dams.
Improved GIS-based Methods for Traffic Noise Impact Assessment
DEFF Research Database (Denmark)
Nielsen, Otto Anker; Bloch, Karsten Sand
1996-01-01
When vector-based GIS-packages are used for traffic noise impact assessments, the buffer-technique is usually employed for the study: 1. For each road segment buffer-zones representing different noise-intervals are generated, 2. The buffers from all road segments are smoothed together, and 3....... The number of buildings within the buffers are enumerated. This technique provides an inaccurate assessment of the noise diffusion since it does not correct for buildings barrier and reflection to noise. The paper presents the results from a research project where the traditional noise buffer technique...... was compared with a new method which includes these corrections. Both methods follow the Common Nordic Noise Calculation Model, although the traditional buffer technique ignores parts of the model. The basis for the work was a digital map of roads and building polygons, combined with a traffic- and road...
Wienand, I; Nolting, U; Kistemann, T
2009-01-01
Following international developments and the new WHO Drinking Water Guidelines (WHO 2004) a process-orientated concept for risk, monitoring and incident management has been developed and implemented in this study. The concept will be reviewed with special consideration for resource protection (first barrier of the multi-barrier system) and in turn, for the Water Safety Plan (WSP) which adequately considers-beyond the current framework of legal requirements-possible new hygienic-microbiologically relevant risks (especially emerging pathogens) for the drinking water supply. The development of a WSP within the framework of risk, monitoring and incident management includes the application of Geographical Information Systems (GIS). In the present study, GIS was used for visualization and spatial analysis in decisive steps in the WSP. The detailed process of GIS-supported implementation included the identification of local participants and their tasks and interactions as an essential part of risk management. A detailed ecological investigation of drinking water conditions in the catchment area was conducted in addition to hazard identification, risk assessment and the monitoring of control measures. The main task of our study was to find out in which steps of the WSP the implementation of GIS could be integrated as a useful, and perhaps even an essential tool.
Development of web-based GIS services for sustainable soil resource management at farm level
Papadopoulos, Antonis; Kolovos, Chronis; Troyanos, Yerasimos; Doula, Maria
2017-09-01
Modern farms situated in urban or suburban areas, include various and in most cases diverse land covers. Land uses in such farms may serve residential, structured, aesthetic and agricultural purposes, usually delimited inside the boundaries of a single property. The environmental conditions across a farm, especially if it is situated on an irregular terrain, can be highly differentiated. Managing soil resources in a small scale diverse farm environment in a holistic and sustainable way should have spatial and temporal reference and take advantage of cut-edge geospatial technologies. In present study, an 8 hectare farm with various land uses in the southern suburbs of Attica Prefecture, Greece was systematically monitored regarding its soil, water and plant resources. Almost 80% of the farm's area is covered with trees, shrubs and low vegetation planted in a mosaic of parterres. Farm data collected concerned soil and water physicochemical characteristics, plant species, topographical features, irrigation network, valves and infrastructure. All data were imported and developed in a GIS geodatabase. Furthermore, web GIS services and a mobile GIS app were developed in order to monitor, update and synchronize present status and future changes performed in the farm. Through the web services and using the mobile GIS app, the user has access to all data stored in the geodatabase and according to access rights he can view or edit the spatial entities. The user can easily make query to specific features, combine their properties with other overlaying spatial data and reach accurate decisions. The app can be downloaded and implemented in mobile devices like smartphones and tablets for extending its functionality. As proven in this study, web GIS services and mobile GIS apps constitute an attractive suite of methodologies for effective and user friendly management of natural resources at farm level.
Kim, L M; Morley, P S; Traub-Dargatz, J L; Salman, M D; Gentry-Weeks, C
2001-03-01
To evaluate factors potentially associated with fecal Salmonella shedding among equine patients hospitalized for colic at a veterinary teaching hospital and to determine the effects of probiotic treatment on fecal Salmonella shedding and clinical signs. Longitudinal study and controlled trial. 246 equine colic patients. History and medical information were obtained from patient records. Fecal and environmental samples were submitted for aerobic bacterial culture for Salmonella enterica. Fifty-one patients were treated with a commercially available probiotic; 46 were treated with a placebo. Logistic regression was used to evaluate data. Salmonella organisms were detected in feces from 23 (9%) patients at least once during hospitalization. Patients were more likely to shed Salmonella organisms if diarrhea was evident equine patients hospitalized at a veterinary teaching hospital because of colic and that pathogen monitoring in patients and the hospital environment and use of barrier nursing precautions for equine colic patients are beneficial.
A new data integration approach for AutoCAD and GIS
Ye, Hongmei; Li, Yuhong; Wang, Cheng; Li, Lijun
2006-10-01
GIS has its advantages both on spatial data analysis and management, particularly on the geometric and attributive information management, which has also attracted lots attentions among researchers around world. AutoCAD plays more and more important roles as one of the main data sources of GIS. Various work and achievements can be found in the related literature. However, the conventional data integration from AutoCAD to GIS is time-consuming, which also can cause the information loss both in the geometric aspects and the attributive aspects for a large system. It is necessary and urgent to sort out new approach and algorithm for the efficient high-quality data integration. In this paper, a novel data integration approach from AutoCAD to GIS will be introduced based on the spatial data mining technique through the data structure analysis both in the AutoCAD and GIS. A practicable algorithm for the data conversion from CAD to GIS will be given as well. By a designed evaluation scheme, the accuracy of the conversion both in the geometric and the attributive information will be demonstrated. Finally, the validity and feasibility of the new approach will be shown by an experimental analysis.
