WorldWideScience

Sample records for girasol helianthus annuus

  1. Efecto protector de Helianthus annuus (girasol sobre el infarto de miocardio en conejos Nueva Zelanda

    Directory of Open Access Journals (Sweden)

    Edith Guardia-Espinoza

    Full Text Available Objetivos. Determinar el efecto protector del aceite de Helianthus annuus (Girasol sobre el infarto de miocardio inducido con epinefrina en conejos Nueva Zelanda. Materiales y métodos. Los conejos fueron asignados aleatoriamente en cinco grupos (n= 8 por grupo: blanco, control negativo, experimental 1 (10 mg/kg, experimental 2 (20 mg/kg y experimental 3 (40 mg/kg. Los grupos experimentales 1, 2 y 3 recibieron aceite de Helianthus annuus durante dos semanas. La epinefrina (2 mg/Kg se administró a los grupos control negativo, experimentales 1, 2 y 3 durante dos días consecutivos con un intervalo de 24 h después del pretratamiento con aceite. Veinticuatro horas después de la última administración, los conejos fueron anestesiados y sacrificados. Se evaluaron los niveles séricos de troponina I y número de polimorfonucleares por μm2. Resultados. Se encontró diferencia significativa entre el grupo control negativo y los grupos experimentales 1, 2 y 3 en los variables niveles séricos de troponina I y número de polimorfonucleares por μm2. Conclusiones: El aceite de Helianthus annuus a dosis de 20 mg/kg tiene efecto protector sobre el infarto de miocardio inducido con epinefrina en conejos Nueva Zelanda

  2. Visitantes florales diurnos del girasol (Helianthus annuus, Asterales: Asteraceae en la Argentina

    Directory of Open Access Journals (Sweden)

    Juan P. TORRETTA

    2010-01-01

    Full Text Available El girasol ( Helianthus annuus L. es un importante cultivo oleaginoso en la Argentina. Durante tres campañas agrícolas, se determinaron la diversidad y la abundancia del elenco de los visitantes florales diurnos de capítulos de girasol, en ocho sitios que cubren gran parte del área cultivada en Argentina. Setenta y seis morfo-especies de visitantes florales, pertenecientes a ocho órdenes, fueron capturados sobre capítulos de este cultivo. El principal orden fue Hymenoptera, con 37 especies o morfo- especies, de las cuales 32 fueron abejas (Apoidea. Las familias de abejas más representadas fueron Apidae (13, Megachilidae (11 y Halictidae (7. La abeja doméstica ( Apis mellifera L. realizó el 93% de las visitas. La composición del elenco de visitantes no mostró un patrón de variación identificable a lo largo del día, ni con respecto a la distancia al borde del cultivo, pero varió entre sitios de muestreo. Se concluye que la abeja doméstica es el principal polinizador del girasol en la Argentina, aunque varias especies nativas de abejas ( Melissodes tintinnans (Holmberg, M. rufithorax Brèthes, Melissoptila tandilensis Holmberg, y Megachile spp. podrían ser consideradas como potenciales polinizadores del cultivo.

  3. Visitantes florales nocturnos del girasol (Helianthus annuus, Asterales: Asteraceae en la Argentina

    Directory of Open Access Journals (Sweden)

    Juan P TORRETTA

    2009-01-01

    Full Text Available El girasol (Helianthus annuus es un cultivo oleaginoso, polinizado por Apis mellifera L. y otras abejas en distintas regiones del mundo. Sin embargo, sus flores también son visitadas por insectos de actividad nocturna. Durante tres campañas agrícolas, se determinó la diversidad de los visitantes nocturnos de capítulos de girasol, en cinco sitios de Argentina. También se estudió el comportamiento de forrajeo de los principales visitantes y la variación de la receptividad estigmática a lo largo del día, con el fin de establecer si estos visitantes contribuyen a la polinización. Al menos 67 especies o morfoespecies pertenecientes a cuatro órdenes de visitantes nocturnos fueron colectadas. El orden más rico y abundante fue Lepidoptera (44 especies o morfoespecies, cinco familias, seguido por Coleoptera (18 especies o morfoespecies, nueve familias, Orthoptera (tres morfoespecies, una familia y Blattaria (dos especies, una familia. Los lepidópteros forrajearon exclusivamente por néctar, mientras que los individuos de los demás órdenes consumieron polen y/o partes florales. El estigma se encontró receptivo durante las horas de luz, con una receptividad máxima al mediodía (12:00 - 14:00. Llamativamente, las flores del girasol son visitadas por mayor número de polillas que de abejas. Debido a que las polillas consumen néctar y potencialmente transportan polen entre flores, en un momento del día en que los estigmas se encuentran menos receptivos, es improbable que polinicen efectivamente el cultivo.

  4. Visitantes florales diurnos del girasol (Helianthus annuus, Asterales: Asteraceae en la Argentina Diurnal floral visitors of sunflower (Helianthus annuus, Asterales: Asteraceae in Argentina

    Directory of Open Access Journals (Sweden)

    Juan P. Torretta

    2010-06-01

    Full Text Available El girasol (Helianthus annuus L. es un importante cultivo oleaginoso en la Argentina. Durante tres campañas agrícolas, se determinaron la diversidad y la abundancia del elenco de los visitantes florales diurnos de capítulos de girasol, en ocho sitios que cubren gran parte del área cultivada en Argentina. Setenta y seis morfo-especies de visitantes florales, pertenecientes a ocho órdenes, fueron capturados sobre capítulos de este cultivo. El principal orden fue Hymenoptera, con 37 especies o morfoespecies, de las cuales 32 fueron abejas (Apoidea. Las familias de abejas más representadas fueron Apidae (13, Megachilidae (11 y Halictidae (7. La abeja doméstica (Apis mellifera L. realizó el 93% de las visitas. La composición del elenco de visitantes no mostró un patrón de variación identificable a lo largo del día, ni con respecto a la distancia al borde del cultivo, pero varió entre sitios de muestreo. Se concluye que la abeja doméstica es el principal polinizador del girasol en la Argentina, aunque varias especies nativas de abejas (Melissodes tintinnans (Holmberg, M. rufithorax Brèthes, Melissoptila tandilensis Holmberg, y Megachile spp. podrían ser consideradas como potenciales polinizadores del cultivo.Sunflower (Helianthus annuus L. is an important oilseed crop in Argentina. During three agricultural years, the diversity and abundance of diurnal floral visitors of sunflower heads were determined in eight sites spanning much of this crop's cultivation area in Argentina. Seventysix morpho-species of floral visitors, belonging to eight orders, were captured on sunflower. The principal order was Hymenoptera, with 37 species or morpho-species, of which 32 were bees (Apoidea. The most represented bee families were Apidae (13, Megachilidae (11 and Halictidae (7. The domestic bee (Apis mellifera L. accounted for 93% of the visits. Floral visitor composition did not show an identifiable variation pattern either throughout the day or

  5. Visitantes florales nocturnos del girasol (Helianthus annuus, Asterales: Asteraceae en la Argentina Nocturnal floral visitors of sunflower (Helianthus annuus, Asterales: Asteraceae in Argentina

    Directory of Open Access Journals (Sweden)

    Juan P Torretta

    2009-12-01

    Full Text Available El girasol (Helianthus annuus es un cultivo oleaginoso, polinizado por Apis mellifera L. y otras abejas en distintas regiones del mundo. Sin embargo, sus flores también son visitadas por insectos de actividad nocturna. Durante tres campañas agrícolas, se determinó la diversidad de los visitantes nocturnos de capítulos de girasol, en cinco sitios de Argentina. También se estudió el comportamiento de forrajeo de los principales visitantes y la variación de la receptividad estigmática a lo largo del día, con el fin de establecer si estos visitantes contribuyen a la polinización. Al menos 67 especies o morfoespecies pertenecientes a cuatro órdenes de visitantes nocturnos fueron colectadas. El orden más rico y abundante fue Lepidoptera (44 especies o morfoespecies, cinco familias, seguido por Coleoptera (18 especies o morfoespecies, nueve familias, Orthoptera (tres morfoespecies, una familia y Blattaria (dos especies, una familia. Los lepidópteros forrajearon exclusivamente por néctar, mientras que los individuos de los demás órdenes consumieron polen y/o partes florales. El estigma se encontró receptivo durante las horas de luz, con una receptividad máxima al mediodía (12:00 - 14:00. Llamativamente, las flores del girasol son visitadas por mayor número de polillas que de abejas. Debido a que las polillas consumen néctar y potencialmente transportan polen entre flores, en un momento del día en que los estigmas se encuentran menos receptivos, es improbable que polinicen efectivamente el cultivo.Sunflower (Helianthus annuus is an oilseed crop pollinated by Apis mellifera L. and other diurnal bees in different regions of the world. However, their flowers are also visited by insects active at night. During three agricultural years, the diversity of nocturnal visitors to sunflower heads was assessed in five different sites in Argentina. The foraging behavior of the main visitors as well as the stigmatic receptivity variations along

  6. Evaluación in vitro del ensilaje de girasol (Helianthus annuus L. solo y combinado con ensilaje de maíz

    Directory of Open Access Journals (Sweden)

    Ramón Gonzalo Aragadvay-Yungán

    2015-01-01

    Full Text Available El ensilado de girasol forrajero (Helianthus annuus L. es promovido para la alimentación del ganado lechero anteescasez de riego y lluvias erráticas. El objetivo fue valorar al ensilado de girasol, solo y en diferentes proporcionescon ensilado de maíz mediante degradación in vitro y la cinética de producción de gas. Se realizaron micro-silos,abiertos a los 80 días para el ensilado de maíz (EMz y 50 días para el ensilado de girasol (EG, evaluándoselos siguientes tratamientos (EMz%: EG%; T1 100:0, T2 75:25, T3 50:50, T4 25:75 y T5 0:100. En el T2 la fibradetergente neutra y ácida disminuyeron significativamente (P0.05 similar a T1. Hubo mayor producción de gas total en T1, pero con una menor tasa de fermentación(P<0.05 al compararlo con T2 cuya tasa de fermentación fue de 0.0530/h, con un tiempo Lag de 3.4 h. El girasolaporta 31.8 % más de PC, 11.8 % menos de energía metabolizable y 11.9 % menos de digestibilidad in vitro.Comparado con el T1, el T2 aportó 1.6 % más de proteína, 2 % menos de energía metabolizable y 4.4 % menosde digestibilidad in vitro. Se concluye que el ensilado de girasol podría ser una alternativa para sustituir alensilado de maíz hasta un 25 %, ya que el aporte de proteína y energía es similar al ensilado de maíz solo.

  7. Helianthus annuus L

    Indian Academy of Sciences (India)

    moj

    contrasting water treatment conditions. Plant OMICS Journal 5, 149-158. Abdi A., Darvishzadeh R., Hatami Maleki H., Haddadi P. and Sarrafi A. 2013. Identification of quantitative trait loci for relative water content and chlorophyll concentration traits in recombinant inbred lines of sunflower (Helianthus annuus L.) under ...

  8. Sunflower (Helianthus annuus L.).

    Science.gov (United States)

    Radonic, Laura M; Lewi, Dalia M; López, Nilda E; Hopp, H Esteban; Escandón, Alejandro S; Bilbao, Marisa López

    2015-01-01

    Sunflower (Helianthus annuus L.) is still considered as a recalcitrant species to in vitro culture and transformation in spite of the publication of different protocols. Here we describe a routine transformation system of this crop which requires mature HA89 genotype seeds and Agrobacterium tumefaciens EHA105 strain for gene delivery, being both easily available. Selection of transformed shoots depends on root development in kanamycin-selective media, instead of shoot color, avoiding selection of escapes. The establishment of this protocol proved successful for the incorporation of both reporter and agronomic important genes and also for the evaluation of the specific expression patterns of different promoters in transgenic sunflower plants. Stable expression of the incorporated transgenes was confirmed by RT-PCR and GUS reporter gene visualization. Stable inheritance of transgenes was successfully followed until T2 generation in several independent lines.

  9. Producción de biomasa y rendimiento de semilla en la asociación girasol (Helianthus annuus L.)-frijol (Phaseolus vulgaris L.) en función del nitrógeno y fósforo

    OpenAIRE

    Edgar J. Morales Rosales

    2007-01-01

    En 2003 se realizó un estudio en Montecillo, Estado de México, para determinar el efecto de la aplicación de nitrógeno (0, 40 y 80 kg ha-1) y fósforo (0, 30 y 60 kg P2O5 ha-1) en la siembra combinada de girasol (cv. Victoria) y frijol (cv. Michoacán). Con el suministro de 80 kg N ha-1 (80 - 00 - 00) se incrementó la producción de biomasa y rendimiento de semilla superando al testigo sin fertilizante en 32% y 35%. Cuando se adicionaron 60 kg P2O5 ha-1 (00 - 60 - 00) se obtuvo una producción de...

  10. Potential allelopathic effects of sunflower ( Helianthus annuus L. ) on ...

    African Journals Online (AJOL)

    Potential allelopathic effects of sunflower (Helianthus annuus L.) cultivar Hysun 38 on Rhizobium, Azospirillum, and phosphate-solubilizing bacteria (PSB) were studied by applying oxidase, QTS tests and Gram staining. Microorganisms for the control group were isolated from soil sampled before sowing sunflower.

  11. Metabolic responses of two Helianthus annuus cultivars to different ...

    African Journals Online (AJOL)

    The present study was carried out to investigate the effect of sodium fluoride on two sunflower cultivars (Helianthus annuus (Fudek cv. and Earlyflower cv.) during germination and seedling growth stages. Increasing fluoride concentrations significantly decreased total protein and carbohydrate content, as well as amylase ...

  12. Transport of glutamine into the xylem of sunflower (Helianthus annuus).

    NARCIS (Netherlands)

    Findenegg, G.R.; Plaisier, W.; Posthumus, M.A.; Melger, W.C.

    1990-01-01

    Sunflower (Helianthus annuus L.) plants were grown on nutrient solution with ammonium nitrogen. After 12 days of growth the ammonium in the nutrient solution was labeled with N (99%). Three hours later glutamine-N in the xylem exudate was labeled for 56% as shown by GC-MS; this percentage increased

  13. Copia and Gypsy retrotransposons activity in sunflower (Helianthus annuus L.)

    Science.gov (United States)

    2009-01-01

    Background Retrotransposons are heterogeneous sequences, widespread in eukaryotic genomes, which refer to the so-called mobile DNA. They resemble retroviruses, both in their structure and for their ability to transpose within the host genome, of which they make up a considerable portion. Copia- and Gypsy-like retrotransposons are the two main classes of retroelements shown to be ubiquitous in plant genomes. Ideally, the retrotransposons life cycle results in the synthesis of a messenger RNA and then self-encoded proteins to process retrotransposon mRNA in double stranded extra-chromosomal cDNA copies which may integrate in new chromosomal locations. Results The RT-PCR and IRAP protocol were applied to detect the presence of Copia and Gypsy retrotransposon transcripts and of new events of integration in unstressed plants of a sunflower (Helianthus annuus L.) selfed line. Results show that in sunflower retrotransposons transcription occurs in all analyzed organs (embryos, leaves, roots, and flowers). In one out of sixty-four individuals analyzed, retrotransposons transcription resulted in the integration of a new element into the genome. Conclusion These results indicate that the retrotransposon life cycle is firmly controlled at a post transcriptional level. A possible silencing mechanism is discussed. PMID:20030800

  14. Natural Variation in Gene Expression Between Wild and Weedy Populations of Helianthus annuus

    OpenAIRE

    Lai, Zhao; Kane, Nolan C.; Zou, Yi; Rieseberg, Loren H.

    2008-01-01

    The molecular genetic changes underlying the transformation of wild plants into agricultural weeds are poorly understood. Here we use a sunflower cDNA microarray to detect variation in gene expression between two wild (non-weedy) Helianthus annuus populations from Utah and Kansas and four weedy H. annuus populations collected from agricultural fields in Utah, Kansas, Indiana, and California. When grown in a common growth chamber environment, populations differed substantially in their gene ex...

  15. Estudio genético y molecular del contenido en tocoferoles en semillas de girasol

    OpenAIRE

    Moral Navarrete, Lidia del

    2016-01-01

    El girasol (Helianthus annuus L.) es una planta herbácea anual de la familia Asteraceae, originaria del norte de América y cultivada como oleaginosa, alimenticia y ornamental en todo el mundo. El aceite de girasol es en la actualidad el cuarto aceite vegetal en términos de producción mundial detrás de la palma, soja y canola. El aceite de girasol es valorado por los consumidores de todo el mundo como un aceite muy saludable, a lo que contribuye su elevado contenido en vitamina ...

  16. Stem cankers on sunflower (Helianthus annuus) in Australia reveal a complex of pathogenic Diaporthe (Phomopsis) species

    NARCIS (Netherlands)

    Thompson, S.M.; Tan, Y.P.; Young, A.J.; Neate, S.M.; Aitken, E.A.B.; Shivas, R.G.

    2012-01-01

    The identification of Diaporthe (anamorph Phomopsis) species associated with stem canker of sunflower (Helianthus annuus) in Australia was studied using morphology, DNA sequence analysis and pathology. Phylogenetic analysis revealed three clades that did not correspond with known taxa, and these are

  17. Effect of wild Helianthus cytoplasms on agronomic and oil characteristics of cultivated sunflower (H. annuus L.)

    Science.gov (United States)

    Sunflower (Helianthus annuus L.) productions reliance on a single source of cytoplasmic male-sterility, PET1, derived from H. petiolaris Nutt., makes the crop genetically vulnerable. Twenty diverse cytoplasmic substitution lines from annual and perennial wild species were compared with the inbred li...

  18. Ecogeography and utility to plant breeding of the crop wild relatives of sunflower (Helianthus annuus L.).

    Science.gov (United States)

    Kantar, Michael B; Sosa, Chrystian C; Khoury, Colin K; Castañeda-Álvarez, Nora P; Achicanoy, Harold A; Bernau, Vivian; Kane, Nolan C; Marek, Laura; Seiler, Gerald; Rieseberg, Loren H

    2015-01-01

    Crop wild relatives (CWR) are a rich source of genetic diversity for crop improvement. Combining ecogeographic and phylogenetic techniques can inform both conservation and breeding. Geographic occurrence, bioclimatic, and biophysical data were used to predict species distributions, range overlap and niche occupancy in 36 taxa closely related to sunflower (Helianthus annuus L.). Taxa lacking comprehensive ex situ conservation were identified. The predicted distributions for 36 Helianthus taxa identified substantial range overlap, range asymmetry and niche conservatism. Specific taxa (e.g., Helianthus deblis Nutt., Helianthus anomalus Blake, and Helianthus divaricatus L.) were identified as targets for traits of interest, particularly for abiotic stress tolerance, and adaptation to extreme soil properties. The combination of techniques demonstrates the potential for publicly available ecogeographic and phylogenetic data to facilitate the identification of possible sources of abiotic stress traits for plant breeding programs. Much of the primary genepool (wild H. annuus) occurs in extreme environments indicating that introgression of targeted traits may be relatively straightforward. Sister taxa in Helianthus have greater range overlap than more distantly related taxa within the genus. This adds to a growing body of literature suggesting that in plants (unlike some animal groups), geographic isolation may not be necessary for speciation.

  19. Ecogeography and utility to plant breeding of the crop wild relatives of sunflower (Helianthus annuus L.

    Directory of Open Access Journals (Sweden)

    Michael Benjamin Kantar

    2015-10-01

    Full Text Available Crop wild relatives (CWR are a rich source of genetic diversity for crop improvement. Combining ecogeographic and phylogenetic techniques can inform both conservation and breeding. Geographic occurrence, bioclimatic, and biophysical data were used to predict species distributions, range overlap and niche occupancy in 36 taxa closely related to sunflower (Helianthus annuus L.. Taxa lacking comprehensive ex situ conservation were identified. The predicted distributions for 36 Helianthus taxa identified substantial range overlap and asymmetry and niche conservatism. Specific taxa (e.g., Helianthus deblis Nutt., Helianthus anomalus Blake, and Helianthus divaricatus L. were identified as targets for traits of interest, particularly for abiotic stress tolerance and adaptation to extreme soil properties. The combination of techniques demonstrates the potential for publicly available ecogeographic and phylogenetic data to facilitate the identification of possible sources of abiotic stress traits for plant breeding programs. Much of the primary genepool (wild H. annuus occurs in extreme environments indicating that introgression of targeted traits may be relatively straightforward. Sister taxa in Helianthus have greater range overlap than more distantly related taxa within the genus. This adds to a growing body of literature suggesting that in plants (unlike some animal groups, geographic isolation may not be necessary for speciation.

  20. Ecogeography and utility to plant breeding of the crop wild relatives of sunflower (Helianthus annuus L.)

    Science.gov (United States)

    Kantar, Michael B.; Sosa, Chrystian C.; Khoury, Colin K.; Castañeda-Álvarez, Nora P.; Achicanoy, Harold A.; Bernau, Vivian; Kane, Nolan C.; Marek, Laura; Seiler, Gerald; Rieseberg, Loren H.