Radiation exposure during equine radiography
International Nuclear Information System (INIS)
Ackerman, N.; Spencer, C.P.; Hager, D.A.; Poulos, P.W. Jr.
1988-01-01
All personnel present in the X-ray examination room during equine radiography were monitored using low energy direct reading ionization chambers (pockets dosimeters) worn outside the lead apron at neck level. The individuals' task and dosimeter readings were recorded after each examination. Average doses ranged from 0 to 6 mrad per study. The greatest exposures were associated with radiography of the shoulder and averaged less than 4 mrad. The individual extending the horse's limb was at greatest risk although the individual holding the horse's halter and the one making the X-ray exposure received similar exposures. A survey of the overhead tube assembly used for some of the X-ray examinations also was performed. Meter readings obtained indicated an asymetric dose distribution around the tube assembly, with the highest dose occurring on the side to which the exposure cord was attached. Although the exposures observed were within acceptable limits for occupational workers, we have altered our protocol and no longer radiograph the equine shoulder unless the horse is anesthetized. Continued use of the pocket dosimeters and maintenance of a case record of radiation exposure appears to make the technologists more aware of radiation hazards
Equine tick-borne infections in the Netherlands
Butler, C.M.
2012-01-01
This thesis focuses on the emergence and establishment of equine tick-borne infections in the Netherlands, with particular attention to their diagnosis, clinical relevance and treatment. Four tick-borne agents (Borrelia burgdorferi, Theileria equi, Babesia caballi and Anaplasma phagocytophilum)
Thompson, K; Clarkson, L
2016-04-01
The extension of research into public practice is enhanced by communication and behaviour change strategies that are consistent with consumer needs and perspectives. To gain support for equine research (or to appreciate the perspectives contributing to disagreement), it is necessary to determine how aware consumers are of research, what research means to them, how they perceive its benefits (if at all) and how they engage with (or resist) it. Because of a surprising dearth of research evaluating consumer perceptions of research in any sector, our aim was to identify the perceived outputs and benefits of research from the perspective of the Australian horse owner. We analysed the data for 930 participants in an online survey. Participants' understanding of research was associated with a broad terminology. Slightly more than half were aware of equine research that had taken place in Australia, with almost half reporting gaining some benefit, notably in relation to equine health. Although comments demonstrated an awareness of the collective benefit of research, research was made meaningful in relation to local conditions and participants' own equestrian disciplines. There is a significant opportunity for increasing awareness of Australia-based equine research and its value to owners of horses. The critical engagement with research by some owners suggests the need for communicators to present research in terms suitable for an intelligent lay audience, with clear identification of the personal and collective benefits for owners, horses and the equestrian community. © 2016 Australian Veterinary Association.
The microbiome associated with equine periodontitis and oral health.
Kennedy, Rebekah; Lappin, David Francis; Dixon, Padraic Martin; Buijs, Mark Johannes; Zaura, Egija; Crielaard, Wim; O'Donnell, Lindsay; Bennett, David; Brandt, Bernd Willem; Riggio, Marcello Pasquale
2016-04-14
Equine periodontal disease is a common and painful condition and its severe form, periodontitis, can lead to tooth loss. Its aetiopathogenesis remains poorly understood despite recent increased awareness of this disorder amongst the veterinary profession. Bacteria have been found to be causative agents of the disease in other species, but current understanding of their role in equine periodontitis is extremely limited. The aim of this study was to use high-throughput sequencing to identify the microbiome associated with equine periodontitis and oral health. Subgingival plaque samples from 24 horses with periodontitis and gingival swabs from 24 orally healthy horses were collected. DNA was extracted from samples, the V3-V4 region of the bacterial 16S rRNA gene amplified by PCR and amplicons sequenced using Illumina MiSeq. Data processing was conducted using USEARCH and QIIME. Diversity analyses were performed with PAST v3.02. Linear discriminant analysis effect size (LEfSe) was used to determine differences between the groups. In total, 1308 OTUs were identified and classified into 356 genera or higher taxa. Microbial profiles at health differed significantly from periodontitis, both in their composition (p PERMANOVA) and in microbial diversity (p < 0.001; Mann-Whitney test). Samples from healthy horses were less diverse (1.78, SD 0.74; Shannon diversity index) and were dominated by the genera Gemella and Actinobacillus, while the periodontitis group samples showed higher diversity (3.16, SD 0.98) and were dominated by the genera Prevotella and Veillonella. It is concluded that the microbiomes associated with equine oral health and periodontitis are distinct, with the latter displaying greater microbial diversity.
Brault, Aaron C.; Powers, Ann M.; Ortiz, Diana; Estrada-Franco, Jose G.; Navarro-Lopez, Roberto; Weaver, Scott C.
2004-01-01
In 1993 and 1996, subtype IE Venezuelan equine encephalitis (VEE) virus caused epizootics in the Mexican states of Chiapas and Oaxaca. Previously, only subtype IAB and IC VEE virus strains had been associated with major outbreaks of equine and human disease. The IAB and IC epizootics are believed to emerge via adaptation of enzootic (sylvatic, equine-avirulent) strains for high titer equine viremia that results in efficient infection of mosquito vectors. However, experimental equine infections with subtype IE equine isolates from the Mexican outbreaks demonstrated neuro-virulence but little viremia, inconsistent with typical VEE emergence mechanisms. Therefore, we hypothesized that changes in the mosquito vector host range might have contributed to the Mexican emergence. To test this hypothesis, we evaluated the susceptibility of the most abundant mosquito in the deforested Pacific coastal locations of the VEE outbreaks and a proven epizootic vector, Ochlerotatus taeniorhynchus. The Mexican epizootic equine isolates exhibited significantly greater infectivity compared with closely related enzootic strains, supporting the hypothesis that adaptation to an efficient epizootic vector contributed to disease emergence. Reverse genetic studies implicated a Ser → Asn substitution in the E2 envelope glycoprotein as the major determinant of the increased vector infectivity phenotype. Our findings underscore the capacity of RNA viruses to alter their vector host range through minor genetic changes, resulting in the potential for disease emergence. PMID:15277679
INTEGRATING MULTIPLE CRITERIA EVALUATION AND GIS IN ECOTOURISM: A REVIEW
Directory of Open Access Journals (Sweden)
Z. H. Mohd
2016-09-01
Full Text Available The concept of 'Eco-tourism' is increasingly heard in recent decades. Ecotourism is one adventure that environmentally responsible intended to appreciate the nature experiences and cultures. Ecotourism should have low impact on environment and must contribute to the prosperity of local residents. This article reviews the use of Multiple Criteria Evaluation (MCE and Geographic Information System (GIS in ecotourism. Multiple criteria evaluation mostly used to land suitability analysis or fulfill specific objectives based on various attributes that exist in the selected area. To support the process of environmental decision making, the application of GIS is used to display and analysis the data through Analytic Hierarchy Process (AHP. Integration between MCE and GIS tool is important to determine the relative weight for the criteria used objectively. With the MCE method, it can resolve the conflict between recreation and conservation which is to minimize the environmental and human impact. Most studies evidences that the GIS-based AHP as a multi criteria evaluation is a strong and effective in tourism planning which can aid in the development of ecotourism industry effectively.
Integrating Multiple Criteria Evaluation and GIS in Ecotourism: a Review
Mohd, Z. H.; Ujang, U.
2016-09-01
The concept of 'Eco-tourism' is increasingly heard in recent decades. Ecotourism is one adventure that environmentally responsible intended to appreciate the nature experiences and cultures. Ecotourism should have low impact on environment and must contribute to the prosperity of local residents. This article reviews the use of Multiple Criteria Evaluation (MCE) and Geographic Information System (GIS) in ecotourism. Multiple criteria evaluation mostly used to land suitability analysis or fulfill specific objectives based on various attributes that exist in the selected area. To support the process of environmental decision making, the application of GIS is used to display and analysis the data through Analytic Hierarchy Process (AHP). Integration between MCE and GIS tool is important to determine the relative weight for the criteria used objectively. With the MCE method, it can resolve the conflict between recreation and conservation which is to minimize the environmental and human impact. Most studies evidences that the GIS-based AHP as a multi criteria evaluation is a strong and effective in tourism planning which can aid in the development of ecotourism industry effectively.
Technology integrated teaching in Malaysian schools: GIS, a SWOT analysis
Directory of Open Access Journals (Sweden)
Habibah Lateh, vasugiammai muniandy
2011-08-01
Full Text Available Geographical Information System (GIS has been introduced and widely used in schools in various countries. The year 1990 onwards, the implementation of GIS in schools showed an increase. This is due to the drastic changes and reforms in the education system. Even though the name GIS suits well to the Geography subject, but it is widely integrated in various subjects such as History, Chemistry, Physics and Science. In Malaysia, GIS is common in fields such as risk management, architecture, town planning and municipal department. Anyhow, it is still unknown in the school education system. Even upper secondary students are not familiar with GIS. The Ministry of Education in Malaysia has been continuously reforming the education towards the aim of creating a society based on economic fundamentals and knowledge. The Master Plan for Educational Development with the aim of developing individual potential with well-integrated and balanced education is already on field. Recently, Malaysia invested 18 % of the annual national budget towards upgrading its education system. The computer in education program started in 1999. Three hundred and twenty two schools were chosen as ‘break a way’ from conventional teaching method towards technology integrated teaching. Projects such as New Primary School Curriculum (KBSR, Integrated Secondary School Curriculum (KBSM, Smart School Project, School Access Centre were introduced constantly. Teacher as the cogwheel of innovations in schools were given courses in aim to develop their ICT knowledge and skill. To this date, the technology integration in subjects is not equal and it disperses through subjects. Geography is one of the ‘dry’ subjects in schools with less technology which is not preferable among students. Geographical Information System (GIS is foremost the best Geographical Information Technology (GIT to be implied in geography subject. In Malaysian Education System, GIS is still exposed just in papers
... EEE is one of the most severe mosquito-transmitted diseases in the United States with approximately 33% mortality ... Emerging and Zoonotic Infectious Diseases (NCEZID) Division of Vector-Borne Diseases (DVBD) Email Recommend Tweet YouTube Instagram Listen Watch ...
Biochemical and biomechanical characterisation of equine cervical facet joint cartilage.