    2015-01-01

    Crop wild relatives (CWR) are a rich source of genetic diversity for crop improvement. Combining ecogeographic and phylogenetic techniques can inform both conservation and breeding. Geographic occurrence, bioclimatic, and biophysical data were used to predict species distributions, range overlap and niche occupancy in 36 taxa closely related to sunflower (Helianthus annuus L.). Taxa lacking comprehensive ex situ conservation were identified. The predicted distributions for 36 Helianthus taxa identified substantial range overlap, range asymmetry and niche conservatism. Specific taxa (e.g., Helianthus deblis Nutt., Helianthus anomalus Blake, and Helianthus divaricatus L.) were identified as targets for traits of interest, particularly for abiotic stress tolerance, and adaptation to extreme soil properties. The combination of techniques demonstrates the potential for publicly available ecogeographic and phylogenetic data to facilitate the identification of possible sources of abiotic stress traits for plant breeding programs. Much of the primary genepool (wild H. annuus) occurs in extreme environments indicating that introgression of targeted traits may be relatively straightforward. Sister taxa in Helianthus have greater range overlap than more distantly related taxa within the genus. This adds to a growing body of literature suggesting that in plants (unlike some animal groups), geographic isolation may not be necessary for speciation. PMID:26500675

  1. Fytochemický výzkum Helianthus annuus L. II

    OpenAIRE

    Niedobová, Soňa

    2007-01-01

    OF THE DIPLOMA THESIS My diploma thesis was intended on phytochemical study of polar extract of Helianthus annuus L. leaves and simultaneously biological tests were done (so-called bioassay - guided separation) - acute toxicity, antioxidant activity (DPPH test, FRAP metod) and antifungal activity. The Fraction 29 showed the highest antioxidant activity. The Fraction 22-24/3, obtained by preparative chromatography, was analyzed by gas chromatography. This analysis shows present of the oil-acid...

  2. Accumulation of radioiodine from aqueous solution by hydroponically cultivated sunflower (Helianthus annuus L.)

    Czech Academy of Sciences Publication Activity Database

    Soudek, Petr; Tykva, Richard; Vaňková, Radomíra; Vaněk, Tomáš

    2006-01-01

    Roč. 57, č. 3 (2006), s. 220-225 ISSN 0098-8472 R&D Projects: GA MŠk(CZ) 1P05OC042 Institutional research plan: CEZ:AV0Z40550506; CEZ:AV0Z50380511 Keywords : radiophytoremediation * Helianthus annuus * radioiodine Subject RIV: DK - Soil Contamination ; De-contamination incl. Pesticides Impact factor: 1.820, year: 2006

  3. [Protective effect of Helianthus annuus (sunflower) on myocardial infarction in New Zealand rabbit].

    Science.gov (United States)

    Guardia-Espinoza, Edith; Herrera-Hurtado, Gianina Liseth del Carmen; Garrido-Jacobi, Saúl; Cárdenas-Peralta, Danitza; Martínez-Romero, Christian; Hernández-Figueroa, Pedro; Condori-Calizaya, Mary; La Barrera-Llacchua, Juan; Flores-Ángeles, Miguel

    2015-01-01

    Determine the protective effect of oil Helianthus annuus (Sunflower) on myocardial infarction induced by epinephrine in New Zealand rabbits. The rabbits were randomized into five groups (8 per group): blank, negative control, experimental 1 (10 mg / kg), experimental 2 (20 mg / kg) and three experimental (40 mg/ kg). Experimental groups 1, 2 and 3 received Helianthus annuus oil for two weeks. Epinephrine (2 mg/Kg) to the negative, Experimental Control 1, 2 and 3 groups was given over two consecutive days with an interval of 24 h after pretreatment with oil. Twenty four hours after the last administration, the rabbits were anesthetized and sacrificed. Serum troponin I and polymorphonuclear evaluated by .mu.m.sup.2. Significant difference between the negative control group and the experimental groups 1, 2 and 3 was found in the serum variables troponin I and polymorphonuclear by .mu.m.sup.2. Helianthus annuus oil at doses of 20 mg/kg has protective effect on myocardial infarction induced by epinephrine in New Zealand rabbits.

  4. A Kinetic Study of Marginal Soil Energy Plant Helianthus annuus Stalk Pyrolysis

    Directory of Open Access Journals (Sweden)

    Huaxiao Yan

    2013-01-01

    Full Text Available The pyrolytic characteristics and kinetics of new marginal soil energy plant Helianthus annuus stalk were investigated using thermogravimetric (TG method from 50 to 800°C in an inert argon atmosphere at different heating rates of 5, 10, 20, and 30°C min−1. The kinetic parameters of activation energy and pre-exponential factor were deduced by Popescu, Flynn-Wall-Ozawa (FWO, and Kissinger-Akahira-Sunose (KAS methods, respectively. The results showed that three stages appeared in the thermal degradation process. The primary devolatilization stage of H. annuus stalk can be described by the Avrami-Erofeev function (n=4. The average activation energy of H. annuus stalk was only 142.9 kJ mol−1. There were minor kinetic compensation effects between the pre-exponential factor and the activation energy. The results suggest that H. annuus stalk is suitable for pyrolysis, and more importantly, the experimental results and kinetic parameters provided useful information for the design of pyrolytic processing system using H. annuus stalk as feedstock.

  5. Phytoremediation of heavy metal copper (Cu2+) by sunflower (Helianthus annuus l.)

    Science.gov (United States)

    Mahardika, G.; Rinanti, A.; Fachrul, M. F.

    2018-01-01

    A study in microcosmic condition has been carried out to determine the effectiveness of Helianthus annuus as a hyperaccumulator plant for heavy metal, Copper (Cu2+), that exposed in the soil. Artificial pollutants containing Copper (Cu2+) 0, 60, 120, 180 ppm are exposed to uncontaminated soil. The 12-weeks old H. annuus seedling were grown in Cu2+ contaminated soil, with variations of absorption time 3, 6, and 9 weeks. Analysis of Cu2+ concentration on soil and H. annuus (root, stem, leaf) was analised by Atomic Absorbtion Spectrometry (AAS). H. annuus are capable for Cu2+ removal, and the highest removal of Cu2+ is 85.56%, the highest metal accumulation/bioconcentration factor (BCF) is 0.99 occurred at roots with 9 weeks of exposure time and the highest translocation factor (TF) is 0.71. This highest removal is five times better than absorption by stems and leaves. The results concluded, the use of H. annuus for phytoextraction of heavy metals Cu2+ in contaminated soil can be an alternative to the absorption of heavy metal Cu2+ with low concentration metals which is generally very difficult to do in physical-chemical removal.

  6. Allelopathic interaction of Jatropha curcas L. with Helianthus annuus L. and Zea mays L.

    Directory of Open Access Journals (Sweden)

    Paulo Sérgio Siberti da Silva

    2012-09-01

    Full Text Available The goals of this work were to evaluate the effect of the allelopathic interaction of Jatropha curcas with Helianthus annuus and Zea mays from root exudates, as well as to evaluate how these exudates influenced the seeds of these species. Four replicates were made with seeds that were germinated in germiteste paper, which was previously autoclaved. Dormancy of the H. annuus seeds was broken by pre-cooling them in a freezer for seven days at 5°C. Jatropha curcas seeds were cultivated for eight days in a germination chamber under a controlled temperature and photoperiod. These seedlings were then discarded and the same substrate was used to germinate 50 H. annuus seeds; only distilled water was used as the control. The root exudates of H. annuus tested on J. curcas and the allelopathic interaction between J. curcas and Z. mays were carried out using the same methodology. Statistical analysis indicated that J. curcas has an inhibitory effect on the time and average speed of germination of H. annuus seedlings and Z. mays has an inhibitory effect on the germination of the seeds of J. curcas.

  7. Effects of Salinity, Temperature, and Polyethylene Glycol on the Seed Germination of Sunflower (Helianthus annuus L.)

    OpenAIRE

    Luan, Zhihui; Xiao, Moxin; Zhou, Daowei; Zhang, Hongxiang; Tian, Yu; Wu, Yi; Guan, Bo; Song, Yantao

    2014-01-01

    Salinization has severe influences on agriculture in the whole world. The main aims of this work were to evaluate osmotic effect and ion effect of NaCl on seed germination of three sunflower (Helianthus annuus L.) cultivars interacting with three alternating temperature regimes and to select the most salt tolerant cultivars to plant in the saline region. Seeds were germinated in the isotonic NaCl and polyethylene glycol (PEG) solutions of −0.45, −0.90, −1.34, −1.79, and −2.24 MPa at 10 : 20, ...

  8. Toward a molecular cytogenetic map for cultivated sunflower (Helianthus annuus L.) by landed BAC/BIBAC clones

    Science.gov (United States)

    Conventional karyotypes and various genetic linkage maps have been established in sunflower (Helianthus annuus L., 2n=34). However, the relationship between linkage groups and individual chromosomes of sunflower remains unknown and has considerable relevance for the sunflower research community. Rec...

  9. Characterization of F1 interspecific hybrids between wild Helianthus annuus L. populations and cultivated sunflower

    Directory of Open Access Journals (Sweden)

    Terzić Sreten

    2006-01-01

    Full Text Available Phenotype, chromosomes pairing and pollen vitality were compared between parental populations and F1 hybrids of interspecific cross between Helianthus annuus L. and cultivated sunflower. The investigation of the simple sequence repeats (SSR polymorphism was also used to test the hybrid nature of F1 populations. The phenotypic traits of F1 hybrid plants were either closer to the wild species or intermediate. Irregular chromosome pairing was found in only 0 to 10% of meiocytes in the meiosis of F1 hybrid plants. Interspecific crosses were confirmed with SSR markers in all hybrid combinations. Alleles that were not present in parental DNA were frequently observed in F1 hybrids. That is additional evidence that those hybrid combinations were not produced by self-fertilization. The results suggest that SSR markers can be efficiently used for the F1 hybrid characterization in crosses between closely related species, in which, the changes of phenotype, meiosis and pollen vitality are not always significant.

  10. Seawater irrigation: antioxidant defence responses in leaves and roots of a sunflower (Helianthus annuus L.) ecotype.

    Science.gov (United States)

    Di Baccio, Daniela; Navari-Izzo, Flavia; Izzo, Riccardo

    2004-12-01

    Salinity is a widespread environmental stress for crop plants. It is common in arid, semiarid, and coast regions. In those environments, seawater infiltrations can occur or the sea provides the only source of water for irrigation. The effects of 10% and 20% seawater in nutrient solutions were studied in 30 day-old plants of sunflower (Helianthus annuus L.) ecotype Katharina Piacenza. Growth parameters, ascorbate and glutathione contents, and the activities of ascorbate peroxidase and glutathione reductase were determined in shoots and roots. The results showed antioxidative responses of the ecotype to both salt treatments. The different activity patterns of antioxidant molecules and enzymes in the leaves and roots suggested a different kind of reaction to the two seawater concentrations.

  11. Effects of gamma radiation on stem diameter growth, carbon gain and biomass partitioning in Helianthus annuus

    International Nuclear Information System (INIS)

    Thiede, M.E.; Link, S.O.; Fellows, R.J.; Beedlow, P.A.

    1995-01-01

    To determine the effects of gamma radiation on stem diameter growth, carbon gain, and biomass partitioning, 19-day-old dwarf sunflower plants (Helianthus annuus, variety NK894) were given variable doses (0–40 Gy) from a 60Co gamma source. Exposure of plants to gamma radiation caused a significant reduction in stem growth and root biomass. Doses as low as 5 Gy resulted in a significant increase in leaf density, suggesting that very low doses of radiation could induce morphological growth changes. Carbohydrate analysis of plants exposed to 40 Gy demonstrated significantly more starch content in leaves and significantly less in stems 18 days after exposure compared with control plants. In contrast, the carbohydrate content of the roots of plants exposed to 40 Gy was not significantly different from non-irradiated plants 18 days after exposure. (author)

  12. Isolation of Bioactive Compounds from Sunflower Leaves (Helianthus annuus L.) Extracted with Supercritical Carbon Dioxide.

    Science.gov (United States)

    El Marsni, Zouhir; Torres, Ascension; Varela, Rosa M; Molinillo, José M G; Casas, Lourdes; Mantell, Casimiro; Martinez de la Ossa, Enrique J; Macias, Francisco A

    2015-07-22

    The work described herein is a continuation of our initial studies on the supercritical fluid extraction (SFE) with CO2 of bioactive substances from Helianthus annuus L. var. Arianna. The selected SFE extract showed high activity in the wheat coleoptile bioassay, in Petri dish phytotoxicity bioassays, and in the hydroponic culture of tomato seeds. Chromatographic fractionations of the extracts and a spectroscopic analysis of the isolated compounds showed 52 substances belonging to 10 different chemical classes, which were mainly sesquiterpene lactones, diterpenes, and flavonoids. Heliannuol M (31), helivypolides K and L (36, 37), and helieudesmanolide B (38) are described for the first time in the literature. Metabolites have been tested in the etiolated wheat coleoptile bioassay with good results in a noteworthy effect on germination. The most active compounds were also tested on tomato seeds, heliannuol A (30) and leptocarpin (45) being the most active, with values similar to those of the commercial herbicide.

  13. Modulation of inflammatory responses by diterpene acids from Helianthus annuus L.

    Science.gov (United States)

    Díaz-Viciedo, Rodrigo; Hortelano, Sonsoles; Girón, Natalia; Massó, Jose M; Rodriguez, Benjamín; Villar, Angel; de Las Heras, Beatriz

    2008-05-02

    Fractionation of a petroleum ether extract of Helianthus annuus L. led to the isolation of three diterpene acids: grandiflorolic, kaurenoic and trachylobanoic acids. These compounds were studied for potential anti-inflammatory activity on the generation of inflammatory mediators in lipopolysaccharide (LPS)-activated RAW 264.7 macrophages. At non-toxic concentrations, these compounds reduced, in a concentration-dependent manner nitric oxide (NO), prostaglandin E(2) (PGE(2)) and tumor necrosis factor (TNF-alpha) production, as well as expression of inducible nitric oxide synthase (NOS-2) and cyclooxygenase-2 (COX-2). All diterpenoids displayed significant in vivo anti-inflammatory activity and suppressed the 12-O-tetradecanoylphorbol-13-acetate (TPA)-mouse ear edema. In addition, inhibition of myeloperoxidase (MPO) activity, an index of cellular infiltration, was observed. In summary, our results suggest that the inhibition of the expression of NOS-2, COX-2 and the release of inflammatory cytokines, is responsible for the anti-inflammatory effects of the diterpenoids isolated from H. annuus L. which likely contributes to the pharmacological action of sunflower.

  14. Response of sunflower (Helianthus annuus L.) leaf surface defenses to exogenous methyl jasmonate.

    Science.gov (United States)

    Rowe, Heather C; Ro, Dae-kyun; Rieseberg, Loren H

    2012-01-01

    Helianthus annuus, the common sunflower, produces a complex array of secondary compounds that are secreted into glandular trichomes, specialized structures found on leaf surfaces and anther appendages of flowers. The primary components of these trichome secretions are sesquiterpene lactones (STL), a diverse class of compounds produced abundantly by the plant family Compositae and believed to contribute to plant defense against herbivory. We treated wild and cultivated H. annuus accessions with exogenous methyl jasmonate, a plant hormone that mediates plant defense against insect herbivores and certain classes of fungal pathogens. The wild sunflower produced a higher density of glandular trichomes on its leaves than the cultivar. Comparison of the profiles of glandular trichome extracts obtained by liquid chromatography-mass spectroscopy (LC-MS) showed that wild and cultivated H. annuus were qualitatively similar in surface chemistry, although differing in the relative size and proportion of various compounds detected. Despite observing consistent transcriptional responses to methyl jasmonate treatment, we detected no significant effect on glandular trichome density or LC-MS profile in cultivated or wild sunflower, with wild sunflower exhibiting a declining trend in overall STL production and foliar glandular trichome density of jasmonate-treated plants. These results suggest that glandular trichomes and associated compounds may act as constitutive defenses or require greater levels of stimulus for induction than the observed transcriptional responses to exogenous jasmonate. Reduced defense investment in domesticated lines is consistent with predicted tradeoffs caused by selection for increased yield; future research will focus on the development of genetic resources to explicitly test the ecological roles of glandular trichomes and associated effects on plant growth and fitness.

  15. [Adaptability of Helianthus annuus seedlings to crude oil pollution in soil and its improvement measures under salinization stress].

    Science.gov (United States)

    Zhang, Jing-lei; Ci, Hua-cong; He, Xing-dong; Liang, Yu-ting; Zhao, Xuan; Sun, Hui-ting; Xie, Hong-tao

    2015-11-01

    To explore the adaptability of plant under salt stress to crude oil pollution of soil and improvement measures, a pot experiment of Helianthus annuus seedlings was conducted using orthogonal experiment method with crude oil-sodium chloride-desulfurization gypsum and cinder-zeolite-desulfurization gypsum-sawdust. The results showed that, with the increase of soil crude oil concentration, the relative growth rate (RGR) of plant height, RGR of aboveground biomass and root N: P ratios of H. annuus seedlings decreased significantly, while the activity of SOD and CAT increased at first and then decreased significantly. The RGR of plant height and aboveground biomass significantly increased (P salinization condition. The crude oil pollution of soil could decrease the relative growth rate of H. annuus seedling, and sawdust could reduce the influence of crude oil pollution on plant growth under salt stress.

  16. Metal accumulation by sunflower (Helianthus annuus L.) and the efficacy of its biomass in enzymatic saccharification.

    Science.gov (United States)

    Dhiman, Saurabh Sudha; Zhao, Xin; Li, Jinglin; Kim, Dongwook; Kalia, Vipin C; Kim, In-Won; Kim, Jae Young; Lee, Jung-Kul

    2017-01-01

    Accumulation of metal contaminants in soil as a result of various industrial and anthropogenic activities has reduced soil fertility significantly. Phytoextraction of metal contaminants can improve soil fertility and provide inexpensive feedstock for biorefineries. We investigated the hyperaccumulation capacity of sunflower (Helianthus annuus) biomass by cultivating these plants in various concentrations of metal contaminants. Sunflowers were grown in soils contaminated with various levels of heavy metals (10-2,000 mg/kg dry soil). The degree of metal uptake by different parts of the biomass and the residual concentration in the soil were estimated through inductively coupled plasma mass spectrometry. An almost 2.5-fold hyperaccumulation of Zn2+ was observed in the leaf and flower biomass compared with the concentration in the soil. For the subsequent saccharification of biomass with hyperaccumulated contaminants, a fungal lignocellulosic consortium was used. The fungal consortium cocktail retained more than 95% filter paper activity with 100 mM Ni2+ ions even after 36 h. The highest saccharification yield (SY, 87.4%) was observed with Ni2+ as the contaminant (10 mg/kg dry wt), whereas Pb2+ (251.9 mg/kg dry wt) was the strongest inhibitor of biomass hydrolysis, resulting in only a 30% SY. Importantly, the enzyme cocktail produced by the fungal consortium resulted in almost the same SY (%) as that obtained from a combination of commercial cellulase and β-glucosidase. Significant sugar conversion (61.7%) from H. annuus biomass hydrolysate occurred, resulting in the production of 11.4 g/L of bioethanol. This is the first study to assess the suitability of phytoremediated sunflower biomass for bioethanol production.

  17. Sunflower (Helianthus annuus) fatty acid synthase complex: enoyl-[acyl carrier protein]-reductase genes.

    Science.gov (United States)

    González-Thuillier, Irene; Venegas-Calerón, Mónica; Garcés, Rafael; von Wettstein-Knowles, Penny; Martínez-Force, Enrique

    2015-01-01

    Enoyl-[acyl carrier protein]-reductases from sunflower. A major factor contributing to the amount of fatty acids in plant oils are the first steps of their synthesis. The intraplastidic fatty acid biosynthetic pathway in plants is catalysed by type II fatty acid synthase (FAS). The last step in each elongation cycle is carried out by the enoyl-[ACP]-reductase, which reduces the dehydrated product of β-hydroxyacyl-[ACP] dehydrase using NADPH or NADH. To determine the mechanisms involved in the biosynthesis of fatty acids in sunflower (Helianthus annuus) seeds, two enoyl-[ACP]-reductase genes have been identified and cloned from developing seeds with 75 % identity: HaENR1 (GenBank HM021137) and HaENR2 (HM021138). The two genes belong to the ENRA and ENRB families in dicotyledons, respectively. The genetic duplication most likely originated after the separation of di- and monocotyledons. RT-qPCR revealed distinct tissue-specific expression patterns. Highest expression of HaENR1 was in roots, stems and developing cotyledons whereas that of H a ENR2 was in leaves and early stages of seed development. Genomic DNA gel blot analyses suggest that both are single-copy genes. In vivo activity of the ENR enzymes was tested by complementation experiments with the JP1111 fabI(ts) E. coli strain. Both enzymes were functional demonstrating that they interacted with the bacterial FAS components. That different fatty acid profiles resulted infers that the two Helianthus proteins have different structures, substrate specificities and/or reaction rates. The latter possibility was confirmed by in vitro analysis with affinity-purified heterologous-expressed enzymes that reduced the crotonyl-CoA substrate using NADH with different V max.