O'Leary, S A; White, J L; Hu, J C; Athanasiou, K A
2018-04-15
The equine cervical facet joint is a site of significant pathology. Located bilaterally on the dorsal spine, these diarthrodial joints work in conjunction with the intervertebral disc to facilitate appropriate spinal motion. Despite the high prevalence of pathology in this joint, the facet joint is understudied and thus lacking in viable treatment options. The goal of this study was to characterise equine facet joint cartilage and provide a comprehensive database describing the morphological, histological, biochemical and biomechanical properties of this tissue. Descriptive cadaver studies. A total of 132 facet joint surfaces were harvested from the cervical spines of six skeletally mature horses (11 surfaces per animal) for compiling biomechanical and biochemical properties of hyaline cartilage of the equine cervical facet joints. Gross morphometric measurements and histological staining were performed on facet joint cartilage. Creep indentation and uniaxial strain-to-failure testing were used to determine the biomechanical compressive and tensile properties. Biochemical assays included quantification of total collagen, sulfated glycosaminoglycan and DNA content. The facet joint surfaces were ovoid in shape with a flat articular surface. Histological analyses highlighted structures akin to articular cartilage of other synovial joints. In general, biomechanical and biochemical properties did not differ significantly between the inferior and superior joint surfaces as well as among spinal levels. Interestingly, compressive and tensile properties of cervical facet articular cartilage were lower than those of articular cartilage from other previously characterised equine joints. Removal of the superficial zone reduced the tissue's tensile strength, suggesting that this zone is important for the tensile integrity of the tissue. Facet surfaces were sampled at a single, central location and do not capture the potential topographic variation in cartilage properties. This
International online survey to assess current practice in equine anaesthesia.
Wohlfender, F D; Doherr, M G; Driessen, B; Hartnack, S; Johnston, G M; Bettschart-Wolfensberger, R
2015-01-01
Multicentre Confidential Enquiries into Perioperative Equine Fatalities (CEPEF) have not been conducted since the initial CEPEF Phases 1-3, 20 years ago. To collect data on current practice in equine anaesthesia and to recruit participants for CEPEF-4. Online questionnaire survey. An online questionnaire was prepared and the link distributed internationally to veterinarians possibly performing equine anaesthesia, using emails, posters, flyers and an editorial. The questionnaire included 52 closed, semiclosed and open questions divided into 8 subgroups: demographic data, anaesthetist, anaesthesia management (preoperative, technical equipment, monitoring, drugs, recovery), areas of improvements and risks and motivation for participation in CEPEF-4. Descriptive statistics and Chi-squared tests for comparison of categorical variables were performed. A total of 199 questionnaires were completed by veterinarians from 14 different countries. Of the respondents, 43% worked in private hospitals, 36% in private practices and 21% in university teaching hospitals. In 40 institutions (23%) there was at least one diplomate of the European or American colleges of veterinary anaesthesia and analgesia on staff. Individual respondents reported routinely employ the following anaesthesia monitoring modalities: electrocardiography (80%), invasive arterial blood pressures (70%), pulse oximetry (60%), capnography (55%), arterial blood gases (47%), composition of inspired and expired gases (45%) and body temperature (35%). Drugs administered frequently or routinely as part of a standard protocol were: acepromazine (44%), xylazine (68%), butorphanol (59%), ketamine (96%), diazepam (83%), isoflurane (76%), dobutamine (46%), and, as a nonsteroidal anti-inflammatory drug, phenylbutazone (73%) or flunixin meglumine (66%). Recovery was routinely assisted by 40%. The main factors perceived by the respondents to affect outcome of equine anaesthesia were the preoperative health status of the
Zhou, Yuan; Shi, Tie-Mao; Hu, Yuan-Man; Gao, Chang; Liu, Miao; Song, Lin-Qi
2011-12-01
Based on geographic information system (GIS) technology and multi-objective location-allocation (LA) model, and in considering of four relatively independent objective factors (population density level, air pollution level, urban heat island effect level, and urban land use pattern), an optimized location selection for the urban parks within the Third Ring of Shenyang was conducted, and the selection results were compared with the spatial distribution of existing parks, aimed to evaluate the rationality of the spatial distribution of urban green spaces. In the location selection of urban green spaces in the study area, the factor air pollution was most important, and, compared with single objective factor, the weighted analysis results of multi-objective factors could provide optimized spatial location selection of new urban green spaces. The combination of GIS technology with LA model would be a new approach for the spatial optimizing of urban green spaces.
Identification of a divergent genotype of equine arteritis virus from South American donkeys.
Rivas, J; Neira, V; Mena, J; Brito, B; Garcia, A; Gutierrez, C; Sandoval, D; Ortega, R
2017-12-01
A novel equine arteritis virus (EAV) was isolated and sequenced from feral donkeys in Chile. Phylogenetic analysis indicates that the new virus and South African asinine strains diverged at least 100 years from equine EAV strains. The results indicate that asinine strains belonged to a different EAV genotype. © 2017 Blackwell Verlag GmbH.
Adaptions of ArcGIS' Linear Referencing System to the Coastal Environment
DEFF Research Database (Denmark)
Balstrøm, Thomas
2008-01-01
For many years it has been problematic to store information for the coastal environment in a GIS. However, a system named "Linear referencing System" based upon a dynamic segmentation principle implemented in ESRIs ArcGIS 9 software has now made it possible to store and analyze information...
Hold your horses: A comparison of human laryngomalacia with analogous equine airway pathology.
Lawrence, Rachael J; Butterell, Matthew J; Constable, James D; Daniel, Matija
2018-02-01
Laryngomalacia is the most common cause of stridor in infants. Dynamic airway collapse is also a well-recognised entity in horses and an important cause of surgical veterinary intervention. We compare the aetiology, clinical features and management of human laryngomalacia with equine dynamic airway collapse. A structured review of the PubMed, the Ovid Medline and the Cochrane Collaboration databases (Cochrane Central Register of Controlled Trials, Cochrane Database of Systemic Reviews). There are numerous equine conditions that cause dynamic airway collapse defined specifically by the anatomical structures involved. Axial Deviation of the Aryepiglottic Folds (ADAF) is the condition most clinically analogous to laryngomalacia in humans, and is likewise most prevalent in the immature equine airway. Both conditions are managed either conservatively, or if symptoms require it, with surgical intervention. The operative procedures performed for ADAF and laryngomalacia are technically comparable. Dynamic collapse of the equine larynx, especially ADAF, is clinically similar to human laryngomalacia, and both are treated in a similar fashion. Copyright © 2017 Elsevier B.V. All rights reserved.