  18. Initial transitions, order and disorder in phyllotactic patterns: the ontogeny of Helianthus annuus: a case study

    Directory of Open Access Journals (Sweden)

    Yves Couder

    2014-01-01

    Full Text Available The variability of the phyllotactic organization of Helianthus annuus L. is investigated. Specimens exhibiting the various possible phyllotactic modes (Fibonacci spirals, Lucas spirals, bijugate spirals etc... were selected. The transitions from the initial decussate growth to these organizations, were characterized and shown to correspond to only a few archetypes. The possible transients from a decussate mode were then investigated in the model of self organization introduced by Douady and Couder (1996a, b, c. They are shown to exhibit the same phenomenology as the observed ones. These various transients have a very different probability of ccurrence which explains the difference of their frequency in plants. Finally the imperfections of the observed dispositions, which affect mainly the plastochron, are also investigated. The model provides an interpretation of this apparent disorder: after a transition the system optimizes the regularity of the parastichies but in doing so it disturbs the plastochron and the divergence. It is only when very large external disturbances affect the system that a real disorder is generated. In these latter cases the parastichies themselves disappear.

  19. Effects of salinity, temperature, and polyethylene glycol on the seed germination of sunflower (Helianthus annuus L.).

    Science.gov (United States)

    Luan, Zhihui; Xiao, Moxin; Zhou, Daowei; Zhang, Hongxiang; Tian, Yu; Wu, Yi; Guan, Bo; Song, Yantao

    2014-01-01

    Salinization has severe influences on agriculture in the whole world. The main aims of this work were to evaluate osmotic effect and ion effect of NaCl on seed germination of three sunflower (Helianthus annuus L.) cultivars interacting with three alternating temperature regimes and to select the most salt tolerant cultivars to plant in the saline region. Seeds were germinated in the isotonic NaCl and polyethylene glycol (PEG) solutions of -0.45, -0.90, -1.34, -1.79, and -2.24 MPa at 10:20, 15:25, and 20:30 °C temperature regimes. Both NaCl and PEG inhibited germination, but the effects of NaCl were less as compared to that of PEG, which means that adverse effects of PEG on germination were due to osmotic effect rather than specific ion accumulation. For the three cultivars, higher germination occurred at 10:20 °C in NaCl treatments and at 20:30 °C in the isotonic PEG treatments. Among the three cultivars, Sandaomei (SDM) is the most tolerant to salt and PEG stress.

  20. Effects of Salinity, Temperature, and Polyethylene Glycol on the Seed Germination of Sunflower (Helianthus annuus L.

    Directory of Open Access Journals (Sweden)

    Zhihui Luan

    2014-01-01

    Full Text Available Salinization has severe influences on agriculture in the whole world. The main aims of this work were to evaluate osmotic effect and ion effect of NaCl on seed germination of three sunflower (Helianthus annuus L. cultivars interacting with three alternating temperature regimes and to select the most salt tolerant cultivars to plant in the saline region. Seeds were germinated in the isotonic NaCl and polyethylene glycol (PEG solutions of −0.45, −0.90, −1.34, −1.79, and −2.24 MPa at 10 : 20, 15 : 25, and 20 : 30°C temperature regimes. Both NaCl and PEG inhibited germination, but the effects of NaCl were less as compared to that of PEG, which means that adverse effects of PEG on germination were due to osmotic effect rather than specific ion accumulation. For the three cultivars, higher germination occurred at 10 : 20°C in NaCl treatments and at 20 : 30°C in the isotonic PEG treatments. Among the three cultivars, Sandaomei (SDM is the most tolerant to salt and PEG stress.

  1. Soil-less bioassays for early screening for resistance to imazapyr in sunflower (Helianthus annuus L.).

    Science.gov (United States)

    Vega, Tatiana; Breccia, Gabriela; Nestares, Graciela; Mayor, María Laura; Zorzoli, Roxana; Picardi, Liliana

    2009-09-01

    Rapid and efficient diagnostic tests for early screening of herbicide resistance are convenient alternatives to field screening methods. There is a need for a quick, reliable and cost-effective method for rapid diagnosis of imidazolinone resistance in sunflower (Helianthus annuus L.). Two seed germination bioassays were developed. Seeds from three sunflower inbred lines differing in resistance to imidazolinones were germinated either on solid culture medium or placed in plastic pots filled with commercial perlite. After 8 days incubation under controlled conditions, both assays successfully distinguished susceptible genotype from the resistant and intermediate ones. The susceptible genotype showed arrested root growth at all herbicide treatments (root length resistant genotype developed a complete root system even when exposed to the highest dose of herbicide. However, no definite differences were observed for the intermediate and resistant genotypes with respect to root growth under the different herbicide treatments. The simple and rapid screening assays described in the present study were useful in discriminating imidazolinone resistance at the seedling stage. Therefore, these bioassays could be potential tools for early screening of imidazolinone resistance genes from large sunflower populations. Copyright 2009 Society of Chemical Industry.

  2. Direct Analyses of Secondary Metabolites by Mass Spectrometry Imaging (MSI) from Sunflower (Helianthus annuus L.) Trichomes.

    Science.gov (United States)

    Brentan Silva, Denise; Aschenbrenner, Anna-Katharina; Lopes, Norberto Peporine; Spring, Otmar

    2017-05-10

    Helianthus annuus (sunflower) displays non-glandular trichomes (NGT), capitate glandular trichomes (CGT), and linear glandular trichomes (LGT), which reveal different chemical compositions and locations in different plant tissues. With matrix-assisted laser desorption/ionization (MALDI) and laser desorption/ionization (LDI) mass spectrometry imaging (MSI) techniques, efficient methods were developed to analyze the tissue distribution of secondary metabolites (flavonoids and sesquiterpenes) and proteins inside of trichomes. Herein, we analyzed sesquiterpene lactones, present in CGT, from leaf transversal sections using the matrix 2,5-dihydroxybenzoic acid (DHB) and α-cyano-4-hydroxycinnamic acid (CHCA) (mixture 1:1) with sodium ions added to increase the ionization in positive ion mode. The results observed for sesquiterpenes and polymethoxylated flavones from LGT were similar. However, upon desiccation, LGT changed their shape in the ionization source, complicating analyses by MSI mainly after matrix application. An alternative method could be applied to LGT regions by employing LDI (without matrix) in negative ion mode. The polymethoxylated flavones were easily ionized by LDI, producing images with higher resolution, but the sesquiterpenes were not observed in spectra. Thus, the application and viability of MALDI imaging for the analyses of protein and secondary metabolites inside trichomes were confirmed, highlighting the importance of optimization parameters.

  3. Phomopsis Stem Canker: A Reemerging Threat to Sunflower (Helianthus annuus) in the United States.

    Science.gov (United States)

    Mathew, Febina M; Alananbeh, Kholoud M; Jordahl, James G; Meyer, Scott M; Castlebury, Lisa A; Gulya, Thomas J; Markell, Samuel G

    2015-07-01

    Phomopsis stem canker causes yield reductions on sunflower (Helianthus annuus L.) on several continents, including Australia, Europe, and North America. In the United States, Phomopsis stem canker incidence has increased 16-fold in the Northern Great Plains between 2001 and 2012. Although Diaporthe helianthi was assumed to be the sole causal agent in the United States, a newly described species, D. gulyae, was found to be the primary cause of Phomopsis stem canker in Australia. To determine the identity of Diaporthe spp. causing Phomopsis stem canker in the Northern Great Plains, 275 infected stems were collected between 2010 and 2012. Phylogenetic analyses of sequences of the ribosomal DNA internal transcribed spacer region, elongation factor subunit 1-α, and actin gene regions of representative isolates, in comparison with those of type specimens, confirmed two species (D. helianthi and D. gulyae) in the United States. Differences in aggressiveness between the two species were determined using the stem-wound method in the greenhouse; overall, D. helianthi and D. gulyae did not vary significantly (P≤0.05) in their aggressiveness at 10 and 14 days after inoculation. These findings indicate that both Diaporthe spp. have emerged as sunflower pathogens in the United States, and have implications on the management of this disease.

  4. Combined linkage and association mapping of flowering time in Sunflower (Helianthus annuus L.).

    Science.gov (United States)

    Cadic, Elena; Coque, Marie; Vear, Felicity; Grezes-Besset, Bruno; Pauquet, Jerôme; Piquemal, Joël; Lippi, Yannick; Blanchard, Philippe; Romestant, Michel; Pouilly, Nicolas; Rengel, David; Gouzy, Jerôme; Langlade, Nicolas; Mangin, Brigitte; Vincourt, Patrick

    2013-05-01

    Association mapping and linkage mapping were used to identify quantitative trait loci (QTL) and/or causative mutations involved in the control of flowering time in cultivated sunflower Helianthus annuus. A panel of 384 inbred lines was phenotyped through testcrosses with two tester inbred lines across 15 location × year combinations. A recombinant inbred line (RIL) population comprising 273 lines was phenotyped both per se and through testcrosses with one or two testers in 16 location × year combinations. In the association mapping approach, kinship estimation using 5,923 single nucleotide polymorphisms was found to be the best covariate to correct for effects of panel structure. Linkage disequilibrium decay ranged from 0.08 to 0.26 cM for a threshold of 0.20, after correcting for structure effects, depending on the linkage group (LG) and the ancestry of inbred lines. A possible hitchhiking effect is hypothesized for LG10 and LG08. A total of 11 regions across 10 LGs were found to be associated with flowering time, and QTLs were mapped on 11 LGs in the RIL population. Whereas eight regions were demonstrated to be common between the two approaches, the linkage disequilibrium approach did not detect a documented QTL that was confirmed using the linkage mapping approach.

  5. Sunflower (Helianthus annuus L.) as a pre-Columbian domesticate in Mexico

    Science.gov (United States)

    Lentz, David L.; Pohl, Mary DeLand; Alvarado, José Luis; Tarighat, Somayeh; Bye, Robert

    2008-01-01

    Mexico has long been recognized as one of the world's cradles of domestication with evidence for squash (Cucurbita pepo) cultivation appearing as early as 8,000 cal B.C. followed by many other plants, such as maize (Zea mays), peppers (Capsicum annuum), common beans (Phaseolus vulgaris), and cotton (Gossypium hirsutum). We present archaeological, linguistic, ethnographic, and ethnohistoric data demonstrating that sunflower (Helianthus annuus) had entered the repertoire of Mexican domesticates by ca. 2600 cal B.C., that its cultivation was widespread in Mexico and extended as far south as El Salvador by the first millennium B.C., that it was well known to the Aztecs, and that it is still in use by traditional Mesoamerican cultures today. The sunflower's association with indigenous solar religion and warfare in Mexico may have led to its suppression after the Spanish Conquest. The discovery of ancient sunflower in Mexico refines our knowledge of domesticated Mesoamerican plants and adds complexity to our understanding of cultural evolution. PMID:18443289

  6. Μetal Uptake by Sunflower (Helianthus annuus) Irrigated with Water Polluted with Chromium and Nickel.

    Science.gov (United States)

    Stoikou, Vasiliki; Andrianos, Vangelis; Stasinos, Sotiris; Kostakis, Marios G; Attiti, Sofia; Thomaidis, Nikolaos S; Zabetakis, Ioannis

    2017-07-17

    The water aquifers of the regions of Asopos River in Viotia and Messapia in Evia (Greece) have been contaminated with hexavalent chromium (Cr (VI)) and bivalent nickel (Ni (II)). Given that these areas are the two biggest tuber producing regions of Greece, in our previous work, the cross-contamination of the food chain with these two heavy metals was quantified. In the present study, the potential of sunflower ( Helianthus annuus ) cultivation in these regions is evaluated. The scope of our study was to investigate the uptake of chromium and nickel by sunflower, in a greenhouse experiment. The study included two cultivation periods of plants in six irrigation lines with different levels of Cr (VI) and Ni (II) ranging from 0 μg/L (control) to 10,000 μg/L. In all plant parts, statistically significant increased levels of Cr (VI) and Ni (II) were found when compared to control ones. Also, a positive correlation, both for Cr and Ni, between levels of heavy metals in irrigation water and plants was observed. Following European Food Safety Authority recommendations, the obtained oil was evaluated as safe for consumption, therefore, sunflower cultivation could be a valid bioremediation solution for the Asopos and Messapia regions.

  7. Effects of sewage sludge fertilizer on heavy metal accumulation and consequent responses of sunflower (Helianthus annuus).

    Science.gov (United States)

    Belhaj, Dalel; Elloumi, Nada; Jerbi, Bouthaina; Zouari, Mohamed; Abdallah, Ferjani Ben; Ayadi, Habib; Kallel, Monem

    2016-10-01

    Use of sewage sludge, a biological residue produced from sewage treatment processes in agriculture, is an alternative disposal technique of waste. To study the usefulness of sewage sludge amendment for Helianthus annuus, a pot experiment was conducted by mixing sewage sludge at 2.5, 5, and 7.5 % (w/w) amendment ratios to the agricultural soil. Soil pH decreased whereas electrical conductivity, organic matter, total N, available P, and exchangeable Na, K, and Ca increased in soil amended with sewage sludge in comparison to unamended soil. Sewage sludge amendment led to significant increase in Pb, Ni, Cu, Cr, and Zn concentrations of soil. The increased concentration of heavy metals in soil due to sewage sludge amendment led to increases in shoot and root concentrations of Cr, Cu, Ni, and Zn in plant as compared to those grown on unamended soil. Accumulation was more in roots than shoots for most of the heavy metals. Moreover, high metal removal for the harvestable parts of the crops was recorded. Sewage sludge amendment increased root and shoot length, leaves number, biomass, and antioxidant activities of sunflower. Significant increases in the activities of antioxidant enzymes and in the glutathione, proline, and soluble sugar content in response to amendment with sewage sludge may be defense mechanisms induced in response to heavy metal stress. Graphical abstract Origin, fate and behavior of sewage sludge fertilizer.

  8. A time-series phytoremediation experiment with sunflowers (Helianthus annuus on a former uranium mining site

    Directory of Open Access Journals (Sweden)

    Kötschau A.

    2013-04-01

    Full Text Available On a test field situated at a former uranium mining site near Ronneburg (Thuringia, Germany a small scale time-series field experiment with sunflowers (Helianthus annuus was carried out. This area ghas elevated contents for the heavy metals Cd, Co, Cr, Cu, Ni, Zn including the radionuclides U and Th. Over a time period of 24 weeks the sunflowers were cultivated on homogenized soil substrate and regularly harvested. The aim was to find the ideal moment to harvest the sunflowers, being defined as having the best balance between the extraction of the contaminants and a high biomass produced. The contents of the elements were determined in soil, roots and above-ground plant parts. The contents in the above-ground plant showed no clear increasing or decreasing trend over time, so they were not the appropriate values to determine the best moment to harvest. Instead the total extracted masses (content in μg/g x biomass in g of the contaminants in the above-ground plant parts were calculated. According to this the best moment to harvest the sunflower plants was reached after 24 weeks of vegetation, because the highest extracted masses for all contaminants were calculated to this time. Additionally the biomass, which could be used e.g. for bio-fuel production, was highest at this time.

  9. Ectopic expression of the HAM59 gene causes homeotic transformations of reproductive organs in sunflower (Helianthus annuus L.).

    Science.gov (United States)

    Shulga, O A; Neskorodov, Ya B; Shchennikova, A V; Gaponenko, A K; Skryabin, K G

    2015-01-01

    The function of the HAM59 MADS-box gene in sunflower (Helianthus annuus L.) was studied to clarify homeotic C activity in the Asteraceae plant family. For the first time, transgenic sunflower plants with a modified pattern of HAM59 expression were obtained. It was shown that the HAM59 MADS-box transcription factor did mediate C activity in sunflower. In particular, it participated in termination of the floral meristem, repression of the cadastral function of A-activity, and together with other C-type sunflower protein HAM45-in the specification of the identity of stamens and pistils.

  10. Identification of candidate genes associated with leaf senescence in cultivated sunflower (Helianthus annuus L..

    Directory of Open Access Journals (Sweden)

    Sebastian Moschen

    Full Text Available Cultivated sunflower (Helianthus annuus L., an important source of edible vegetable oil, shows rapid onset of senescence, which limits production by reducing photosynthetic capacity under specific growing conditions. Carbon for grain filling depends strongly on light interception by green leaf area, which diminishes during grain filling due to leaf senescence. Transcription factors (TFs regulate the progression of leaf senescence in plants and have been well explored in model systems, but information for many agronomic crops remains limited. Here, we characterize the expression profiles of a set of putative senescence associated genes (SAGs identified by a candidate gene approach and sunflower microarray expression studies. We examined a time course of sunflower leaves undergoing natural senescence and used quantitative PCR (qPCR to measure the expression of 11 candidate genes representing the NAC, WRKY, MYB and NF-Y TF families. In addition, we measured physiological parameters such as chlorophyll, total soluble sugars and nitrogen content. The expression of Ha-NAC01, Ha-NAC03, Ha-NAC04, Ha-NAC05 and Ha-MYB01 TFs increased before the remobilization rate increased and therefore, before the appearance of the first physiological symptoms of senescence, whereas Ha-NAC02 expression decreased. In addition, we also examined the trifurcate feed-forward pathway (involving ORE1, miR164, and ethylene insensitive 2 previously reported for Arabidopsis. We measured transcription of Ha-NAC01 (the sunflower homolog of ORE1 and Ha-EIN2, along with the levels of miR164, in two leaves from different stem positions, and identified differences in transcription between basal and upper leaves. Interestingly, Ha-NAC01 and Ha-EIN2 transcription profiles showed an earlier up-regulation in upper leaves of plants close to maturity, compared with basal leaves of plants at pre-anthesis stages. These results suggest that the H. annuus TFs characterized in this work could

  11. Identification of candidate genes associated with leaf senescence in cultivated sunflower (Helianthus annuus L.).

    Science.gov (United States)

    Moschen, Sebastian; Bengoa Luoni, Sofia; Paniego, Norma B; Hopp, H Esteban; Dosio, Guillermo A A; Fernandez, Paula; Heinz, Ruth A

    2014-01-01

    Cultivated sunflower (Helianthus annuus L.), an important source of edible vegetable oil, shows rapid onset of senescence, which limits production by reducing photosynthetic capacity under specific growing conditions. Carbon for grain filling depends strongly on light interception by green leaf area, which diminishes during grain filling due to leaf senescence. Transcription factors (TFs) regulate the progression of leaf senescence in plants and have been well explored in model systems, but information for many agronomic crops remains limited. Here, we characterize the expression profiles of a set of putative senescence associated genes (SAGs) identified by a candidate gene approach and sunflower microarray expression studies. We examined a time course of sunflower leaves undergoing natural senescence and used quantitative PCR (qPCR) to measure the expression of 11 candidate genes representing the NAC, WRKY, MYB and NF-Y TF families. In addition, we measured physiological parameters such as chlorophyll, total soluble sugars and nitrogen content. The expression of Ha-NAC01, Ha-NAC03, Ha-NAC04, Ha-NAC05 and Ha-MYB01 TFs increased before the remobilization rate increased and therefore, before the appearance of the first physiological symptoms of senescence, whereas Ha-NAC02 expression decreased. In addition, we also examined the trifurcate feed-forward pathway (involving ORE1, miR164, and ethylene insensitive 2) previously reported for Arabidopsis. We measured transcription of Ha-NAC01 (the sunflower homolog of ORE1) and Ha-EIN2, along with the levels of miR164, in two leaves from different stem positions, and identified differences in transcription between basal and upper leaves. Interestingly, Ha-NAC01 and Ha-EIN2 transcription profiles showed an earlier up-regulation in upper leaves of plants close to maturity, compared with basal leaves of plants at pre-anthesis stages. These results suggest that the H. annuus TFs characterized in this work could play important

  12. Root water transport of Helianthus annuus L. under iron oxide nanoparticle exposure.

    Science.gov (United States)

    Martínez-Fernández, Domingo; Barroso, Didac; Komárek, Michael

    2016-01-01

    The application of nanomaterials in commercially available products is increasing rapidly for agriculture, phytoremediation and biotechnology. Since plants suppose the first sink for the accumulation of nanoparticles from the environment, emerging studies have focused on the general consequences for plants and their effects on the biomass production. However, effects on the root surface, as well as blockage of nutrients and water uptake by the roots, may also occur. This experiment was designed to prove if the plant water relations can be affected by the adsorption of nanoparticles on the root surface, causing a consequent stress for the plants. With this goal, plants of Helianthus annuus were previously grown in a hydroponic culture, and at age of 55 days, their roots were exposed to three different concentrations of nanomaghemite (NM) in the hydroponic solution for 5 days: control without NM; 50 and 100 mg l(-1) NM. The main effect was related to the reduction of the root hydraulic conductivity (Lo) and the nutrients uptake. The concentrations of the macronutrients Ca, K, Mg and S in the shoot were reduced relative to the control plants, which resulted in lower contents of chlorophyll pigments. Although stress was not detected in the plants, after the analysis of stress markers like the accumulation of proline or ascorbate in the tissues, reduction of the root functionality by nanoparticles has been identified here, manifested as the effect of NM on Lo. The treatment with 50 mg l(-1) NM significantly reduced the Lo, by up to 57% of its control value, and it was reduced by up to 26% at 100 mg l(-1) NM. These results will be an important factor to take into account with regard to the applicability of NM for long-term use in crops, particularly during privative water conditions.

  13. The sunflower (Helianthus annuus L.) genome reflects a recent history of biased accumulation of transposable elements.