Loomans, J.B.A.; Waaijer, P.G.; Maree, J.T.M.; Weeren, van P.R.; Barneveld, A.
2009-01-01
The aim of this study was to evaluate systematically the quality of equine veterinary top sports medicine in The Netherlands and the degree to which the expectations in the field are met. Focus was on structure, process and outcome of care. The structure of care is generally satisfactory but there
An ArcGIS decision support tool for artificial reefs site selection (ArcGIS ARSS)
Stylianou, Stavros; Zodiatis, George
2017-04-01
Although the use and benefits of artificial reefs, both socio-economic and environmental, have been recognized with research and national development programmes worldwide their development is rarely subjected to a rigorous site selection process and the majority of the projects use the traditional (non-GIS) approach, based on trial and error mode. Recent studies have shown that the use of Geographic Information Systems, unlike to traditional methods, for the identification of suitable areas for artificial reefs siting seems to offer a number of distinct advantages minimizing possible errors, time and cost. A decision support tool (DSS) has been developed based on the existing knowledge, the multi-criteria decision analysis techniques and the GIS approach used in previous studies in order to help the stakeholders to identify the optimal locations for artificial reefs deployment on the basis of the physical, biological, oceanographic and socio-economic features of the sites. The tool provides to the users the ability to produce a final report with the results and suitability maps. The ArcGIS ARSS support tool runs within the existing ArcMap 10.2.x environment and for the development the VB .NET high level programming language has been used along with ArcObjects 10.2.x. Two local-scale case studies were conducted in order to test the application of the tool focusing on artificial reef siting. The results obtained from the case studies have shown that the tool can be successfully integrated within the site selection process in order to select objectively the optimal site for artificial reefs deployment.
DEFF Research Database (Denmark)
Berg, Lise Charlotte; Koch, Thomas Gadegaard; Heerkens, T.
2009-01-01
Objective: Orthopaedic injury is the most common cause of lost training days or premature retirement in the equine athlete. Cell-based therapies are a potential new treatment option in musculo-skeletal diseases. Mesenthymal stromal cells (MSC) have been derived from multiple sources in the horse...
Energy management based on AM/FM/GIS for phase balancing application on distribution systems
International Nuclear Information System (INIS)
Kuo, C.-C.; Chao, Y.-T.
2010-01-01
Unbalanced feeder systems may deteriorate of power quality, and increase investment and operating costs for distribution systems. The phase swapping method recommends re-phasing circuits of laterals and transformers for making the current and voltage balanced and also reducing feeder loss and voltage drop. In this paper, an application program, based on the automated mapping/facilities management/ geographic information system (AM/FM/GIS) is developed which contains a function of automatically computing Z-bus, load flow and phase balancing of feeders with phase swapping by using easily selecting of feeder on a graphic user interface application. Therefore, the relative data need not be keyed in manually. The presented phase balancing algorithm are based on database and related data structures developed on the AM/FM/GIS and Visual Basic software, which can be integrated into the Tai-Power distribution automation system. Then, the phase balancing algorithm is designed to handle the load patterns and the load of transformers that connect specific feeders when evaluating phase swaps that will result in reduced daily circuit losses over all load points. The proposed application not only can effectively reduce the circuit loss and improves phase balancing, but also enhances power quality efficiently under easily using environment.
A GIS approach for predicting prehistoric site locations.
Energy Technology Data Exchange (ETDEWEB)
Kuiper, J. A.; Wescott, K. L.
1999-08-04
Use of geographic information system (GIS)-based predictive mapping to locate areas of high potential for prehistoric archaeological sites is becoming increasingly popular among archaeologists. Knowledge of the environmental variables influencing activities of original inhabitants is used to produce GIS layers representing the spatial distribution of those variables. The GIS layers are then analyzed to identify locations where combinations of environmental variables match patterns observed at known prehistoric sites. Presented are the results of a study to locate high-potential areas for prehistoric sites in a largely unsurveyed area of 39,000 acres in the Upper Chesapeake Bay region, including details of the analysis process. The project used environmental data from over 500 known sites in other parts of the region and the results corresponded well with known sites in the study area.
Carter-Arnold, J L; Neilsen, N L; Amelse, L L; Odoi, A; Dhar, M S
2014-09-01
Stem cell therapies are used routinely in equine practice. Most published reports characterise stem cells derived from younger horses; however, middle-aged horses are often in athletic performance, and experience degenerative medical conditions. Thus, mesenchymal stem cells (MSCs) from this group should be investigated. To describe differences in in vitro adherence, proliferation and potential for differentiation of equine bone marrow-derived MSCs (equine BMMSCs) harvested from middle-aged (10-13 years old) female donors. Descriptive study of stem cell characteristics. Equine BMMSCs from 6 horses were cultured in vitro and evaluated for viability, proliferation, osteogenesis, chondrogenesis, adipogenesis, cluster-of-differentiation markers and gene expression. Equine BMMSCs from all 6 donors demonstrated fibroblastic, cellular morphology, adherence to plastic and expression of cluster-of-differentiation markers. They varied in their rate of proliferation and trilineage differentiation. The equine BMMSCs of one of 6 donors demonstrated a higher rate of proliferation, enhanced ability for cell passaging and a more robust in vitro differentiation. Comparatively, equine BMMSCs from 2 donors demonstrated a lower rate of proliferation and lack of osteogenic and chondrogenic differentiation. The results of this study confirm that donor-to-donor variation in equine BMMSCs exists and this variation can be documented using in vitro assays. Subjective assessment suggests that the rate of proliferation tends to correlate with differentiation potential. © 2013 EVJ Ltd.