    Science.gov (United States)

    Staton, S Evan; Bakken, Bradley H; Blackman, Benjamin K; Chapman, Mark A; Kane, Nolan C; Tang, Shunxue; Ungerer, Mark C; Knapp, Steven J; Rieseberg, Loren H; Burke, John M

    2012-10-01

    Aside from polyploidy, transposable elements are the major drivers of genome size increases in plants. Thus, understanding the diversity and evolutionary dynamics of transposable elements in sunflower (Helianthus annuus L.), especially given its large genome size (∼3.5 Gb) and the well-documented cases of amplification of certain transposons within the genus, is of considerable importance for understanding the evolutionary history of this emerging model species. By analyzing approximately 25% of the sunflower genome from random sequence reads and assembled bacterial artificial chromosome (BAC) clones, we show that it is composed of over 81% transposable elements, 77% of which are long terminal repeat (LTR) retrotransposons. Moreover, the LTR retrotransposon fraction in BAC clones harboring genes is disproportionately composed of chromodomain-containing Gypsy LTR retrotransposons ('chromoviruses'), and the majority of the intact chromoviruses contain tandem chromodomain duplications. We show that there is a bias in the efficacy of homologous recombination in removing LTR retrotransposon DNA, thereby providing insight into the mechanisms associated with transposable element (TE) composition in the sunflower genome. We also show that the vast majority of observed LTR retrotransposon insertions have likely occurred since the origin of this species, providing further evidence that biased LTR retrotransposon activity has played a major role in shaping the chromatin and DNA landscape of the sunflower genome. Although our findings on LTR retrotransposon age and structure could be influenced by the selection of the BAC clones analyzed, a global analysis of random sequence reads indicates that the evolutionary patterns described herein apply to the sunflower genome as a whole. © 2012 The Authors. The Plant Journal © 2012 Blackwell Publishing Ltd.

  14. Association mapping in sunflower (Helianthus annuus L.) reveals independent control of apical vs. basal branching.

    Science.gov (United States)

    Nambeesan, Savithri U; Mandel, Jennifer R; Bowers, John E; Marek, Laura F; Ebert, Daniel; Corbi, Jonathan; Rieseberg, Loren H; Knapp, Steven J; Burke, John M

    2015-03-11

    Shoot branching is an important determinant of plant architecture and influences various aspects of growth and development. Selection on branching has also played an important role in the domestication of crop plants, including sunflower (Helianthus annuus L.). Here, we describe an investigation of the genetic basis of variation in branching in sunflower via association mapping in a diverse collection of cultivated sunflower lines. Detailed phenotypic analyses revealed extensive variation in the extent and type of branching within the focal population. After correcting for population structure and kinship, association analyses were performed using a genome-wide collection of SNPs to identify genomic regions that influence a variety of branching-related traits. This work resulted in the identification of multiple previously unidentified genomic regions that contribute to variation in branching. Genomic regions that were associated with apical and mid-apical branching were generally distinct from those associated with basal and mid-basal branching. Homologs of known branching genes from other study systems (i.e., Arabidopsis, rice, pea, and petunia) were also identified from the draft assembly of the sunflower genome and their map positions were compared to those of associations identified herein. Numerous candidate branching genes were found to map in close proximity to significant branching associations. In sunflower, variation in branching is genetically complex and overall branching patterns (i.e., apical vs. basal) were found to be influenced by distinct genomic regions. Moreover, numerous candidate branching genes mapped in close proximity to significant branching associations. Although the sunflower genome exhibits localized islands of elevated linkage disequilibrium (LD), these non-random associations are known to decay rapidly elsewhere. The subset of candidate genes that co-localized with significant associations in regions of low LD represents the most

  15. Pollen aroma fingerprint of two sunflower (Helianthus annuus L.) genotypes characterized by different pollen colors.

    Science.gov (United States)

    Bertoli, Alessandra; Fambrini, Marco; Doveri, Silvia; Leonardi, Michele; Pugliesi, Claudio; Pistelli, Luisa

    2011-09-01

    Samples of fresh pollen grains, collected from capitula in full bloom from two genotypes of sunflower (Helianthus annuus L.) and characterized by a different color, i.e., white-cream (WC) and orange (O), were analyzed by the HS-SPME (headspacesolid phase microextraction)/GC/MS technique. This study defined for the first time the fingerprint of the sunflower pollen, separated from the disc flowers, to define its contribution to the inflorescence aroma. In the GC/MS fingerprints of the WC and O genotypes, 61 and 62 volatile compounds were identified, respectively. Monoterpene hydrocarbons (34% in O vs. 28% in WC) and sesquiterpene hydrocarbons (37% in O vs. 31% in WC) were ubiquitous in all samples analyzed and represented the main chemical classes. α-Pinene (21% in O vs. 20% in WC) and sabinene (11% in O vs. 6% in WC) were the dominant volatiles, but also a full range of aliphatic hydrocarbons and their oxygenated derivatives gave a decisive contribution to the aroma composition (10% in O vs. 12% in WC). In addition, dendrolasin (3% in O vs. 4% in WC) and some minor constituents such as (E)-hex-2-en-1-ol (0.4% in O vs. 0.1% in WC) were pointed out not only for their contribution to the pollen scent, but also for their well-known role in the plant ecological relationships. Having evaluated two pollen morphs with different carotenoid-based colors, the study sought to highlight also the presence of some volatile precursors or derivatives of these pigments in the aroma. However, the pollen aroma of the two selected genotypes made a specific chemical contribution to the sunflower inflorescence scent without any influence on carotenoid derivatives. 2011 Verlag Helvetica Chimica Acta AG, Zürich.

  16. Physiology and proteomics of drought stress acclimation in sunflower (Helianthus annuus L.).

    Science.gov (United States)

    Fulda, S; Mikkat, S; Stegmann, H; Horn, R

    2011-07-01

    An easy and manageable in vitro screening system for drought tolerance of sunflower seedlings based on MS media supplemented with polyethylene glycol 6000 was evaluated. Morphological and physiological parameters were compared between control (-0.05 MPa) and drought-stressed (-0.6 MPa) seedlings of Helianthus annuus L. cv. Peredovick. There was a significant growth deficit in drought-stressed plants compared to control plants in terms of hypocotyl length, and shoot and root fresh mass. Shoot growth was more restricted than root growth, resulting in an increased root/shoot ratio of drought-stressed plants. Accumulation of osmolytes such as inositol (65-fold), glucose (58-fold), proline (55-fold), fructose (11-fold) and sucrose (eightfold), in leaves of drought-stressed plants could be demonstrated by gas-liquid chromatography. Soluble protein patterns of leaves were analysed with two-dimensional gel electrophoresis (2D-PAGE) and MALDI-TOF mass spectrometry. A set of 46 protein spots allowed identification of 19 marker proteins. Quantitative changes in protein expression of drought-stressed versus control plants were detected. In leaves of drought-stressed sunflower seedlings six proteins were significantly up-regulated more than twofold: a putative caffeoyl-CoA 3-O-methyltransferase (4.5-fold), a fructokinase 3 (3.3-fold), a vegetative storage protein (2.5-fold), a glycine-rich RNA binding protein (2.2-fold), a CuZn-superoxide dismutase (2.1-fold) and an unknown low molecular weight protein (2.3-fold). These proteins represent general stress proteins induced under drought conditions or proteins contributing to basic carbon metabolism. The up-regulated proteins are interesting candidates for further physiological and molecular investigations regarding drought tolerance in sunflower. © 2011 German Botanical Society and The Royal Botanical Society of the Netherlands.

  17. C15 FUNCTIONALIZED DERIVATIVES OF ent-KAUR-16-EN-19-OIC ACID: ISOLATION FROM THE SUNFLOWER HELIANTHUS ANNUUS L. AND SYNTHESIS

    Directory of Open Access Journals (Sweden)

    Marina Grinco

    2010-06-01

    Full Text Available The known diterpenic ester – 15α-angeloyl-ent-kaur-16-en-19-oic (angeloylgrandifl oric acid has been isolated from the dry wastes of Helianthus annuus L. The synthesis of 15α-hydroxy- and 15-oxo-ent-kaur-16-en-19- oic acids starting from ent-kaur-16-en-19-oic acid has been performed.

  18. MÉXICO: CENTRO DE ORIGEN DE LA DOMESTICACIÓN DEL GIRASOL

    Directory of Open Access Journals (Sweden)

    Robert Bye

    2009-01-01

    Full Text Available Hasta hace poco tiempo, el origen geográfico del girasol domesticado (Helianthus annuus había sido reportado en el área del sureste de los Estados Unidos de América. El análisis de documentos históricos de México y "semillas" arqueológicas recientemente descubiertas en Tabasco y Morelos, México, indican que los girasoles cultivados fueron importantes durante la época prehispánica y del virreinato en el centro de México. Cabe mencionar que los aquenios prehistóricos más grandes y más antiguos son de México. Aunque hoy en día las plantas silvestres son genéticamente distantes de los cultivares comerciales contemporáneos, las evidencias indican que México es el centro de origen más antiguo.

  19. Response to salinity in the homoploid hybrid species Helianthus paradoxus and its progenitors H. annuus and H. petiolaris

    Science.gov (United States)

    Karrenberg, Sophie; Edelist, Cécile; Lexer, Christian; Rieseberg, Loren

    2008-01-01

    Summary To contribute to the understanding of ecological differentiation in speciation, we compared salinity responses of the halophytic diploid hybrid species Helianthus paradoxus and its glycophytic progenitors Helianthus annuus and Helianthus petiolaris. Plants of three populations of each species were subjected to a control (nonsaline) and three salinity treatments, including one simulating the ion composition in the habitat of H. paradoxus. Relative to the control, saline treatments led to a 17% biomass increase in H. paradoxus while its progenitors suffered 19–33% productivity reductions and only in H. paradoxus, leaf contents of potassium, calcium, and magnesium were strongly reduced. Under all treatments, H. paradoxus allocated more resources to roots, was more succulent, and had higher leaf contents of sodium (> 200 mmol l−1 tissue water) and sulfur than its progenitor species. These results suggest that salt tolerance and thus speciation of H. paradoxus is related to sodium replacing potassium, calcium and magnesium as vacuolar osmotica. The evolutionary and genetic mechanisms likely to be involved are discussed. PMID:16626481

  20. Sunflower (Helianthus annuus) fatty acid synthase complex: β-hydroxyacyl-[acyl carrier protein] dehydratase genes.

    Science.gov (United States)

    González-Thuillier, Irene; Venegas-Calerón, Mónica; Sánchez, Rosario; Garcés, Rafael; von Wettstein-Knowles, Penny; Martínez-Force, Enrique

    2016-02-01

    Two sunflower hydroxyacyl-[acyl carrier protein] dehydratases evolved into two different isoenzymes showing distinctive expression levels and kinetics' efficiencies. β-Hydroxyacyl-[acyl carrier protein (ACP)]-dehydratase (HAD) is a component of the type II fatty acid synthase complex involved in 'de novo' fatty acid biosynthesis in plants. This complex, formed by four intraplastidial proteins, is responsible for the sequential condensation of two-carbon units, leading to 16- and 18-C acyl-ACP. HAD dehydrates 3-hydroxyacyl-ACP generating trans-2-enoyl-ACP. With the aim of a further understanding of fatty acid biosynthesis in sunflower (Helianthus annuus) seeds, two β-hydroxyacyl-[ACP] dehydratase genes have been cloned from developing seeds, HaHAD1 (GenBank HM044767) and HaHAD2 (GenBank GU595454). Genomic DNA gel blot analyses suggest that both are single copy genes. Differences in their expression patterns across plant tissues were detected. Higher levels of HaHAD2 in the initial stages of seed development inferred its key role in seed storage fatty acid synthesis. That HaHAD1 expression levels remained constant across most tissues suggest a housekeeping function. Heterologous expression of these genes in E. coli confirmed both proteins were functional and able to interact with the bacterial complex 'in vivo'. The large increase of saturated fatty acids in cells expressing HaHAD1 and HaHAD2 supports the idea that these HAD genes are closely related to the E. coli FabZ gene. The proposed three-dimensional models of HaHAD1 and HaHAD2 revealed differences at the entrance to the catalytic tunnel attributable to Phe166/Val1159, respectively. HaHAD1 F166V was generated to study the function of this residue. The 'in vitro' enzymatic characterization of the three HAD proteins demonstrated all were active, with the mutant having intermediate K m and V max values to the wild-type proteins.

  1. Molecular tagging of a novel rust resistance gene R(12) in sunflower (Helianthus annuus L.).

    Science.gov (United States)

    Gong, L; Hulke, B S; Gulya, T J; Markell, S G; Qi, L L

    2013-01-01

    Sunflower production in North America has recently suffered economic losses in yield and seed quality from sunflower rust (Puccinia helianthi Schwein.) because of the increasing incidence and lack of resistance to new rust races. RHA 464, a newly released sunflower male fertility restorer line, is resistant to both of the most predominant and most virulent rust races identified in the Northern Great Plains of the USA. The gene conditioning rust resistance in RHA 464 originated from wild Helianthus annuus L., but has not been molecularly marked or determined to be independent from other rust loci. The objectives of this study are to identify molecular markers linked to the rust resistance gene and to investigate the allelism of this gene with the unmapped rust resistance genes present in HA-R6, HA-R8 and RHA 397. Virulence phenotypes of seedlings for the F(2) population and F(2:3) families suggested that a single dominant gene confers rust resistance in RHA 464, and this gene was designated as R(12). Bulked segregant analysis identified ten markers polymorphic between resistant and susceptible bulks. In subsequent genetic mapping, the ten markers covered 33.4 cM of genetic distance on linkage group 11 of sunflower. A co-dominant marker CRT275-11 is the closest marker distal to R(12) with a genetic distance of 1.0 cM, while ZVG53, a dominant marker linked in the repulsion phase, is proximal to R(12) with a genetic distance of 9.6 cM. The allelism test demonstrated that R(12) is not allelic to the rust resistance genes in HA-R6, HA-R8 and RHA 397, and it is also not linked to any previously mapped rust resistance genes. Discovery of the R(12) novel rust resistance locus in sunflower and associated markers will potentially support the molecular marker-assisted introgression and pyramiding of R(12) into sunflower breeding lines.

  2. Linearity assumption in soil-to-plant transfer factors of natural uranium and radium in Helianthus annuus L

    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez, P. Blanco [Departamento de Fisica, Facultad de Ciencias, Universidad de Extremadura, 06071 Badajoz (Spain); Tome, F. Vera [Departamento de Fisica, Facultad de Ciencias, Universidad de Extremadura, 06071 Badajoz (Spain)]. E-mail: fvt@unex.es; Fernandez, M. Perez [Area de Ecologia, Departamento de Fisica, Facultad de Ciencias, Universidad de Extremadura, 06071 Badajoz (Spain); Lozano, J.C. [Laboratorio de Radiactividad Ambiental, Facultad de Ciencias, Universidad de Salamanca, 37008 Salamanca (Spain)

    2006-05-15

    The linearity assumption of the validation of soil-to-plant transfer factors of natural uranium and {sup 226}Ra was tested using Helianthus annuus L. (sunflower) grown in a hydroponic medium. Transfer of natural uranium and {sup 226}Ra was tested in both the aerial fraction of plants and in the overall seedlings (roots and shoots). The results show that the linearity assumption can be considered valid in the hydroponic growth of sunflowers for the radionuclides studied. The ability of sunflowers to translocate uranium and {sup 226}Ra was also investigated, as well as the feasibility of using sunflower plants to remove uranium and radium from contaminated water, and by extension, their potential for phytoextraction. In this sense, the removal percentages obtained for natural uranium and {sup 226}Ra were 24% and 42%, respectively. Practically all the uranium is accumulated in the roots. However, 86% of the {sup 226}Ra activity concentration in roots was translocated to the aerial part.

  3. Influence of silver and titanium nanoparticles on arbuscular mycorrhizal colonization and accumulation of radiocaesium in Helianthus annuus

    Energy Technology Data Exchange (ETDEWEB)

    Dubchak, S.; Ogar, A.; Mietelski, J. W.; Turnau, K.

    2010-07-01

    The influence of albacore's mycorrhizal fungus on {sup 1}34Cs uptake by Helianthus annuus was studied in a pilot study under growth chamber conditions. Mycorrhizal plants took up five times more {sup 1}34Cs (up to 250,000 Bq kg{sup -}1 dry weight) than non mycorrhizal plants. Silver and titanium nanoparticles, supplied into the surface soil layer decreased both the mycorrhizal colonization and Cs uptake by mycorrhizal plants. The application of activated carbon attenuated the effect of nanoparticles and increased {sup 1}34Cs uptake in the presence of mycorrhizal fungi (up to 400,000 Bq kg{sup -}1 dry weight). The results underline the possible application of phyto remediation techniques based on mycorrhizas assisted plants in decontamination of both radionuclides and nanoparticles. (Author) 27 refs.

  4. Aromatic Plants growing in Nigeria: Essential Oil Constituents of Cassia alata (Linn. Roxb. and Helianthus annuus L.

    Directory of Open Access Journals (Sweden)

    Yusuff O. Kamil

    2010-10-01

    Full Text Available The volatile constituents identified from the leaves of two Nigerian plants are being reported. The oil samples were obtained from the studied plant species by hydrodistillation using a Clevenger apparatus and then subsequently analyzed for their constituents by gas chromatography (GC and gas chromatography coupled with mass spectrometry (GC/MS. The quantitatively significant constituents of the leaf oil of Cassia alata (Linn. Roxb., (Fabaceae were 1, 8-cineole (39.8%, β-caryophyllene (19.1% and caryophyllene oxide (12.7%. Limonene (5.2%, germacrene D (5.5% and α-selinene (5.4% constituted the other significant compounds present in the oil. T he sunflower oil, Helianthus annuus L., (Asteraceae was rich in α-pinene (16.0%, germacrene D (14.4%, sabinene (9.4% and 14-hydroxy-α-muurolene (9.0%.

  5. Linearity assumption in soil-to-plant transfer factors of natural uranium and radium in Helianthus annuus L

    International Nuclear Information System (INIS)

    Rodriguez, P. Blanco; Tome, F. Vera; Fernandez, M. Perez; Lozano, J.C.

    2006-01-01

    The linearity assumption of the validation of soil-to-plant transfer factors of natural uranium and 226 Ra was tested using Helianthus annuus L. (sunflower) grown in a hydroponic medium. Transfer of natural uranium and 226 Ra was tested in both the aerial fraction of plants and in the overall seedlings (roots and shoots). The results show that the linearity assumption can be considered valid in the hydroponic growth of sunflowers for the radionuclides studied. The ability of sunflowers to translocate uranium and 226 Ra was also investigated, as well as the feasibility of using sunflower plants to remove uranium and radium from contaminated water, and by extension, their potential for phytoextraction. In this sense, the removal percentages obtained for natural uranium and 226 Ra were 24% and 42%, respectively. Practically all the uranium is accumulated in the roots. However, 86% of the 226 Ra activity concentration in roots was translocated to the aerial part

  6. Agronomic performance and chemical response of sunflower (Helianthus annuus L. to some organic nitrogen sources and conventional nitrogen fertilizers under sandy soil conditions

    Directory of Open Access Journals (Sweden)

    Ramadan, Mohamed Fawzy

    2009-03-01

    Full Text Available Sunflower (Helianthus annuus L. is an option for oilseed production, particularly in dry land areas due to good root system development. In this study, two field experiments were performed in the El-Khattara region (Sharkia Governorate, Egypt during the 2005 season. The objective of this research was to determine the effect of organicnitrogen (ON sources and their combinations as well as to compare the effect of ON and ammonium sulfate (AS as a conventional fertilizer added individually or in combination on growth, yield components, oil percentage and the uptake of some macronutrients by sunflowers grown on sandy soil. The treatments of chicken manure (CM and a mixture of farmyard manure (FYM with CM were superior to the other treatments and gave the highest yield, dry matter yield, NPK uptake by plants at all growth stages along with seed yield at the mature stage. The effect of the different ON on crop yield and its components may follow the order; CM> palma residues (PR> FYM. This was more emphasized when the materials were mixed with AS at a ratio of 3:1 and 1:1. The uptake of nitrogen (N, phosphorus (P and potassium (K by plants was affected by the addition of different N sources and treatments. The highest nutrient content and uptake by straw were obtained when treated with CM followed by PR at all growth stages, while it was PR followed by CM for seeds. Oil recovery was shown to respond to the N supply and the changes in individual fatty acids were not statistically different. However, it seems that the application of organic fertilizers resulted in an increase in total unsaturated fatty acids compared to the control.El girasol (Helianthus annuus es una opción para la producción de semillas oleaginosas, en particular en terrenos arenosos debido al buen desarrollo de sus raíces. En este trabajo, dos estudios de campo fueron realizados en la región de El-Ishattara (Sharkia Governorate, Egypt durante la estación 2005. El efecto de

  7. In vitro mutagenicity assay (Ames test and phytochemical characterization of seeds oil of Helianthus annuus Linné (sunflower

    Directory of Open Access Journals (Sweden)

    Nelma de Mello Silva Oliveira

    Full Text Available The objective of this research was to investigate the genotoxic potential of the oil of H. annuus L. (sunflower seeds via the Ames test as well as its oxidative properties and lipid composition. The pre-incubation method, system metabolic activation (S9 fraction and five S. typhimurium strains (TA97, TA98, TA100, TA1535 and TA102 were employed for the Ames test. The oxidative stability and fatty acid composition were analyzed by standard methods and gas chromatography. A revertant analysis showed no significant differences between the treatment doses (10–200 μl/plate and the negative controls, regardless of S9+ and S9−, and included all of the S. typhimurium strains. Chromatographic analysis showed high levels of polyunsaturated fatty acids, followed by monounsaturated, saturated and total trans-isomers. Among the polyunsaturated, monounsaturated and saturated fatty acids, linoleic, oleic and palmitic acids predominated. The results suggest that the sunflower oil is not genotoxic as indicated by frameshift mutations and base pair substitutions regardless of the treatment dose, but shows dose-dependent toxicity. The oxidative properties of the sunflower oil were consistent with the requirements of national and international standards. However, its composition could also indicate phytotherapeutic properties. Keywords: Helianthus annuus L., Sunflower oil, Genetic toxicity, Gas chromatography

  8. Detection of herbicide effects on pigment composition and PSII photochemistry in Helianthus annuus by Raman spectroscopy and chlorophyll a fluorescence

    Science.gov (United States)

    Vítek, Petr; Novotná, Kateřina; Hodaňová, Petra; Rapantová, Barbora; Klem, Karel

    2017-01-01

    The effects of herbicides from three mode-of-action groups - inhibitors of protoporphyrinogen oxidase (carfentrazone-ethyl), inhibitors of carotenoid biosynthesis (mesotrione, clomazone, and diflufenican), and inhibitors of acetolactate synthase (amidosulfuron) - were studied in sunflower plants (Helianthus annuus). Raman spectroscopy, chlorophyll fluorescence (ChlF) imaging, and UV screening of ChlF were combined to evaluate changes in pigment composition, photosystem II (PSII) photochemistry, and non-photochemical quenching in plant leaves 6 d after herbicide application. The Raman signals of phenolic compounds, carotenoids, and chlorophyll were evaluated and differences in their intensity ratios were observed. Strongly augmented relative content of phenolic compounds was observed in the case of amidosulfuron-treated plants, with a simultaneous decrease in the chlorophyll/carotenoid intensity ratio. The results were confirmed by in vivo measurement of flavonols using UV screening of ChlF. Herbicides from the group of carotenoid biosynthesis inhibitors significantly decreased both the maximum quantum efficiency of PSII and non-photochemical quenching as determined by ChlF. Resonance Raman imaging (mapping) data with high resolution (150,000-200,000 spectra) are presented, showing the distribution of carotenoids in H. annuus leaves treated by two of the herbicides acting as inhibitors of carotenoid biosynthesis (clomazone or diflufenican). Clear signs were observed that the treatment induced carotenoid depletion within sunflower leaves. The depletion spatial pattern registered differed depending on the type of herbicide applied.

  9. Acumulación de NPK por el girasol (Helianthus annuus L. en un Mollisol del Valle del Cauca

    Directory of Open Access Journals (Sweden)

    Ortiz R. Gloria

    1992-12-01

    Full Text Available

    A field experiment was conducted to determine macronutrient concentration and amount of NPK absorbed by the different parts of the sunflower plant. The soil used was of the Palmira Serie (PL classified as Pachic Haplustol of clay-loam texture, pH 6.4, 3.0% O.M., 63.9 ppm of P and 0.43 meq of K/100g of soil. The comercial hybrid DO- 664 was used, leaf, stem, bud, capitulum and seed samples wer taken 20, 40, 60 and 80 days post-emergence, chemicaly analized and N, P, K concentration determined. Results indicated more nitrogen concentration (3.19% in leaves and potassium (5.4% in the stems 40 days after emergence, while  phosphorus (0.96% was greatest in seed at 80 days. The order of absortion of the elements at 80 days in kg/ha was: K, 166.2; N, 69.2 and P, 16.7. This indicates that N and P fertilization should be fractionated up to day 40, while for K up to day 60.

    El estudio se realizó en un suelo de la serie Palmira (PL, clasificado como Pachic Haplustol, de textura francoarcillosa, pH 6.4, 3.0% de materia orgánica, 63.9 ppm de P y 0.43 meq de K/l00 g de suelo. Se utilizó el híbrido comercial DO-664 adelantando muestreos de hojas, tallos, botones, capítulos y semillas a los 20, 40, 60 Y 80 días después de la emergencia, analizándose químicamente y determinándose la concentración de N, P y K. Los resultados indicaron mayor concentración de nitrógeno (3.19% en hojas y de potasio (5.4% en tallos a los 40 días de emergencia, mientras que el fósforo (0.96% fué en la semilla a los 80 días. La  secuencia de absorción de elementos a los 80 días en kg/ha fue de 166.2 para potasio, 69.2 para nitrógeno y 16.7 para fósforo, indicando que para fertilizar con N y P se debe fraccionar el producto hasta los 40 días, mientras que para K hasta los 60 días.

  10. Triploid Production from Interspecific Crosses of Two Diploid Perennial Helianthus with Diploid Cultivated Sunflower (Helianthus annuus L.).

    Science.gov (United States)

    Liu, Zhao; Seiler, Gerald J; Gulya, Thomas J; Feng, Jiuhuan; Rashid, Khalid Y; Cai, Xiwen; Jan, Chao-Chien

    2017-04-03

    Wild Helianthus species are a valuable genetic resource for the improvement of cultivated sunflower. We report the discovery and characterization of a unique high frequency production of triploids when cultivated sunflower was pollinated by specific accessions of diploid Helianthus nuttallii T. & G. and H. maximiliani Schr. Genomic in situ hybridization (GISH) analyses indicated that the triploid F 1 s had two genomes from the wild pollen sources and one from the cultivated line. Mitotic chromosome analyses indicated that the frequency of triploid progenies from the crosses of cultivated lines × H. nuttallii accession 102 (N102) was significantly higher than those of unexpected polyploid progenies from the crosses of wild perennial species × N102, and no unexpected polyploids were obtained from the reverse crosses. Pollen stainability analysis suggested the existence of a low percentage of unreduced (2 n ) male gametes in some accessions, especially N102 and H. maximiliani accession 1113 (M1113), which were generated at the telophase II and tetrad stages of meiosis. The triploid F 1 s could be the results of preferred fertilization of the low frequency of 2 n male gametes with the female gametes of the cultivated sunflower, due to the dosage factors related to recognition and rejection of foreign pollen during fertilization. The triploids have been used to produce amphiploids and aneuploids. Future studies of the male gametes' fate from pollination through fertilization will further uncover the mechanism of this whole genome transmission. Studies of the genetic control of this trait will facilitate research on sunflower polyploidy speciation and evolution, and the utilization of this trait in sunflower breeding. Copyright © 2017 Liu et al.

  11. THE EFFECTS OF GAMMA RADIATION ON CRUDE OIL YIELD AND GERMINATION OF SUNFLOWER-TANAY VARIETY (HELIANTHUS ANNUUS L. SEEDS

    Directory of Open Access Journals (Sweden)

    H. E. VAİZOĞULLAR

    2014-06-01

    Full Text Available This study was conducted to investigate the effects of gamma rays on crude oil yield, seedling growth, germination and antimicrobial activity of sunflower (Helianthus annuus. As plant materials, sunflower variety Tanay seeds were used and irradiated with doses of 0 (control, 100, 200, 300, 400 and 500 Gy gamma radiation. Irradiation was performed in a cesium (Ce137 Gammacell 3000 Elan source, dose rate about 9.75 Gy/min (2900 Ci in the Pamukkale University Faculty of Medicine in the department of the radiological.To determine seed viability, tetrazolium chloride (TTC test was performed. Moisture amount of seeds were also measured by AOCS standarts and seeds were subjected to germination tests. The seeds were treated with 100 ppm doses of GA3 for 24 hours (GA, soaking for 24 hours (SB, preheating for 24 hours in a week (PH and precooling for 24 hours in a week (PC for optimization of germination.The result showed that the highest crude oil yield was also obtained from 400 Gy. As a result of testing of seed viability, 95% viability in seeds was determined. In 12L/12D light photoperiod, 25% germination in seeds was detected at GA application the highest, the lowest 5% germination in seeds was determined in PC application. It was found that minimum and maximum values ranged between 5.72and 10.81% for humidity rate.Extraction of the seed of Sunflower-Tanay was done with soxhlet apparatus using petroleum ether by hot continuous extraction for 6 hours. Antimicrobial activity of Sunflower-Tanay extract were tested by a disk diffusion method. Extracts of the H.annuus L.(sunflower-Tanay showed no antimicrobial activity against M.luteus NCIMB 13267 and E. coli ATCC 25922.

  12. Rhizofiltration using sunflower (Helianthus annuus L.) and bean (Phaseolus vulgaris L. var. vulgaris) to remediate uranium contaminated groundwater

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Minhee, E-mail: heelee@pknu.ac.kr [Department of Environmental Geosciences, Pukyong National University, 599-1 Daeyondong, Namgu, Busan 608-737 (Korea, Republic of); Yang, Minjune [Department of Environmental Geosciences, Pukyong National University, 599-1 Daeyondong, Namgu, Busan 608-737 (Korea, Republic of)

    2010-01-15

    The uranium removal efficiencies of rhizofiltration in the remediation of groundwater were investigated in lab-scale experiments. Sunflower (Helianthus annuus L.) and bean (Phaseolus vulgaris L. var. vulgaris) were cultivated and an artificially uranium contaminated solution and three genuine groundwater samples were used in the experiments. More than 80% of the initial uranium in solution and genuine groundwater, respectively, was removed within 24 h by using sunflower and the residual uranium concentration of the treated water was lower than 30 {mu}g/L (USEPA drinking water limit). For bean, the uranium removal efficiency of the rhizofiltration was roughly 60-80%. The maximum uranium removal via rhizofiltration for the two plant cultivars occurred at pH 3-5 of solution and their uranium removal efficiencies exceeded 90%. The lab-scale continuous rhizofiltration clean-up system delivered over 99% uranium removal efficiency, and the results of SEM and EDS analyses indicated that most uranium accumulated in the roots of plants. The present results suggested that the uranium removal capacity of two plants evaluated in the clean-up system was about 25 mg/kg of wet plant mass. Notably, the removal capacity of the root parts only was more than 500 mg/kg.

  13. The Comparison of Effects of Gamma Radiation of Crude Oil Yield on Some Sunflower (Helianthus Annuus Seeds

    Directory of Open Access Journals (Sweden)

    Havser ERTEM VAİZOĞULLAR

    2015-01-01

    Full Text Available This study compares the effects of different doses gamma radiation on crude oil yield and moisture of different six variety sunflower (Helianthus annuus L. seeds. As materials, sunflower variety Ege-2001, Turay, AS-508, Tunca, TR-3080 and Tarsan-1018 seeds were used and irradiated with doses of 0 (control, 100, 200, 300, 400 and 500 Gy gamma radiation. Irradiation was performed in a cesium (Ce137 Gammacell 3000 Elan source, dose rate about 9.75 Gy/min (2900 Ci in the Pamukkale University Faculty of Medicine in the department of the radiological. Moisture amount of seeds were also measured by AOCS standarts. Extraction of the seeds was done with soxhlet apparatus using petroleum ether by hot continuous extraction for 6 hours.  It was found that the highest moisture rate in 100 Gy for all seeds variety. The moisture rate ranged between 3.00 and 9.68% in TR-3080 and Ege-2001, respectively. According to the our results, seed moisture content was affected by gamma radiation in a significant negative one-way. The significant reduction in seed moisture content (9.68% began at 100 Gy of gamma rays and continued to decline to up to 4.04% at 500 Gy. The crude oil yield showed not a important increase in 100 and 200 Gy doses. The result showed that the highest crude oil yield was also obtained from 400 Gy and 33.49% in Ege-2001 seeds.

  14. Translatome profiling in dormant and nondormant sunflower (Helianthus annuus) seeds highlights post-transcriptional regulation of germination.

    Science.gov (United States)

    Layat, Elodie; Leymarie, Juliette; El-Maarouf-Bouteau, Hayat; Caius, José; Langlade, Nicolas; Bailly, Christophe

    2014-12-01

    Seed dormancy, which blocks germination in apparently favourable conditions, is a key regulatory control point of plant population establishment. As germination requires de novo translation, its regulation by dormancy is likely to be related to the association of individual transcripts to polysomes. Here, the polysome-associated mRNAs, that is, the translatome, were fractionated and characterized with microarrays in dormant and nondormant sunflower (Helianthus annuus) embryos during their imbibition at 10°C, a temperature preventing germination of dormant embryos. Profiling of mRNAs in polysomal complexes revealed that the translatome differs between germinating and nongerminating embryos. Association of transcripts with polysomes reached a maximum after 15 h of imbibition; at this time-point 194 polysome-associated transcripts were specifically found in nondormant embryos and 47 in dormant embryos only. The proteins corresponding to the polysomal mRNAs in nondormant embryos appeared to be very pertinent for germination and were involved mainly in transport, regulation of transcription or cell wall modifications. This work demonstrates that seed germination results from a timely regulated and selective recruitment of mRNAs to polysomes, thus opening novel fields of investigation for the understanding of this developmental process. © 2014 The Authors. New Phytologist © 2014 New Phytologist Trust.

  15. Molecular cloning and biochemical characterization of three phosphoglycerate kinase isoforms from developing sunflower (Helianthus annuus L.) seeds.

    Science.gov (United States)

    Troncoso-Ponce, M A; Rivoal, J; Venegas-Calerón, M; Dorion, S; Sánchez, R; Cejudo, F J; Garcés, R; Martínez-Force, E

    2012-07-01

    Three cDNAs encoding different phosphoglycerate kinase (PGK, EC 2.7.2.3) isoforms, two cytosolic (HacPGK1 and HacPGK2) and one plastidic (HapPGK), were cloned and characterized from developing sunflower (Helianthus annuus L.) seeds. The expression profiles of these genes showed differences in heterotrophic tissues, such as developing seeds and roots, where HacPGK1 was predominant, while HapPGK was highly expressed in photosynthetic tissues. The cDNAs were expressed in Escherichia coli, and the corresponding proteins purified to electrophoretic homogeneity, using immobilized metal ion affinity chromatography, and biochemically characterized. Despite the high level of identity between sequences, the HacPGK1 isoform showed strong differences in terms of specific activity, temperature stability and pH sensitivity in comparison to HacPGK2 and HapPGK. A polyclonal immune serum was raised against the purified HacPGK1 isoform, which showed cross-immunoreactivity with the other PGK isoforms. This serum allowed the localization of high expression levels of PGK isozymes in embryo tissues. Copyright © 2012 Elsevier Ltd. All rights reserved.

  16. Phytotoxic effects of nickel on yield and concentration of macro- and micro-nutrients in sunflower (Helianthus annuus L.) achenes.

    Science.gov (United States)

    Ahmad, Muhammad Sajid Aqeel; Ashraf, Muhammad; Hussain, Mumtaz

    2011-01-30

    The phytotoxic effects of varying levels of nickel (0, 10, 20, 30, and 40 mg L(-1)) on growth, yield and accumulation of macro- and micro-nutrients in leaves and achenes of sunflower (Helianthus annuus L.) were appraised in this study. A marked reduction in root and shoot fresh biomass was recorded at higher Ni levels. Nickel stress also caused a substantial decrease in all macro- and micro-nutrients in leaves and achenes. The lower level of Ni (10 mg L(-1)) had a non-significant effect on various yield attributes, but higher Ni levels considerably decreased these parameters. Higher Ni levels decreased the concentrations of Ca, Mn and Fe in achenes. In contrast, achene N, K, Zn, Mn and Cu decreased consistently with increasing level of Ni, even at lower level (10 mg L(-1)). Sunflower hybrid Hysun-33 had better yield and higher most of the nutrients in achenes as compared with SF-187. The maximum reduction in all parameters was observed at the maximum level of nickel (40 mg L(-1)) where almost all parameters were reduced more than 50% of those of control plants. In conclusion, the pattern of uptake and accumulation of different nutrients in sunflower plants were nutrient- and cultivar-specific under Ni-stress. Copyright © 2010 Elsevier B.V. All rights reserved.

  17. Rhizofiltration using sunflower (Helianthus annuus L.) and bean (Phaseolus vulgaris L. var. vulgaris) to remediate uranium contaminated groundwater

    International Nuclear Information System (INIS)

    Lee, Minhee; Yang, Minjune

    2010-01-01

    The uranium removal efficiencies of rhizofiltration in the remediation of groundwater were investigated in lab-scale experiments. Sunflower (Helianthus annuus L.) and bean (Phaseolus vulgaris L. var. vulgaris) were cultivated and an artificially uranium contaminated solution and three genuine groundwater samples were used in the experiments. More than 80% of the initial uranium in solution and genuine groundwater, respectively, was removed within 24 h by using sunflower and the residual uranium concentration of the treated water was lower than 30 μg/L (USEPA drinking water limit). For bean, the uranium removal efficiency of the rhizofiltration was roughly 60-80%. The maximum uranium removal via rhizofiltration for the two plant cultivars occurred at pH 3-5 of solution and their uranium removal efficiencies exceeded 90%. The lab-scale continuous rhizofiltration clean-up system delivered over 99% uranium removal efficiency, and the results of SEM and EDS analyses indicated that most uranium accumulated in the roots of plants. The present results suggested that the uranium removal capacity of two plants evaluated in the clean-up system was about 25 mg/kg of wet plant mass. Notably, the removal capacity of the root parts only was more than 500 mg/kg.

  18. Plant domestication and the assembly of bacterial and fungal communities associated with strains of the common sunflower, Helianthus annuus.

    Science.gov (United States)

    Leff, Jonathan W; Lynch, Ryan C; Kane, Nolan C; Fierer, Noah

    2017-04-01

    Root and rhizosphere microbial communities can affect plant health, but it remains undetermined how plant domestication may influence these bacterial and fungal communities. We grew 33 sunflower (Helianthus annuus) strains (n = 5) that varied in their extent of domestication and assessed rhizosphere and root endosphere bacterial and fungal communities. We also assessed fungal communities in the sunflower seeds to investigate the degree to which root and rhizosphere communities were influenced by vertical transmission of the microbiome through seeds. Neither root nor rhizosphere bacterial communities were affected by the extent of sunflower domestication, but domestication did affect the composition of rhizosphere fungal communities. In particular, more modern sunflower strains had lower relative abundances of putative fungal pathogens. Seed-associated fungal communities strongly differed across strains, but several lines of evidence suggest that there is minimal vertical transmission of fungi from seeds to the adult plants. Our results indicate that plant-associated fungal communities are more strongly influenced by host genetic factors and plant breeding than bacterial communities, a finding that could influence strategies for optimizing microbial communities to improve crop yields. © 2016 The Authors. New Phytologist © 2016 New Phytologist Trust.

  19. Evaluating the Effects of Municipal Waste and Wastewater on Absorption of Nickel and Cadmium of Helianthus Annuus Plant

    Directory of Open Access Journals (Sweden)

    Amirhossein Ashouri

    2016-01-01

    Full Text Available The present study is an attempt to examine the effects of municipal waste and wastewater on absorption of nickel and cadmium of helianthus annuus plant. In order to determine cadmium and nickel in different organs of the plant in soil with organic fertilizers of municipal waste and municipal sewage sludge, we conducted a split plot study. The study was in form of randomized complete block from 2011 to 2015 under farm conditions. We considered the main factor in five levels of control, 10 and 20 tons of sewage sludge and municipal waste compost per hectare besides the minor factor of yearly treatment during four years. The results showed that using 20 tons of sewage sludge and waste per hectare increased absorbable soil nickel and cadmium up to approximately 220%. Also, the amount of cadmium and nickel in root was about 400% more than the control group. Bacteria found in soil contaminated to heavy metals showed remarkable resistance against higher concentration of these elements. Both bioaccumulation and biosorption techniques indicated high potential to refine aquatic environments. However, the bioaccumulation technique showed better efficiency in lower concentrations and the biosorption revealed better efficiency in higher concentrations of metals.

  20. Seed yield, N-uptake and oil quality in Helianthus annuus as affected by N-fertilizer

    International Nuclear Information System (INIS)

    Kurdali, F.; Al-Ain, F.; Attar, J.

    2008-11-01

    A field experiment was conducted to study the impact of different nitrogen fertilizer rates (0, 50, 100 and 150 kg N/ha as urea) on dry matter yield, N uptake, seed yield, grain oil content and properties of sunflower Helianthus annuus using the 15 N labeling technique. Sunflower plants responded strongly to increasing N supply with respect to growth performance. Dry matter yield and total N uptake were significantly increased with increasing N-supply. Partitioning of N yield in different plant parts showed that capitulum was the principle sink of N (60%) followed by leaves (30%) and stem (10%) regardless of N-fertilizer rates. Seed yield of sunflower was significantly increased at higher N-supply. However, oil concentration was significantly reduced in the N-fertilized treatments. Decreasing of grain oil content due to N addition was overcompensated by the seed yield increase. Consequently, no significant effect of N supply on oil yield was observed. The effect of N supply on iodine number was small, and only a small trend towards lower iodine value in the N100 was observed. No clear trend of the effect of N supply on other oil quality parameters was observed. Nitrogen derived from fertilizer (Ndff) was significantly increased with increasing N-supply. Recovery of fertilizer 15 N was of 64% regardless of N-rates. This efficiency was less pronounced in stem and leaves than that in capitulum which had a greater value at higher N-supply. (Author)

  1. Root biomass response to foliar application of imazapyr for two imidazolinone tolerant alleles of sunflower (Helianthus annuus L.).