Risk factors for equine fractures in Thoroughbred flat racing in North America.
Georgopoulos, Stamatis Panagiotis; Parkin, Tim D H
2017-04-01
The aim of this paper is to identify risk factors associated with equine fractures in flat horse racing of Thoroughbreds in North America. Equine fractures were defined as any fracture sustained by a horse during a race. This was a cohort study that made use of all starts from the racecourses reporting injuries. The analysis was based on 2,201,152 racing starts that represent 91% of all official racing starts in the USA and Canada from 1st January 2009-31st December 2014. Approximately 3,990,000 workout starts made by the 171,523 Thoroughbreds that raced during that period were also included in the analysis. During this period the incidence of equine fractures was 2 per 1000 starts. The final multivariable logistic regression models identified risk factors significantly associated (pfracture. For example, horses were found to have a 32% higher chance of sustaining a fracture when racing on a dirt surface compared to a synthetic surface; a 35% higher chance if they had sustained a previous injury during racing and a 47% higher chance was also found for stallions compared to mares and geldings. Furthermore, logistic regression models based on data available only from the period 2009-2013 were used to predict the probability of a Thoroughbred sustaining a fracture for 2014. The 5% of starts that had the highest score in our predictive models for 2014 were found to have 2.4 times (95% CI: 1.9-2.9) higher fracture prevalence than the mean fracture prevalence of 2014. The results of this study can be used to identify horses at higher risk on entering a race and could help inform the design and implementation of preventive measures aimed at minimising the number of Thoroughbreds sustaining fractures during racing in North America. Copyright © 2016 Elsevier B.V. All rights reserved.
Geostatistical modelling of carbon monoxide levels in Khartoum State (Sudan) - GIS pilot based study
Energy Technology Data Exchange (ETDEWEB)
Alhuseen, A [Comenius University in Bratislava, Faculty of Natural Sciences, Dept. of Landscape Ecology, 84215 Bratislava (Slovakia); Madani, M [Ministry of Environment and Physical Development, 1111 Khartoum (Sudan)
2012-04-25
The objective of this study is to develop a digital GIS model; that can evaluate, predict and visualize carbon monoxide (CO) levels in Khartoum state. To achieve this aim, sample data had been collected, processed and managed to generate a dynamic GIS model of carbon monoxide levels in the study area. Parametric data collected from the field and analysis carried throughout this study show that (CO) emissions were lower than the allowable ambient air quality standards released by National Environment Protection Council (NEPC-USA) for 1998. However, this pilot study has found emissions of (CO) in Omdurman city were the highest. This pilot study shows that GIS and geostatistical modeling can be used as a powerful tool to produce maps of exposure. (authors)
The application of GIS and its components in tourism
Directory of Open Access Journals (Sweden)
Jovanović Verka
2008-01-01
Full Text Available Since the success of any tourism business is determined by tourism planning, development research and marketing, the first thing we review in this article is GIS application for tourism planning. Both tourism and IT increasingly provide strategic opportunities and powerful tools for economic growth, redistribution of wealth and development of equity around the globe. GIS technology offers great opportunities for the development of modern tourism applications using maps. This technology integrates common database operations such as query with the unique visualization and geographic analysis benefits offered by maps. GIS is used for bringing the georeferenced data (spatial and non spatial of geographic location Zlatibor and Zlatar into digital maps. Each object is assigned to a thematic layer. Each layer combines related objects like roads, building, protected areas or watercourses. In this research the authors used GIS in three types of applications such as inventory, analysis and evaluation of plan based on tourism development.
Energy Technology Data Exchange (ETDEWEB)
Brower, M.C. [Brower & Company, Andover, MA (United States); Hurley, P. [RLA Consulting, Bothell, WA (United States); Simon, R. [Consulting Meteorologist, Mill Valley, CA (United States)
1996-12-31
This paper describes the methodology and results of a wide-area wind resource assessment and site selection in Colorado. This was the first phase in a three-part assessment and monitoring program conducted for the State of Colorado Office of Energy Conservation and several collaborating utilities. The objective of this phase was to identify up to 20 candidate sites for evaluation and possible long-term monitoring. This was accomplished using a geographic information system (GIS), which takes into account such factors as topography, existing wind resource data, locations of transmission lines, land cover, and land use. The resulting list of sites recommended for evaluation in Phase 2 of the study includes locations throughout Colorado, but most are in the eastern plains. The GIS wind siting model may be modified and updated in the future as additional information becomes available. 3 figs., 1 tab.
An Exploration of Industry Expert Perception of Equine Welfare Using Vignettes
Directory of Open Access Journals (Sweden)
Cordelie DuBois
2017-12-01
Full Text Available As part of a larger Delphi survey project, equine professionals (n = 14 were presented with twelve short scenarios in which a horse’s welfare could be compromised. They were asked to rank each scenario (with 0 indicating no welfare concerns and 5 indicating a situation where immediate intervention was necessary, provide justification for their ranking, and give examples of what might have been the motivation behind the scenario. The wide range within vignette scores demonstrated the diversity of opinion even among a relatively small group of equine professionals. Qualitative analysis of responses to vignettes suggested that respondents typically ranked situations higher if they had a longer duration and the potential for greater or longer-lasting consequences (e.g., serious injury. Respondents were also the most sensitive to situations in which the horse’s physical well-being (e.g., painful experience was, or could be, compromised. Financial reasons, ignorance, and human convenience were also areas discussed as potential motivators by survey respondents. Overall, responses from the vignettes allowed for a picture of welfare perception based on personal values.