    Science.gov (United States)

    Sala, Carlos A; Bulos, Mariano; Altieri, Emiliano; Ramos, María Laura

    2012-09-01

    Imisun and CLPlus are two imidazolinone tolerance traits in sunflower (Helianthus annuus L.) determined by the expression of two alleles at the locus Ahasl1. Both traits differed in their tolerance level to imazapyr -a type of imidazolinone herbicide- when aboveground biomass is considered, but the concomitant herbicide effect over the root system has not been reported. The objective of this work was to quantify the root biomass response to increased doses of imazapyr in susceptible (ahasl1/ahasl1), Imisun (Ahasl1-1/Ahasl1-1) and CLPlus (Ahasl1-3/Ahasl1-3) homozygous sunflower genotypes. These materials were sprayed at the V2-V4 stage with increased doses of imazapyr (from 0 to 480 g active ingredient ha(-1)) and 14 days after treatment root biomass of each plant was assessed. Genotype at the Ahasl1 locus, dose of imazapyr and their interaction significantly contributed (P < 0.001) to explain the reduction in root biomass accumulation after herbicide application. Estimated dose of imazapyr required to reduce root biomass accumulation by fifty percent (GR(50)) differed statistically for the three genotypes under study (P < 0.001). CLPlus genotypes showed the highest values of GR(50), 300 times higher on average than the susceptible genotypes, and almost 8 times higher than Imisun materials, demonstrating that both alleles differ in their root biomass response to foliar application of increased doses of imazapyr.

  2. Elimination of natural uranium and {sup 226}Ra from contaminated waters by rhizofiltration using Helianthus annuus L

    Energy Technology Data Exchange (ETDEWEB)

    Vera Tome, F. [Departamento de Fisica Aplicada, Facultad de Ciencias, Universidad de Extremadura, 06071 Badajoz (Spain)], E-mail: fvt@unex.es; Blanco Rodriguez, P. [Departamento de Fisica, Facultad de Ciencias, Universidad de Extremadura, 06071 Badajoz (Spain); Lozano, J.C. [Laboratorio de Radiactividad Ambiental, Facultad de Ciencias, Universidad de Salamanca, 37008 Salamanca (Spain)

    2008-04-15

    The elimination of natural uranium and {sup 226}Ra from contaminated waters by rhizofiltration was tested using Helianthus annuus L. (sunflower) seedlings growing in a hydroponic medium. Different experiments were designed to determine the optimum age of the seedlings for the remediation process, and also to study the principal way in which the radionuclides are removed from the solution by the sunflower roots. In every trial a precipitate appeared which contained a major fraction of the natural uranium and {sup 226}Ra. The results indicated that the seedlings themselves induced the formation of this precipitate. When four-week-old seedlings were exposed to contaminated water, a period of only 2 days was sufficient to remove the natural uranium and {sup 226}Ra from the solution: about 50% of the natural uranium and 70% of the {sup 226}Ra were fixed in the roots, and essentially the rest was found in the precipitate, with only very small percentages fixed in the shoots and left in solution.

  3. Analysis of transposons and repeat composition of the sunflower (Helianthus annuus L.) genome.

    Science.gov (United States)

    Cavallini, Andrea; Natali, Lucia; Zuccolo, Andrea; Giordani, Tommaso; Jurman, Irena; Ferrillo, Veronica; Vitacolonna, Nicola; Sarri, Vania; Cattonaro, Federica; Ceccarelli, Marilena; Cionini, Pier Giorgio; Morgante, Michele

    2010-02-01

    A sample-sequencing strategy combined with slot-blot hybridization and FISH was used to study the composition of the repetitive component of the sunflower genome. One thousand six hundred thirty-eight sequences for a total of 954,517 bp were analyzed. The fraction of sequences that can be classified as repetitive using computational and hybridization approaches amounts to 62% in total. Almost two thirds remain as yet uncharacterized in nature. Of those characterized, most belong to the gypsy superfamily of LTR-retrotransposons. Unlike in other species, where single families can account for large fractions of the genome, it appears that no transposon family has been amplified to very high levels in sunflower. All other known classes of transposable elements were also found. One family of unknown nature (contig 61) was the most repeated in the sunflower genome. The evolution of the repetitive component in the Helianthus genus and in other Asteraceae was studied by comparative analysis of the hybridization of total genomic DNAs from these species to the sunflower small-insert library and compared to gene-based phylogeny. Very little similarity is observed between Helianthus species and two related Asteraceae species outside of the genus. Most repetitive elements are similar in annual and perennial Helianthus species indicating that sequence amplification largely predates such divergence. Gypsy-like elements are more represented in the annuals than in the perennials, while copia-like elements are similarly represented, attesting a different amplification history of the two superfamilies of LTR-retrotransposons in the Helianthus genus.

  4. Physico-chemical attributes of seed oil from drought stressed sunflower (Helianthus annuus L. plants

    Directory of Open Access Journals (Sweden)

    Anwar, Farooq

    2009-12-01

    ísticas cualitativas y cuantitativas de semilla de girasol y aceites de semilla fueron evaluadas. Dos cultivos de girasol (Gulshan-98 y Sun Cross fueron sembrados en el campo. El tratamiento de estrés hídrico fue aplicado en el estado vegetativo y reproductivo. El análisis de la semilla de girasol mostro que el contenido en aceite disminuyo significativamente (p ≤ 0.05 (un descenso del 10,52% respecto al control debido al estrés hídrico cuando se impone en ambos estado de crecimiento. Ambos cultivos de girasol mostraron respuestas diferenciadas al estrés hídrico con respecto a los contenidos de los ácidos oleico y linoleico. Una correlación negativa significativa entre los ácidos oleico y linoleico fue observada en cv. Gulshan-98 bajo condiciones de déficit de agua en comparación con Suncross en la que tal efecto del estres hídrico sobre los ácidos oleico y linoleico no fue obsevado. Las condiciones de déficit de agua causan una reducción en el ácido linoleico en Gulshan-98, mientras que permanece inalterado en Suncross. Los contenidos de ácido esteárico aumentaron en cv. Gulshan-98 debido a la sequia, mientras que no se observo efecto del estrés hídrico sobre el contenido de ácido palmítico en el aceite de ambos cultivos de girasol. En general, los ácidos grasos poliinsaturado del aceite permanecen sin cambios en condiciones de estrés hídrico o en plantas regadas normalmente de ambos cultivo, sin embargo los ácidos grasos saturados incrementaron en Gulshan-98. Los contenidos de tocoferoles totales o individuales (α, γ, and δ en aceite de semilla se incrementaron significativamente con la aplicación de estrés hídrico en ambos cultivos. Una evaluación de las características físicas y químicas de ambos cultivos de girasol revelan que el estrés por sequia causa un marcado incremento en el contenido de materia insaponificable (18,75% con respecto al control y un descenso del índice de yodo (5,87% respecto al control, aunque el índice de

  5. Effect of antioxidant butylated hydroxyl anisole on the thermal or oxidative stability of sunflower oil (Helianthus Annuus) by ultrasonic.

    Science.gov (United States)

    Murari, Satish Kumar; Shwetha, M V

    2016-01-01

    The aim of the current investigation was to evaluate the efficiency of butylated hydroxyl anisole (BHA) as an antioxidant in sunflower oil (Helianthus Annuus). The oxidation stability of sunflower oil have been investigated by the effects of varying amounts of BHA. The antioxidant incorporated sunflower oil system and control edible oil were subjected to heating at 180 ± 5 °C continuously for a period of 4 h per day for consecutive 4 days. The parameters used to assess the thermal degradation and oxidation properties of the oils include ultrasonic velocity, viscosity, density and peroxide value. The fatty acid compositions of the oils were measured by gas chromatography. Adiabatic compressibility, intermolecular free length, relaxation time and acoustic impedance have been calculated from experimental data. Viscosity, density and ultrasonic velocity change in control oil is from 3.72 × 10(-2) to 13.2 × 10(-2) Nsm - 2, 918 to 994 kg/m3 and 1412 to 1484 m/s respectively and in sunflower oil with 200 ppm BHA is from 3.88 × 10(-2) to 7.52 × 10(-2) Nsm - 2, 926 to 962 kg/m3 and 1418 to 1463 m/s respectively for 16 h of heat treated oil. The ultrasonic results obtained have shown reduction in thermal degradation and improvement in oxidation stability of antioxidant loaded oil in comparison to base oil. Hence, it can be recommended that sunflower oil with 200 ppm BHA can be used for frying without adverse effect on physical properties. The ultrasonic velocity can be used for assessment of stability of frying oil.

  6. Toward a molecular cytogenetic map for cultivated sunflower (Helianthus annuus L.) by landed BAC/BIBAC clones.

    Science.gov (United States)

    Feng, Jiuhuan; Liu, Zhao; Cai, Xiwen; Jan, Chao-Chien

    2013-01-01

    Conventional karyotypes and various genetic linkage maps have been established in sunflower (Helianthus annuus L., 2n = 34). However, the relationship between linkage groups and individual chromosomes of sunflower remains unknown and has considerable relevance for the sunflower research community. Recently, a set of linkage group-specific bacterial /binary bacterial artificial chromosome (BAC/BIBAC) clones was identified from two complementary BAC and BIBAC libraries constructed for cultivated sunflower cv. HA89. In the present study, we used these linkage group-specific clones (~100 kb in size) as probes to in situ hybridize to HA89 mitotic chromosomes at metaphase using the BAC-fluorescence in situ hybridization (FISH) technique. Because a characteristic of the sunflower genome is the abundance of repetitive DNA sequences, a high ratio of blocking DNA to probe DNA was applied to hybridization reactions to minimize the background noise. As a result, all sunflower chromosomes were anchored by one or two BAC/BIBAC clones with specific FISH signals. FISH analysis based on tandem repetitive sequences, such as rRNA genes, has been previously reported; however, the BAC-FISH technique developed here using restriction fragment length polymorphism (RFLP)-derived BAC/BIBAC clones as probes to apply genome-wide analysis is new for sunflower. As chromosome-specific cytogenetic markers, the selected BAC/BIBAC clones that encompass the 17 linkage groups provide a valuable tool for identifying sunflower cytogenetic stocks (such as trisomics) and tracking alien chromosomes in interspecific crosses. This work also demonstrates the potential of using a large-insert DNA library for the development of molecular cytogenetic resources.

  7. Genetic diversity and population structure in cultivated sunflower and a comparison to its wild progenitor, Helianthus annuus L.

    Science.gov (United States)

    Mandel, J R; Dechaine, J M; Marek, L F; Burke, J M

    2011-09-01

    Crop germplasm collections are valuable resources for ongoing plant breeding efforts. To fully utilize such collections, however, researchers need detailed information about the amount and distribution of genetic diversity present within collections. Here, we report the results of a population genetic analysis of the primary gene pool of sunflower (Helianthus annuus L.) based on a broad sampling of 433 cultivated accessions from North America and Europe, as well as a range-wide collection of 24 wild sunflower populations. Gene diversity across the cultivars was 0.47, as compared with 0.70 in the wilds, indicating that cultivated sunflower harbors roughly two-thirds of the total genetic diversity present in wild sunflower. Population structure analyses revealed that wild sunflower can be subdivided into four genetically distinct population clusters throughout its North American range, whereas the cultivated sunflower gene pool could be split into two main clusters separating restorer lines from the balance of the gene pool. Use of a maximum likelihood method to estimate the contribution of the wild gene pool to the cultivated sunflower germplasm revealed that the bulk of the cultivar diversity is derived from two wild sunflower population genetic clusters that are primarily composed of individuals from the east-central United States, the same general region in which sunflower domestication is believed to have occurred. We also identified a nested subset of accessions that capture as much of the allelic diversity present within the sampled cultivated sunflower germplasm collection as possible. At the high end, a core set of 288 captured nearly 90% of the alleles present in the full set of 433, whereas a core set of just 12 accessions was sufficient to capture nearly 50% of the total allelic diversity present within this sample of cultivated sunflower.

  8. Pre-haustorial resistance to broomrape (Orobanche cumana) in sunflower (Helianthus annuus): cytochemical studies.

    Science.gov (United States)

    Echevarría-Zomeño, Sira; Pérez-de-Luque, Alejandro; Jorrín, Jesús; Maldonado, Ana M

    2006-01-01

    Sunflower broomrape (Orobanche cumana Wallr.) is a root holoparasitic angiosperm considered as one of the major constraints for sunflower production in Mediterranean areas. Breeding for resistance is regarded as the most effective, feasible, and environmentally friendly solution to control this parasite. However, the existing sources of genetic resistance are defeated by the continuous emergence of new more virulent races of the parasite. In this work, the interaction between sunflower and O. cumana has been analysed in order to gain insights into the mechanisms involved in resistance. Two sunflower genotypes were selected showing different behaviour against the new race F of O. cumana, HE-39998 (susceptible) and HE-39999 (resistant), and both compatible and incompatible interactions were compared. Pot and Petri dish bioassays revealed that only HE-39998 plants were severely affected, supporting a high number of successfully established broomrapes to mature flowering, whereas in HE-39999 root tubercles were never observed, resistance being associated with browning symptoms of both parasite and host tissues. Histological aspects of the resistance were further investigated. Suberization and protein cross-linking at the cell wall were seen in the resistant sunflower cells in contact with the parasite, preventing parasite penetration and connection to the host vascular system. In addition, fluorescence and confocal laser microscopy (CLM) observations revealed accumulation of phenolic compounds during the incompatible reaction, which is in agreement with these metabolites playing a defensive role during H. annuus-O. cumana interaction.

  9. Development, characterization and experimental validation of a cultivated sunflower (Helianthus annuus L.) gene expression oligonucleotide microarray.

    Science.gov (United States)

    Fernandez, Paula; Soria, Marcelo; Blesa, David; DiRienzo, Julio; Moschen, Sebastian; Rivarola, Maximo; Clavijo, Bernardo Jose; Gonzalez, Sergio; Peluffo, Lucila; Príncipi, Dario; Dosio, Guillermo; Aguirrezabal, Luis; García-García, Francisco; Conesa, Ana; Hopp, Esteban; Dopazo, Joaquín; Heinz, Ruth Amelia; Paniego, Norma

    2012-01-01

    Oligonucleotide-based microarrays with accurate gene coverage represent a key strategy for transcriptional studies in orphan species such as sunflower, H. annuus L., which lacks full genome sequences. The goal of this study was the development and functional annotation of a comprehensive sunflower unigene collection and the design and validation of a custom sunflower oligonucleotide-based microarray. A large scale EST (>130,000 ESTs) curation, assembly and sequence annotation was performed using Blast2GO (www.blast2go.de). The EST assembly comprises 41,013 putative transcripts (12,924 contigs and 28,089 singletons). The resulting Sunflower Unigen Resource (SUR version 1.0) was used to design an oligonucleotide-based Agilent microarray for cultivated sunflower. This microarray includes a total of 42,326 features: 1,417 Agilent controls, 74 control probes for sunflower replicated 10 times (740 controls) and 40,169 different non-control probes. Microarray performance was validated using a model experiment examining the induction of senescence by water deficit. Pre-processing and differential expression analysis of Agilent microarrays was performed using the Bioconductor limma package. The analyses based on p-values calculated by eBayes (psunflower unigene collection, and a custom, validated sunflower oligonucleotide-based microarray using Agilent technology. Both the curated unigene collection and the validated oligonucleotide microarray provide key resources for sunflower genome analysis, transcriptional studies, and molecular breeding for crop improvement.

  10. Discovery and introgression of the wild sunflower-derived novel downy mildew resistance gene Pl 19 in confection sunflower (Helianthus annuus L.).

    Science.gov (United States)

    Zhang, Z W; Ma, G J; Zhao, J; Markell, S G; Qi, L L

    2017-01-01

    A new downy mildew resistance gene, Pl 19 , was identified from wild Helianthus annuus accession PI 435414, introduced to confection sunflower, and genetically mapped to linkage group 4 of the sunflower genome. Wild Helianthus annuus accession PI 435414 exhibited resistance to downy mildew, which is one of the most destructive diseases to sunflower production globally. Evaluation of the 140 BC 1 F 2:3 families derived from the cross of CMS CONFSCLB1 and PI 435414 against Plasmopara halstedii race 734 revealed that a single dominant gene controls downy mildew resistance in the population. Bulked segregant analysis conducted in the BC 1 F 2 population with 860 simple sequence repeat (SSR) markers indicated that the resistance derived from wild H. annuus was associated with SSR markers located on linkage group (LG) 4 of the sunflower genome. To map and tag this resistance locus, designated Pl 19 , 140 BC 1 F 2 individuals were used to construct a linkage map of the gene region. Two SSR markers, ORS963 and HT298, were linked to Pl 19 within a distance of 4.7 cM. After screening 27 additional single nucleotide polymorphism (SNP) markers previously mapped to this region, two flanking SNP markers, NSA_003564 and NSA_006089, were identified as surrounding the Pl 19 gene at a distance of 0.6 cM from each side. Genetic analysis indicated that Pl 19 is different from Pl 17 , which had previously been mapped to LG4, but is closely linked to Pl 17 . This new gene is highly effective against the most predominant and virulent races of P. halstedii currently identified in North America and is the first downy mildew resistance gene that has been transferred to confection sunflower. The selected resistant germplasm derived from homozygous BC 2 F 3 progeny provides a novel gene for use in confection sunflower breeding programs.

  11. Development, characterization and experimental validation of a cultivated sunflower (Helianthus annuus L. gene expression oligonucleotide microarray.

    Directory of Open Access Journals (Sweden)

    Paula Fernandez

    Full Text Available Oligonucleotide-based microarrays with accurate gene coverage represent a key strategy for transcriptional studies in orphan species such as sunflower, H. annuus L., which lacks full genome sequences. The goal of this study was the development and functional annotation of a comprehensive sunflower unigene collection and the design and validation of a custom sunflower oligonucleotide-based microarray. A large scale EST (>130,000 ESTs curation, assembly and sequence annotation was performed using Blast2GO (www.blast2go.de. The EST assembly comprises 41,013 putative transcripts (12,924 contigs and 28,089 singletons. The resulting Sunflower Unigen Resource (SUR version 1.0 was used to design an oligonucleotide-based Agilent microarray for cultivated sunflower. This microarray includes a total of 42,326 features: 1,417 Agilent controls, 74 control probes for sunflower replicated 10 times (740 controls and 40,169 different non-control probes. Microarray performance was validated using a model experiment examining the induction of senescence by water deficit. Pre-processing and differential expression analysis of Agilent microarrays was performed using the Bioconductor limma package. The analyses based on p-values calculated by eBayes (p<0.01 allowed the detection of 558 differentially expressed genes between water stress and control conditions; from these, ten genes were further validated by qPCR. Over-represented ontologies were identified using FatiScan in the Babelomics suite. This work generated a curated and trustable sunflower unigene collection, and a custom, validated sunflower oligonucleotide-based microarray using Agilent technology. Both the curated unigene collection and the validated oligonucleotide microarray provide key resources for sunflower genome analysis, transcriptional studies, and molecular breeding for crop improvement.

  12. Effects of Foliar Rates of Methanol Applications on some of Traits Related to Seed Yield of Sunflower (Helianthus annuus L. under Water Deficit Stress

    Directory of Open Access Journals (Sweden)

    E. Khalilvand Behrouzyar

    2014-07-01

    Full Text Available To investigate the effects of rates of methanol foliar applications under water deficit stress on someof traits related to seed yield of sunflower (Helianthus annuus L, a split plot experiment was conducted during growing seasons of 2011-2012. Treatments were four levels of water deficit stresses a1: severe stress (irrigation at 25% FC, a2: mild stress (irrigation at 50% FC, a3: fair stress (irrigation at 75% FC and a4: normal irrigation (irrigation at 100% FC and six levels of foliar methanol applications [b1:0, b2:7, b3:14, b4:21, b5:28 and b6:35 (v/v]. The analysis of variance showed significant effect of interaction between water deficit stress and methanol rates of foliar applications on seed yield per plant, dry weight per plant, number of seeds per head (p

  13. Effect of Irrigation with Contaminated Water by Cloth Detergent on Seed Germination Traits and Early Growth of Sunflower (Helianthus annuus L.

    Directory of Open Access Journals (Sweden)

    Hassan HEIDARI

    2013-02-01

    Full Text Available One of the sources for irrigation is sewage. Contaminated water may affect seed germination and plant growth. A laboratory experiment and a pot experiment were conducted in 2012 to determine the effect of different doses of detergent on seed germination traits and early growth of sunflower (Helianthus annuus L.. The experiments included eight doses of cloth detergent (0, 0.00002, 0.0002, 0.002, 0.02, 0.2, 2, 20 g/L. Results showed that 20 and 2 g/L of detergent severely reduced seed germination, plant height, leaf number per plant, total biomass and stem weight. 20 g/L of detergent reduced shoot length, root length, seedling weight and seed vigor. Seed germination stage was more sensitive to contaminated water than early growth stage. The results demonstrated that irrigating sunflower by contaminated water with household cleaning products at high concentration should be avoided.

  14. Repetitive DNA and Plant Domestication: Variation in Copy Number and Proximity to Genes of LTR-Retrotransposons among Wild and Cultivated Sunflower (Helianthus annuus) Genotypes.

    Science.gov (United States)

    Mascagni, Flavia; Barghini, Elena; Giordani, Tommaso; Rieseberg, Loren H; Cavallini, Andrea; Natali, Lucia

    2015-11-24

    The sunflower (Helianthus annuus) genome contains a very large proportion of transposable elements, especially long terminal repeat retrotransposons. However, knowledge on the retrotransposon-related variability within this species is still limited. We used next-generation sequencing (NGS) technologies to perform a quantitative and qualitative survey of intraspecific variation of the retrotransposon fraction of the genome across 15 genotypes--7 wild accessions and 8 cultivars--of H. annuus. By mapping the Illumina reads of the 15 genotypes onto a library of sunflower long terminal repeat retrotransposons, we observed considerable variability in redundancy among genotypes, at both superfamily and family levels. In another analysis, we mapped Illumina paired reads to two sets of sequences, that is, long terminal repeat retrotransposons and protein-encoding sequences, and evaluated the extent of retrotransposon proximity to genes in the sunflower genome by counting the number of paired reads in which one read mapped to a retrotransposon and the other to a gene. Large variability among genotypes was also ascertained for retrotransposon proximity to genes. Both long terminal repeat retrotransposon redundancy and proximity to genes varied among retrotransposon families and also between cultivated and wild genotypes. Such differences are discussed in relation to the possible role of long terminal repeat retrotransposons in the domestication of sunflower. © The Author(s) 2015. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution.

  15. Helianthus annuus L

    Indian Academy of Sciences (India)

    moj

    Abstract. Sunflower is an important source of edible oil. Drought is known as an important factor limiting the growth and productivity of field crops in most parts of the world. Agricultural biotechnology mainly aims at developing crops with higher tolerance to the challenging environmental conditions, such as drought.

  16. Evaluating the Competitive Ability of Sunflower (Helianthus annuus L. Cultivars against Tumble Pigweed (Amaranthus albus L. in Birjand Region

    Directory of Open Access Journals (Sweden)

    mohammad javad babaie zarch

    2017-09-01

    Full Text Available Introduction Using crop species and cultivars with high competitive ability against weeds is one of the effective strategies for sustainable weed management. Emergence rate, rapid root growth, seed vigor, development rate of leaves, rapid root and shoot biomass accumulation, rapid canopy closure and plant height are important traits in relation to the competitiveness between different cultivars of crops. Competitive ability is measured using two indices including the weed growth prevention ability or weed biomass reduction index and crop tolerance to weed or yield reduction preventing index. The purpose of this study is to evaluate the competitive ability of six oilseed sunflower (Helianthus annuus L. cultivars and also introducing the most important morpho-physiological attributes affecting their competitive ability with tumble pigweed (Amaranthus albus L. in Birjand. Materials and methods This experiment was carried out as factorial layout based on randomized complete block design with three replications at the Agricultural Research Station, University of Birjand in 2012. Treatments were included six sunflower oilseed cultivars (Azargol, Jame esfehan, Farrokh, Syrna, Progress, Euroflor and tumble pigweed densities in four levels (zero (control, 5, 10 and 15 plants per square meter. The number of days and cumulative degree days were recorded from sowing to emergence. Plant height, leaf area and dry matter were recorded at four stages from emergence to 75 days after it. Sunflower seeds were harvested after physiological maturity. Preventing indices were used to evaluate the competitive ability of cultivars, competitive tolerance (Watson et al., 2002 and weed biomass. Data were analyzed with the SAS software and cluster analysis was performed using SPSS software. FLSD test was employed for comparison of the means at the 5% significance level. The graphs were prepared by Excel. Results and Discussion Analysis of variance showed that there was a

  17. Genotyping-by-sequencing targeting of a novel downy mildew resistance gene Pl 20 from wild Helianthus argophyllus for sunflower (Helianthus annuus L.).

    Science.gov (United States)

    Ma, G J; Markell, S G; Song, Q J; Qi, L L

    2017-07-01

    Genotyping-by-sequencing revealed a new downy mildew resistance gene, Pl 20 , from wild Helianthus argophyllus located on linkage group 8 of the sunflower genome and closely linked to SNP markers that facilitate the marker-assisted selection of resistance genes. Downy mildew (DM), caused by Plasmopara halstedii, is one of the most devastating and yield-limiting diseases of sunflower. Downy mildew resistance identified in wild Helianthus argophyllus accession PI 494578 was determined to be effective against the predominant and virulent races of P. halstedii occurring in the United States. The evaluation of 114 BC 1 F 2:3 families derived from the cross between HA 89 and PI 494578 against P. halstedii race 734 revealed that single dominant gene controls downy mildew resistance in the population. Genotyping-by-sequencing analysis conducted in the BC 1 F 2 population indicated that the DM resistance gene derived from wild H. argophyllus PI 494578 is located on the upper end of the linkage group (LG) 8 of the sunflower genome, as was determined single nucleotide polymorphism (SNP) markers associated with DM resistance. Analysis of 11 additional SNP markers previously mapped to this region revealed that the resistance gene, named Pl 20 , co-segregated with four markers, SFW02745, SFW09076, S8_11272025, and S8_11272046, and is flanked by SFW04358 and S8_100385559 at an interval of 1.8 cM. The newly discovered P. halstedii resistance gene has been introgressed from wild species into cultivated sunflower to provide a novel gene with DM resistance. The homozygous resistant individuals were selected from BC 2 F 2 progenies with the use of markers linked to the Pl 20 gene, and these lines should benefit the sunflower community for Helianthus improvement.

  18. Somatic embryogenesis from corolla tubes of interspecific amphiploids between cultivated sunflower (Helianthus annuus L.) and its wild species

    Science.gov (United States)

    Somatic embryogenesis in vitro provides an efficient means of plant multiplication, facilitating sunflower improvement and germplasm innovation. In the present study, using interspecific amphiploids (2n=4x=68) between cultivated sunflower and wild perennial Helianthus species as explant donors, soma...

  19. Produção de sementes de girassol (Helianthus annuus L. em três sistemas de polinização - DOI: 10.4025/actascianimsci.v25i2.1974 Seed production and germination of sunflower (Helianthus annuus L. in three pollination systems- DOI: 10.4025/actascianimsci.v25i2.1974

    Directory of Open Access Journals (Sweden)

    Vagner de Alencar Arnaut de Toledo

    2003-04-01

    Full Text Available Esse experimento foi realizado para avaliar a produção e a germinação de sementes de girassol (Helianthus annuus. Foi utilizada uma área somente demarcada de 8m x 3m, e o desenvolvimento da colônia dentro de uma gaiola telada com 8m x 3m com dois metros de altura na sua porção mais alta. Entretanto, a produção de sementes foi 362,34% maior na área coberta com abelhas Apis mellifera, bem como 27,12%% no peso dos aquênios. Pode-se concluir que a polinização por abelhas no girassol proporcionou não só um aumento na produção de sementes, como também na sua viabilidade em relação à área coberta sem abelhas.This study was carried out to evaluate seed production and germination of sunflower, Helianthus annuus. The sunflower cultivar used is called Embrapa 122-V2000. The experiment used a marked area that had 8m x 3m, and in a second area was installed, containing a honeybee colony and covered with wire screen, 8m x 3m, with two meters in the highest part. The seed production was 362.34% higher in the covered area with honeybee colony, and its achenes weight, 27.12% higher. Therefore, pollination by honeybees in sunflower increases the seed production, as well as its germination.

  20. ROLE OF SOME CHEMICAL MATERIALS ON THE PHYTO-EXTRACTION OF HEAVY METALS FROM CONTAMINATED SOILS WITH SUNFLOWER PLANTS (HELIANTHUS ANNUUS)

    International Nuclear Information System (INIS)

    ABD EL-BARY, S.A.; EL-NAKA, E.A.; RIZK, M.A.; LOTFY, S.M.

    2009-01-01

    Chelation and complexation of heavy metals were evaluated as practical ways to solubilize, detoxify and enhance heavy metals accumulation by plants. Sunflower (Helianthus annuus) was selected as potential heavy metals accumulator for metals phyto-extraction in two selected soils (clayey and sandy). To enhance metals phyto-extraction, ammonium nitrate and organic chelates such as EDTA and citric acid were added to soils at the rates from 0 to 20 mmol/kg soil as extracting solutions and applied to the soil by mixing thoroughly before planting. Dry matter production and metals concentrations in shoots and roots and soil pH were measured after 60 days.Plant dry matter production and metals accumulation were varied with soil contamination, chelate / organic acid form and rate, and soil type. The highest metals concentration was obtained in plants grown on clayey soil, however, the lowest content was observed in case of sandy soil. Addition of citric acid increased metals accumulation and translocation to the shoots significantly. Addition of 20 mmol/kg of citric acid to clayey soils increased metals concentration in shoots several folds of magnitude, but addition of ammonium nitrate had little effect on metal translocation to shoots. Citric acid was the most effective chelate in plant accumulation of tested metals.

  1. A new method for in-situ monitoring of the underground development of Orobanche cumana in sunflower (Helianthus annuus) with a mini-rhizotron.

    Science.gov (United States)

    Eizenberg, H; Shtienberg, D; Silberbush, M; Ephrath, J E

    2005-11-01

    To develop an in-situ, non-destructive method for observation and monitoring of the underground developmental stages of the root parasite Orobanche cumana. The parasitic weed Orobanche causes severe damage to vegetables and field crops. Most of the damage caused to the crops occurs during the underground, unobservable parasitism stage. Sunflower (Helianthus annuus 'Adi') plants were planted in soil that was artificially inoculated with O. cumana seeds. Clear Plexiglas mini-rhizotron plastic observation tubes were inserted into the soil. Seed germination, early stage of penetration, and formation of tubercles and spikes were observed non-destructively and were monitored throughout the growing season by mean of a mini-rhizotron camera. Use of this technology enabled the complete individual parasite life cycle from the very early development (including germination) to Orobanche shoot to be monitored. In addition, the effect of the systemic herbicide Cadre (imazapic) on the development of O. cumana was inspected and quantified. This novel methodology facilitates the in-situ study of major aspects of the host-parasite interaction and of parasite suppression, such as parasitism dynamics, parasite growth rate, and the effect of chemical treatments on the parasite.

  2. SOIL CHEMICAL PROPERTIES AND GROWTH OF SUNFLOWER (HELIANTHUS ANNUUS L. AS AFFECTED BY THE APPLICATION OF ORGANIC FERTILIZERS AND INOCULATION WITH ARBUSCULAR MYCORRHIZAL FUNGI

    Directory of Open Access Journals (Sweden)

    Apolino José Nogueira da Silva

    2015-02-01

    Full Text Available The use of organic fertilizers and the inoculation of mycorrhizal fungi in the cultivation of oil crops is essential to reduce production costs and minimize negative impacts on natural resources. A field experiment was conducted in an Argissolo Amarelo (Ultisol with the aim of evaluating the effects of fertilizer application and inoculation of arbuscular mycorrhizal fungi on the growth attributes of sunflower (Helianthus annuus L. and on soil chemical properties. The experiment was conducted at the Federal University of Rio Grande do Norte, Brazil, using a randomized block design with three replicates in a 4 × 2 factorial arrangement consisting of four treatments in regard to application of organic fertilizer (liquid biofertilizer, cow urine, mineral fertilizer, and unfertilized control and two treatments in regard to arbuscular mycorrhizal fungi (with and without mycorrhizal fungi. The results showed that the physiological attributes of relative growth rate and leaf weight ratio were positively influenced by fertilization, compared to the control treatment, likely brought about by the supply of nutrients from the fertilizers applied. The growth and productivity attributes were positively affected by mycorrhization.

  3. The effect of subambient to elevated atmospheric CO₂ concentration on vascular function in Helianthus annuus: implications for plant response to climate change.

    Science.gov (United States)

    Rico, Christopher; Pittermann, Jarmila; Polley, H Wayne; Aspinwall, Michael J; Fay, Phillip A

    2013-09-01

    Plant gas exchange is regulated by stomata, which coordinate leaf-level water loss with xylem transport. Stomatal opening responds to internal concentrations of CO₂ in the leaf, but changing CO₂ can also lead to changes in stomatal density that influence transpiration. Given that stomatal conductance increases under subambient concentrations of CO₂ and, conversely, that plants lose less water at elevated concentrations, can downstream effects of atmospheric CO₂ be observed in xylem tissue? We approached this problem by evaluating leaf stomatal density, xylem transport, xylem anatomy and resistance to cavitation in Helianthus annuus plants grown under three CO₂ regimes ranging from pre-industrial to elevated concentrations. Xylem transport, conduit size and stomatal density all increased at 290 ppm relative to ambient and elevated CO₂ concentrations. The shoots of the 290-ppm-grown plants were most vulnerable to cavitation, whereas xylem cavitation resistance did not differ in 390- and 480-ppm-grown plants. Our data indicate that, even as an indirect driver of water loss, CO₂ can affect xylem structure and water transport by coupling stomatal and xylem hydraulic functions during plant development. This plastic response has implications for plant water use under variable concentrations of CO₂, as well as the evolution of efficient xylem transport. © 2013 The Authors. New Phytologist © 2013 New Phytologist Trust.

  4. Inoculating Helianthus annuus (sunflower) grown in zinc and cadmium contaminated soils with plant growth promoting bacteria--effects on phytoremediation strategies.

    Science.gov (United States)

    Marques, Ana P G C; Moreira, Helena; Franco, Albina R; Rangel, António O S S; Castro, Paula M L

    2013-06-01

    Plant growth promoting bacteria (PGPR) may help reducing the toxicity of heavy metals to plants in polluted environments. In this work the effects of inoculating metal resistant and plant growth promoting bacterial strains on the growth of Helianthus annuus grown in Zn and Cd spiked soils were assessed. The PGPR strains Ralstonia eutropha (B1) and Chrysiobacterium humi (B2) reduced losses of weight in metal exposed plants and induced changes in metal bioaccumulation and bioconcentration - with strain B2 decreasing up to 67% Zn accumulation and by 20% Zn bioconcentration factor (BCF) in the shoots, up to 64% Zn uptake and 38% Zn BCF in the roots, and up to 27% Cd uptake and 27% Cd BCF in plant roots. The impact of inoculation on the bacterial communities in the rhizosphere of the plant was also assessed. Bacterial community diversity decreased with increasing levels of metal contamination in the soil, but in rhizosphere soil of plants inoculated with the PGPR strains, a higher bacterial diversity was kept throughout the experimental period. Inoculation of sunflower, particularly with C. humi (B2), appears to be an effective way of enhancing the short term stabilization potential of the plant in metal contaminated land, lowering losses in plant biomass and decreasing aboveground tissue contamination. Copyright © 2013 Elsevier Ltd. All rights reserved.

  5. Comparative study of SOS2 and a novel PMP3-1 gene expression in two sunflower (Helianthus annuus L.) lines differing in salt tolerance.

    Science.gov (United States)

    Saadia, Mubshara; Jamil, Amer; Ashraf, Muhammad; Akram, Nudrat Aisha

    2013-06-01

    Gene expression pattern of two important regulatory proteins, salt overly sensitive 2 (SOS2) and plasma membrane protein 3-1 (PMP3-1), involved in ion homeostasis, was analyzed in two salinity-contrasting sunflower (Helianthus annuus L.) lines, Hysun-38 (salt tolerant) and S-278 (moderately salt tolerant). The pattern was studied at selected time intervals (24 h) under 150 mM NaCl treatment. Using reverse transcription PCR, SOS2 gene fragment was obtained from young leaf and root tissues of opposing lines while that for PMP3-1 was obtained only from young root tissues. Both tolerant and moderately tolerant lines showed a gradual increase in SOS2 expression in sunflower root tissues. Leaf tissues showed the gradually increasing pattern of SOS2 expression in tolerant plants as compared to that for moderately tolerant ones that showed a relatively lower level of expression for this gene. We found the highest level of PMP 3-1 expression in the roots of tolerant sunflower line at 6 and 12 h postsalinity treatment. The moderately tolerant line showed higher expression of PMP3-1 at 12 and 24 h after salt treatment. Overall, the expression of genes for both the regulator proteins varied significantly in the two sunflower lines differing in salinity tolerance.

  6. Greenhouse gas emissions and plant characteristics from soil cultivated with sunflower (Helianthus annuus L.) and amended with organic or inorganic fertilizers

    International Nuclear Information System (INIS)

    López-Valdez, F.; Fernández-Luqueño, F.; Luna-Suárez, S.; Dendooven, L.

    2011-01-01

    Agricultural application of wastewater sludge has become the most widespread method of disposal, but the environmental effects on soil, air, and crops must be considered. The effect of wastewater sludge or urea on sunflower's (Helianthus annuus L.) growth and yield, the soil properties, and the resulting CO 2 and N 2 O emissions are still unknown. The objectives of this study were to investigate: i) the effect on soil properties of organic or inorganic fertilizer added to agricultural soil cultivated with sunflower, ii) how urea or wastewater sludge increases CO 2 and N 2 O emissions from agricultural soil over short time periods, and iii) the effect on plant characteristics and yield of urea or wastewater sludge added to agricultural soil cultivated with sunflower. The sunflower was fertilized with wastewater sludge or urea or grown in unamended soil under greenhouse conditions while plant and soil characteristics, yield, and greenhouse gas emissions were monitored. Sludge and urea modified some soil characteristics at the onset of the experiment and during the first two months but not thereafter. Some plant characteristics were improved by sludge. Urea and sludge treatments increased the yield at similar rates, while sludge-amended soil significantly increased N 2 O emissions but not CO 2 emissions compared to the other amended or unamended soils. This implies that wastewater sludge increased the biomass and/or the yield; however, from a holistic point of view, using wastewater sludge as fertilizer should be viewed with concern.

  7. THE EFFECT OF SPRUCE BARK POLYPHENOLS EXTRACT IN COMBINATION WITH DEUTERIUM DEPLETED WATER (DDW ON GLYCINE MAX L. AND HELIANTHUS ANNUUS L. DEVELOPMENT

    Directory of Open Access Journals (Sweden)

    Corneliu Tanase

    2010-09-01

    Full Text Available The aim of this study was to evaluate the effect of spruce bark aqueous extract and deuterium depleted water (DDW as bioregulators on the plant growth Glycine max L. and Helianthus annuus. The following specific parameteres were closely monitorised: germination energy and germination capacity, plants vegetative organelles growth and development and photoassimilatory pigments concentrations. The results have shown that DDW presents different effects depending on tested plant species. In the case of soybean, DDW presented stimulatory effects on both germination energy and capacity, radicles elongation, primary leaves growth and development but inhibitory effects on photoassimilatory pigments. Spruce bark extract reduced the germination capacity of soybean seeds, but accelerated the germination process of sunflower seeds and present stimulatory effects on plantlets biomass accumulation. The combination of DDW with Picea abies polyphenolic extract promoted soybean plantlet elongation, especially the rootlets ones and stimulated green biomass accumulation for both soybean and sunflower plantlets. Analyzing the photoassimilatory pigments concentration for sunflower, it can be observed an increasing trend (almost 100% comparing with control when introduce into the growth medium DDW and P. abies polyphenolic extract. DDW and P. abies bark extract have shown an important role in plant growth and development, improving photoassimiliation process.

  8. [Analysis of mineral elements of sunflower (Helianthus annuus L.) grown on saline land in Hetao Irrigation District by ICP-AES].

    Science.gov (United States)

    Tong, Wen-Jie; Chen, Fu; Wen, Xin-Ya

    2014-01-01

    The absorption and accumulation of ten mineral elements in four kinds of organs (root, steam, leaf and flower disc) in Helianthus annuus L. plants cultured in Hetao Irrigation District under different level of salinity stress were determined by ICP-AES with wet digestion (HNO3 + HClO4). The results showed that: (1) The contents of Fe, Mn, Zn, Ca, and Na were highest in roots, so was K in stems, B and Mg in leaves and P in flower discs, while no significant difference was detected in the content of Cu among these organs; (2) The cumulants of Ca, Mg, P, Cu, B and Zn were highest in flower discs, so were Na, Fe and Mn in roots and K in stems; (3) In sunflower plants, the proportion of mineral element cumulant for K : Ca : Mg : P : Na was 16.71 : 5.23 : 3.86 : 1.23 : 1.00, and for Zn : Fe : B : Mn: Cu was 56.28 : 27.75 : 1.93 : 1.17 : 1.00, respectively; (4) The effect of salinity stress on absorption of mineral elements differed according to the kind of organ and element, root was the most sensitive to soil salt content, followed by stem and leaf, and the effect on flower disc seemed complex.

  9. Effects of untreated and treated oilfield-produced water on seed germination, seedling development, and biomass production of sunflower (Helianthus annuus L.).