A European perspective on GIS-based walkability and active modes of transport.
Grasser, Gerlinde; van Dyck, Delfien; Titze, Sylvia; Stronegger, Willibald J
2017-02-01
The association between GIS-based walkability and walking for transport is considered to be well established in USA and in Australia. Research on the association between walkability and cycling for transport in European cities is lacking. The aim of this study was to test the predictive validity of established walkability measures and to explore alternative walkability measures associated with walking and cycling for transport in a European context. Outcome data were derived from the representative cross-sectional survey ( n = 843) ‘Radfreundliche Stadt’ of adults in the city of Graz (Austria). GIS-based walkability was measured using both established measures (e.g. gross population density, household unit density, entropy index, three-way intersection density, IPEN walkability index) and alternative measures (e.g. proportion of mixed land use, four-way intersection density, Graz walkability index). ANCOVAs were conducted to examine the adjusted association between walkability measures and outcomes. Household unit density, proportion of mixed land use, three-way intersection density and IPEN walkability index were positively associated with walking for transport, but the other measures were not. All walkability measures were positively associated with cycling for transport. The established walkability measures were applicable to a European city such as Graz. The alternative walkability measures performed well in a European context. Due to measurement issues the association between these walkability measures and walking for transport needs to be investigated further. © The Author 2016. Published by Oxford University Press on behalf of the European Public Health Association. All rights reserved.
Jansen, Marijke; Kamphuis, Carlijn B. M.; Pierik, Frank H.; Ettema, Dick F.; Dijst, Martin J.
2018-01-01
Background To improve our understanding of the neighborhood environment – physical activity (PA) relationship, it is of importance to assess associations between neighborhood environmental characteristics and neighborhood-based PA. Methods Participants’ (N = 308; 45–65 years) light PA (LPA) and moderate-vigorous PA (MVPA) within a 400, 800, and 1600 m buffer around adults’ homes was measured using accelerometers and GPS-devices. Land use data in ArcGIS provided neighborhood characteristics fo...
Analysis of sea use landscape pattern based on GIS: a case study in Huludao, China.
Suo, Anning; Wang, Chen; Zhang, Minghui
2016-01-01
This study aims to analyse sea use landscape patterns on a regional scale based on methods of landscape ecology integrated with sea use spatial characteristics. Several landscape-level analysis indices, such as the dominance index, complex index, intensivity index, diversity index and sea congruency index, were established using Geographic Information System (GIS) and applied in Huludao, China. The results indicated that sea use landscape analysis indices, which were created based on the characteristics of sea use spatial patterns using GIS, are suitable to quantitatively describe the landscape patterns of sea use. They are operable tools for the landscape analysis of sea use. The sea use landscape in Huludao was dominated by fishing use with a landscape dominance index of 0.724. The sea use landscape is a complex mosaic with high diversity and plenty of fishing areas, as shown by the landscape complex index of 27.21 and the landscape diversity index of 1.25. Most sea use patches correspond to the marine functional zonation plan and the sea use congruency index is 0.89 in the fishing zone and 0.92 in the transportation zone.
Providing open-access online materials and hands-on sessions for GIS exercises
Oguchi, T.; Yamauchi, H.; Hayakawa, Y. S.
2017-12-01
Researchers of GIS (Geographical Information Systems/Sciences) in Japan have collaborated to provide materials for GIS lecture classes in universities for the last 20 years. The major outcomes include 1) a GIS core curriculum, 2) a GIS "body of knowledge" explaining the details of the curriculum, 3) a series of PowerPoint presentations, and 4) a comprehensive GIS textbook. However, materials for GIS exercises at university classes using GIS software have been limited in Japan. Therefore, we launched a project to provide such materials which will be available online and accessible by anybody. The materials cover broad basic aspects of GIS including geoscientific applications such as terrain analysis using digital elevation models. The materials utilize public-domain and open-source software packages such as QGIS and GRASS. The data used are also freely available ones such as those from the Geospatial Information Authority of Japan. The use of the GitHub platform to distribute the materials allow easier online interactions by both material producers and users. Selected sets of the materials have been utilized for hands-on activities including both official university classes and public instructions. We have been updating the materials based on the opinions of people who took the hands-on courses for better GIS education. The current materials are in Japanese, but we plan to translate some of them into English.
Georeferenced Population Datasets of Mexico (GEO-MEX): Urban Place GIS Coverage of Mexico
National Aeronautics and Space Administration — The Urban Place GIS Coverage of Mexico is a vector based point Geographic Information System (GIS) coverage of 696 urban places in Mexico. Each Urban Place is...
GIS-based methods for establishing the datafoundation for traffic models
DEFF Research Database (Denmark)
Nielsen, Otto Anker
1997-01-01
Traffic models demand large amounts of data - some of which are: Traffic network topology, traffic network data, zone-data and trip matrices. GIS is a natural tool for handling most of these data as it can ease the work process and improve the quality control. However, traffic models demand a com......-plex topology not very well covered by the traditional GIS-topology. The paper describes a number of applications where ARC/INFO and ArcView have been used to automate the process of building a traffic network topology. The methodology has been used on a number of full-scale models, from medium sized urban...... areas to metropolitan areas (Copenhagen, Denmark and Bandung, Indonesia). The paper covers key subjects in the work process which has been eased considerably by using AML and Avenue scripts or by using the information from ARC/INFO in external applications:· Semi-automatic procedures for attaching zones...
PBL-GIS in Secondary Geography Education: Does It Result in Higher-Order Learning Outcomes?
Liu, Yan; Bui, Elisabeth N.; Chang, Chew-Hung; Lossman, Hans G.
2010-01-01
This article presents research on evaluating problem-based learning using GIS technology in a Singapore secondary school. A quasi-experimental research design was carried to test the PBL pedagogy (PBL-GIS) with an experimental group of students and compare their learning outcomes with a control group who were exposed to PBL but not GIS. The…
Venous hemogasometry of equines finalists in 90 km endurance races
Directory of Open Access Journals (Sweden)
Cinthia B.S. Dumont
2014-06-01
Full Text Available Front of exercise, the organic systems may suffer water-electrolyte and acid-base imbalances, particularly in the case of blood gases, demonstrating variations from different causes, whether respiratory and/or metabolic. Understanding the physiological adaptations to exercise is essential in the search for the optimum performance. In this way, this study measured the venous blood gases (pO2, pCO2, as well as the oxygen saturation (SatO2 in healthy equines, Arabian horses finalists in 90km endurance races. A total of fourteen Arabian horses were evaluated, nine males and five females, between six and 12 years old, finalists in 90km endurance races. There was a significant reduction in pO2, pCO2 and SatO2 after the exercise, however, the values remained within the normality range, and did not change the athletic performance of the animals, indicating a temporary alteration, assuming thus a character of physiological response to the exercise performed. The equines, finalists in 90 Km endurance races, demonstrated efficient ventilatory process, without any alterations in the athletic performance, being adapted to the type of exercise imposed.
The development of a GIS atlas of southern African freshwater fish ...
African Journals Online (AJOL)
The development of a GIS atlas of southern African freshwater fish. LEP Scott, PH Skelton, AJ Booth, L Verheust. Abstract. A geographic information systems (GIS) based atlas of southern African freshwater fish has been developed for the SADC countries. The JLB Smith Institute of Ichthyology, in collaboration with ALCOM, ...
GIS Methodology for Planning Planetary-Rover Operations
Powell, Mark; Norris, Jeffrey; Fox, Jason; Rabe, Kenneth; Shu, I-Hsiang
2007-01-01
A document describes a methodology for utilizing image data downlinked from cameras aboard a robotic ground vehicle (rover) on a remote planet for analyzing and planning operations of the vehicle and of any associated spacecraft. Traditionally, the cataloging and presentation of large numbers of downlinked planetary-exploration images have been done by use of two organizational methods: temporal organization and correlation between activity plans and images. In contrast, the present methodology involves spatial indexing of image data by use of the computational discipline of geographic information systems (GIS), which has been maturing in terrestrial applications for decades, but, until now, has not been widely used in support of exploration of remote planets. The use of GIS to catalog data products for analysis is intended to increase efficiency and effectiveness in planning rover operations, just as GIS has proven to be a source of powerful computational tools in such terrestrial endeavors as law enforcement, military strategic planning, surveying, political science, and epidemiology. The use of GIS also satisfies the need for a map-based user interface that is intuitive to rover-activity planners, many of whom are deeply familiar with maps and know how to use them effectively in field geology.
Sensitivity of wildlife habitat models to uncertainties in GIS data
Stoms, David M.; Davis, Frank W.; Cogan, Christopher B.
1992-01-01
Decision makers need to know the reliability of output products from GIS analysis. For many GIS applications, it is not possible to compare these products to an independent measure of 'truth'. Sensitivity analysis offers an alternative means of estimating reliability. In this paper, we present a CIS-based statistical procedure for estimating the sensitivity of wildlife habitat models to uncertainties in input data and model assumptions. The approach is demonstrated in an analysis of habitat associations derived from a GIS database for the endangered California condor. Alternative data sets were generated to compare results over a reasonable range of assumptions about several sources of uncertainty. Sensitivity analysis indicated that condor habitat associations are relatively robust, and the results have increased our confidence in our initial findings. Uncertainties and methods described in the paper have general relevance for many GIS applications.
Kattaa, Bassam; Al-Fares, Walid; Al Charideh, Abdul Rahman
2010-05-01
Vulnerability assessment to delineate areas that are more susceptible to contamination from anthropogenic sources has become an important element for sensible resource management and landuse planning. This contribution aims at estimating aquifer vulnerability by applying the RISKE model in Banyas Catchment Area (BCA), Tartous Prefecture, west Syria. An additional objective is to demonstrate the combined use of the RISKE model and a geographical information system (GIS) as an effective method for groundwater pollution risk assessment. The RISKE model uses five environmental parameters (Rock of aquifer media, Infiltration, Soil media, Karst, and Epikarst) to characterize the hydro-geological setting and evaluate aquifer vulnerability. The elevated eastern and low western part of the study area was dominated by high vulnerability classes, while the middle part was characterized by moderate vulnerability classes. Based on the vulnerability analysis, it was found that 2% and 39% of BCA is under low and high vulnerability to groundwater contamination, respectively, while more than 52% and 5% of the area of BCA can be designated as an area of moderate and very high vulnerability to groundwater contamination, respectively. The GIS technique has provided an efficient environment for analyses and high capabilities of handling a large amount of spatial data. Copyright 2009 Elsevier Ltd. All rights reserved.
pLog enterprise-enterprise GIS-based geotechnical data management system enhancements.
2015-12-01
Recent eorts by the Louisiana Department of Transportation and Development (DOTD) and the : Louisiana Transportation Research Center (LTRC) have developed a Geotechnical Information : Database, with a Geographic Information System (GIS) interface....