    Science.gov (United States)

    da Costa Marques, Mônica Regina; de Souza, Paulo Sérgio Alves; Rigo, Michelle Machado; Cerqueira, Alexandre Andrade; de Paiva, Julieta L; Merçon, Fábio; Perez, Daniel Vidal

    2015-10-01

    This study aims to evaluate possible toxic effects of oil and other contaminants from oilfield-produced water from oil exploration and production, on seed germination, and seedling development of sunflower (Helianthus annuus L.). In comparison, as treated by electroflocculation, oilfield-produced water, with lower oil and organic matter content, was also used. Electroflocculation treatment of oilfield-produced water achieved significant removals of chemical oxygen demand (COD) (94 %), oil and grease (O&G) (96 %), color (97 %), and turbidity (99 %). Different O&G, COD, and salt levels of untreated and treated oilfield-produced water did not influence germination process and seedling biomass production. Normal seedlings percentage and vigor tended to decrease more intensely in O&G and COD levels, higher than 337.5 mg L(-1) and 1321 mg O2 L(-1), respectively, using untreated oilfield-produced water. These results indicate that this industrial effluent must be treated, in order to not affect adversely seedling development. This way, electroflocculation treatment appears as an interesting alternative to removing oil and soluble organic matter in excess from oilfield-produced water improving sunflower's seedling development and providing a friendly environmental destination for this wastewater, reducing its potential to harm water resources, soil, and biota.

  10. Comparison of MP AES and ICP-MS for analysis of principal and selected trace elements in nitric acid digests of sunflower (Helianthus annuus).

    Science.gov (United States)

    Karlsson, Stefan; Sjöberg, Viktor; Ogar, Anna

    2015-04-01

    The use of nitrogen as plasma gas for microwave plasma atomic emission spectroscopy (MP AES) is an interesting development in analytical science since the running cost can be significantly reduced in comparison to the inductively coupled argon plasma. Here, we evaluate the performance of the Agilent 4100 MP AES instrument for the analysis of principal metals (Ca, K, Mg, and Na), lithogenic metals (Al, Fe, and Mn) and selected trace metals (As, Ba, Cd, Co, Cr, Cu, Mo, Ni, Pb, V, and Zn) in nitric acid plant digests. The digests were prepared by microwave-assisted dissolution of dry plant material from sunflower (Helianthus annuus) in concentrated nitric acid. Comparisons are made with analysis of the same solutions with ICP-MS (Agilent 7500cx) using the octopole reaction system (ORS) in the collision mode for As, Fe, and V. The limits of detection were usually in the low µg L(-1) range and all principal and lithogenic metals were successfully determined with the MP AES and provided almost identical results with the ICP-MS. The same applies for the selected trace metals except for As, Co and Mo where the concentrations were below the detection limit with the MP AES. For successful analysis we recommend that (i) only atom lines are used, (ii) ionization is minimized (e.g. addition of CsNO3) and (iii) the use of internal standards should be considered to resolve spectral interferences. Copyright © 2014 Elsevier B.V. All rights reserved.

  11. Genetics and mapping of a novel downy mildew resistance gene, Pl(18), introgressed from wild Helianthus argophyllus into cultivated sunflower (Helianthus annuus L.).

    Science.gov (United States)

    Qi, L L; Foley, M E; Cai, X W; Gulya, T J

    2016-04-01

    A novel downy mildew resistance gene, Pl(18), was introgressed from wild Helianthus argophyllus into cultivated sunflower and genetically mapped to linkage group 2 of the sunflower genome. The new germplasm, HA-DM1, carrying Pl(18) has been released to the public. Sunflower downy mildew (DM) is considered to be the most destructive foliar disease that has spread to every major sunflower-growing country of the world, except Australia. A new dominant downy mildew resistance gene (Pl 18) transferred from wild Helianthus argophyllus (PI 494573) into cultivated sunflower was mapped to linkage group (LG) 2 of the sunflower genome using bulked segregant analysis with 869 simple sequence repeat (SSR) markers. Phenotyping 142 BC1F2:3 families derived from the cross of HA 89 and H. argophyllus confirmed the single gene inheritance of resistance. Since no other Pl gene has been mapped to LG2, this gene was novel and designated as Pl (18). SSR markers CRT214 and ORS203 flanked Pl(18) at a genetic distance of 1.1 and 0.4 cM, respectively. Forty-six single nucleotide polymorphism (SNP) markers that cover the Pl(18) region were surveyed for saturation mapping of the region. Six co-segregating SNP markers were 1.2 cM distal to Pl(18), and another four co-segregating SNP markers were 0.9 cM proximal to Pl(18). The new BC2F4-derived germplasm, HA-DM1, carrying Pl(18) has been released to the public. This new line is highly resistant to all Plasmopara halstedii races identified in the USA providing breeders with an effective new source of resistance against downy mildew in sunflower. The molecular markers that were developed will be especially useful in marker-assisted selection and pyramiding of Pl resistance genes because of their close proximity to the gene and the availability of high-throughput SNP detection assays.

  12. Líneas de girasol de la EEA Pergamino

    Directory of Open Access Journals (Sweden)

    GONZÁLEZ, J

    2011-04-01

    Full Text Available Se analizaron tres grupos de líneas de girasol (Helianthus annuus de la EEA Pergamino del INTA. Grupo 1: líneas derivadas de los compuestos P1, P2, P4, PGRK y KLM liberadas en la década del 90. Grupo 2: líneas GP logradas de cruzas entre las del grupo 1 con otras fuentes, liberadas a partir del 2001. Grupo 3: líneas AO (contenido de oleico > 80% derivadas de materiales del North Dakota y de cruzas con materiales locales. Se analizaron los siguientes caracteres: número de aquenios por capítulo, peso de cien aquenios, porcentaje de pepita y aceite, altura de planta y número de días desde siembra a floración. El objetivo fue evaluar la variabilidad del germoplasma entre grupos y las asociaciones entre caracteres dentro de cada grupo, para identificar el idiotipo y las características diferenciales. El efecto de la selección se manifestó claramente al comparar los grupos. En el Grupo 1, la selección se efectuó principalmente por rendimiento de semilla y en los Grupos 2 y 3, se dirigió a la mejora del contenido porcentual de aceite y contenido porcentual de oleico respectivamente. Las líneas del Grupo 2 y Grupo 3 (AO superaron en contenido de aceite a las del Grupo 1, las cuales fueron de mayor altura y peso de aquenio. Dentro de cada grupo se identificaron de 4 a 6 subgrupos caracterizados por los objetivos del mejoramiento y diferenciándose líneas independientes derivadas por objetivos de selección indirecta. El germoplasma evaluado podría incorporarse a diferentes “backgrounds” genéticos según los objetivos del mejoramiento.

  13. Osmotic and Salt Stresses Modulate Spontaneous and Glutamate-Induced Action Potentials and Distinguish between Growth and Circumnutation in Helianthus annuus Seedlings

    Directory of Open Access Journals (Sweden)

    Maria Stolarz

    2017-10-01

    Full Text Available Action potentials (APs, i.e., long-distance electrical signals, and circumnutations (CN, i.e., endogenous plant organ movements, are shaped by ion fluxes and content in excitable and motor tissues. The appearance of APs and CN as well as growth parameters in seedlings and 3-week old plants of Helianthus annuus treated with osmotic and salt stress (0–500 mOsm were studied. Time-lapse photography and extracellular measurements of electrical potential changes were performed. The hypocotyl length was strongly reduced by the osmotic and salt stress. CN intensity declined due to the osmotic but not salt stress. The period of CN in mild salt stress was similar to the control (~164 min and increased to more than 200 min in osmotic stress. In sunflower seedlings growing in a hydroponic medium, spontaneous APs (SAPs propagating basipetally and acropetally with a velocity of 12–20 cm min−1 were observed. The number of SAPs increased 2–3 times (7–10 SAPs 24 h−1plant−1 in the mild salt stress (160 mOsm NaCl and KCl, compared to the control and strong salt stress (3–4 SAPs 24 h−1 plant−1 in the control and 300 mOsm KCl and NaCl. Glutamate-induced series of APs were inhibited in the strong salt stress-treated seedlings but not at the mild salt stress and osmotic stress. Additionally, in 3-week old plants, the injection of the hypo- or hyperosmotic solution at the base of the sunflower stem evoked series of APs (3–24 APs transmitted along the stem. It has been shown that osmotic and salt stresses modulate differently hypocotyl growth and CN and have an effect on spontaneous and evoked APs in sunflower seedlings. We suggested that potassium, sodium, and chloride ions at stress concentrations in the nutrient medium modulate sunflower excitability and CN.

  14. Candidate gene association mapping of Sclerotinia stalk rot resistance in sunflower (Helianthus annuus L.) uncovers the importance of COI1 homologs.

    Science.gov (United States)

    Talukder, Zahirul I; Hulke, Brent S; Qi, Lili; Scheffler, Brian E; Pegadaraju, Venkatramana; McPhee, Kevin; Gulya, Thomas J

    2014-01-01

    Functional markers for Sclerotinia basal stalk rot resistance in sunflower were obtained using gene-level information from the model species Arabidopsis thaliana. Sclerotinia stalk rot, caused by Sclerotinia sclerotiorum, is one of the most destructive diseases of sunflower (Helianthus annuus L.) worldwide. Markers for genes controlling resistance to S. sclerotiorum will enable efficient marker-assisted selection (MAS). We sequenced eight candidate genes homologous to Arabidopsis thaliana defense genes known to be associated with Sclerotinia disease resistance in a sunflower association mapping population evaluated for Sclerotinia stalk rot resistance. The total candidate gene sequence regions covered a concatenated length of 3,791 bp per individual. A total of 187 polymorphic sites were detected for all candidate gene sequences, 149 of which were single nucleotide polymorphisms (SNPs) and 38 were insertions/deletions. Eight SNPs in the coding regions led to changes in amino acid codons. Linkage disequilibrium decay throughout the candidate gene regions declined on average to an r (2) = 0.2 for genetic intervals of 120 bp, but extended up to 350 bp with r (2) = 0.1. A general linear model with modification to account for population structure was found the best fitting model for this population and was used for association mapping. Both HaCOI1-1 and HaCOI1-2 were found to be strongly associated with Sclerotinia stalk rot resistance and explained 7.4 % of phenotypic variation in this population. These SNP markers associated with Sclerotinia stalk rot resistance can potentially be applied to the selection of favorable genotypes, which will significantly improve the efficiency of MAS during the development of stalk rot resistant cultivars.

  15. A GRAS-like gene of sunflower (Helianthus annuus L.) alters the gibberellin content and axillary meristem outgrowth in transgenic Arabidopsis plants.

    Science.gov (United States)

    Fambrini, M; Mariotti, L; Parlanti, S; Salvini, M; Pugliesi, C

    2015-11-01

    The GRAS proteins belong to a plant transcriptional regulator family that function in the regulation of plant growth and development. Despite their important roles, in sunflower only one GRAS gene (HaDella1) with the DELLA domain has been reported. Here, we provide a functional characterisation of a GRAS-like gene from Helianthus annuus (Ha-GRASL) lacking the DELLA motif. The Ha-GRASL gene contains an intronless open reading frame of 1,743 bp encoding 580 amino acids. Conserved motifs in the GRAS domain are detected, including VHIID, PFYRE, SAW and two LHR motifs. Within the VHII motif, the P-H-N-D-Q-L residues are entirely maintained. Phylogenetic analysis reveals that Ha-GRASL belongs to the SCARECROW LIKE4/7 (SCL4/7) subfamily of the GRAS consensus tree. Accumulation of Ha-GRASL mRNA at the adaxial boundaries from P6/P7 leaf primordia suggests a role of Ha-GRASL in the initiation of median and basal axillary meristems (AMs) of sunflower. When Ha-GRASL is over-expressed in Arabidopsis wild-type plants, the number of lateral bolts increases differently from untransformed plants. However, Ha-GRASL slightly affects the lateral suppressor (las-4-) mutation. Therefore, we hypothesise that Ha-GRASL and LAS are not functionally equivalent. The over-expression of Ha-GRASL reduces metabolic flow of gibberellins (GAs) in Arabidopsis and this modification could be relevant in AM development. Phylogenetic analysis includes LAS and SCL4/7 in the same major clade, suggesting a more recent separation of these genes with respect to other GRAS members. We propose that some features of their ancestor, as well as AM initiation and outgrowth, are partially retained in both LAS and SCL4/7. © 2015 German Botanical Society and The Royal Botanical Society of the Netherlands.

  16. Physiological and biochemical responses of sunflower (Helianthus annuus L.) exposed to nano-CeO2 and excess boron: Modulation of boron phytotoxicity.

    Science.gov (United States)

    Tassi, E; Giorgetti, L; Morelli, E; Peralta-Videa, J R; Gardea-Torresdey, J L; Barbafieri, M

    2017-01-01

    Little is known about the interaction of nanoparticles (NPs) with soil constituents and their effects in plants. Boron (B), an essential micronutrient that reduces crop production at both deficiency and excess, has not been investigated with respect to its interaction with cerium oxide NPs (nano-CeO 2 ). Considering conflicting results on the nano-CeO 2 toxicity and protective role as antioxidant, their possible modulation on B toxicity in sunflower (Helianthus annuus L.) was investigated. Sunflower was cultivated for 30 days in garden pots containing original or B-spiked soil amended with nano-CeO 2 at 0-800 mg kg -1 . At harvest, Ce and B concentrations in tissues, biomass, and activities of stress enzymes in leaves were determined. Results showed that in the original soil, Ce accumulated mainly in roots, with little translocation to stems and leaves, while reduced root Ce was observed in plants from B-spiked soil. In the original soil, higher levels of nano-CeO 2 reduced plant B concentration. Although morphological effects were not visible, changes in biomass and oxidative stress response were observed. Sunflower leaves from B-spiked soil showed visible symptoms of B toxicity, such as necrosis and chlorosis in old leaves, as well as an increase of superoxide dismutase (SOD) activity. However, at high nano-CeO 2 level, SOD activity decreased reaching values similar to that of the control. This study has shown that nano-CeO 2 reduced both the B nutritional status of sunflower in original soil and the B phytotoxicity in B-spiked soil. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

  17. Ridge sowing of sunflower (Helianthus annuus L.) in a minimum till system improves the productivity, oil quality, and profitability on a sandy loam soil under an arid climate.

    Science.gov (United States)

    Sher, Ahmad; Suleman, Muhammad; Qayyum, Abdul; Sattar, Abdul; Wasaya, Allah; Ijaz, Muhammad; Nawaz, Ahmad

    2018-02-14

    Sunflower (Helianthus annuus L.) is a major oilseed crop grown for its edible oil across the globe including Pakistan. In Pakistan, the production of edible oil is less than the required quantity; the situation is being worsened with the increasing population. Thus, there is dire need to grow those sunflower genotypes which perform better under a given set of agronomic practices. In this 2-year study, we compared four sunflower genotypes, viz., Armoni, Kundi, Sinji, and S-278 for their yield potential, oil contents, fatty acid composition, and profitability under three sowing methods, viz., bed sowing, line sowing, and ridge sowing and two tillage system, viz., plow till and minimum till. Among the sunflower genotypes, the genotype Armoni produced the highest plant height, number of leaves, head diameter, 1000-achene weight, and achene yield; the oil contents and oleic acid were the highest in genotype Sinji. Among the sowing methods, the highest number of leaves per plant, head diameter, number of achenes per head, achene yield, and oil contents were recorded in ridge sowing. Among the tillage systems, the highest head diameter 16. 2 cm, 1000-achene weight (57.2 g), achene yield (1.8 t ha -1 ), oil contents (35.2%), and oleic acid (15.2%) were recorded in minimum till sunflower. The highest net benefits and benefit to cost ratio were recorded in minimum till ridge sown Armoni genotype. In conclusion, the genotype Armoni should be grown on ridges to achieve the highest achene yield, oil contents, and net profitability.

  18. Comportamento de Apis mellifera L. africanizada em flor de girassol (Helianthus annuus L. e avaliação do desenvolvimento de uma colônia de Apis mellifera em área de girassol coberta Behavior of Apis mellifera L. Africanized honeybees in sunflower (Helianthus annuus L. and evaluation of Apis mellifera L. colony inside covered area of sunflower

    Directory of Open Access Journals (Sweden)

    Vagner de Alencar Arnaut de Toledo

    2002-04-01

    Full Text Available O presente experimento objetivou avaliar o comportamento polinizador da Apis mellifera L. (Hymenoptera, Apidae africanizada e o desenvolvimento da colônia em área coberta de girassol, Helianthus annuus L. (Asteraceae. Foi utilizada uma área somente demarcada de 8 m x 3 m, e o desenvolvimento da colônia dentro de uma gaiola telada com 8 m x 3 m com dois metros de altura na sua porção mais alta. A abelha mais constante visitando o girassol durante todo o dia foi a Apis mellifera, embora os halictídeos tenham sido os mais freqüentes coletores de pólen, sendo estes vistos somente nas manhãs até às 11h. Na área coberta, houve uma redução de 34,74% no peso do enxame, 38,08% de mel, 100% no número de pupas de operárias e uma redução de 99,37% no número de ovos/larvas. As abelhas coletaram mais néctar do que pólen uniformemente ao longo do dia. No girassol, as abelhas coletoras de néctar têm influência na polinização da cultura maior do que as coletoras de pólen e néctar/pólenThis research was carried out to evaluate the behavior of africanized honeybees, Apis mellifera L. (Hymenoptera, Apidae and the development of a colony inside a covered area of sunflower, Helianthus annuus L. (Asteraceae crop. It was used an area marked with 8 m x 3 m, and a second area in which a honeybee colony was installed inside a covered area with wire screen of 8m x 3m, two meters high in the highest part. The honeybees were constantly on sunflower during all day, however the Halictidae bees had been the most frequent in pollen harvesting, but these bees were seen until 11 a.m. In covered area, it occurred a reduction of 34.74% in swarm weight, 38.08% in honey, 100% in worker pupae, and 99.37% in egg-larvae. The honeybees gathered more nectar than pollen during the day. The nectar forager has more effect upon crop pollination than pollen foragers and pollen/nectar foragers, in sunflower.

  19. Identification and characterization of two bisabolene synthases from linear glandular trichomes of sunflower (Helianthus annuus L., Asteraceae).

    Science.gov (United States)

    Aschenbrenner, Anna-Katharina; Kwon, Moonhyuk; Conrad, Jürgen; Ro, Dae-Kyun; Spring, Otmar

    2016-04-01

    Sunflower is known to produce a variety of bisabolene-type sesquiterpenes and accumulates these substances in trichomes of leaves, stems and flowering parts. A bioinformatics approach was used to identify the enzyme responsible for the initial step in the biosynthesis of these compounds from its precursor farnesyl pyrophosphate. Based on sequence similarity with a known bisabolene synthases from Arabidopsis thaliana AtTPS12, candidate genes of Helianthus were searched in EST-database and used to design specific primers. PCR experiments identified two candidates in the RNA pool of linear glandular trichomes of sunflower. Their sequences contained the typical motifs of sesquiterpene synthases and their expression in yeast functionally characterized them as bisabolene synthases. Spectroscopic analysis identified the stereochemistry of the product of both enzymes as (Z)-γ-bisabolene. The origin of the two sunflower bisabolene synthase genes from the transcripts of linear trichomes indicates that they may be involved in the synthesis of sesquiterpenes produced in these trichomes. Comparison of the amino acid sequences of the sunflower bisabolene synthases showed high similarity with sesquiterpene synthases from other Asteracean species and indicated putative evolutionary origin from a β-farnesene synthase. Copyright © 2016 Elsevier Ltd. All rights reserved.

  20. Genetics and mapping of the R₁₁ gene conferring resistance to recently emerged rust races, tightly linked to male fertility restoration, in sunflower (Helianthus annuus L.).

    Science.gov (United States)

    Qi, L L; Seiler, G J; Vick, B A; Gulya, T J

    2012-09-01

    Sunflower oil is one of the major sources of edible oil. As the second largest hybrid crop in the world, hybrid sunflowers are developed by using the PET1 cytoplasmic male sterility system that contributes to a 20 % yield advantage over the open-pollinated varieties. However, sunflower production in North America has recently been threatened by the evolution of new virulent pathotypes of sunflower rust caused by the fungus Puccinia helianthi Schwein. Rf ANN-1742, an 'HA 89' backcross restorer line derived from wild annual sunflower (Helianthus annuus L.), was identified as resistant to the newly emerged rust races. The aim of this study was to elucidate the inheritance of rust resistance and male fertility restoration and identify the chromosome location of the underlying genes in Rf ANN-1742. Chi-squared analysis of the segregation of rust response and male fertility in F(2) and F(3) populations revealed that both traits are controlled by single dominant genes, and that the rust resistance gene is closely linked to the restorer gene in the coupling phase. The two genes were designated as R ( 11 ) and Rf5, respectively. A set of 723 mapped SSR markers of sunflower was used to screen the polymorphism between HA 89 and the resistant plant. Bulked segregant analysis subsequently located R ( 11 ) on linkage group (LG) 13 of sunflower. Based on the SSR analyses of 192 F(2) individuals, R ( 11 ) and Rf5 both mapped to the lower end of LG13 at a genetic distance of 1.6 cM, and shared a common marker, ORS728, which was mapped 1.3 cM proximal to Rf5 and 0.3 cM distal to R ( 11 ) (Rf5/ORS728/R ( 11 )). Two additional SSRs were linked to Rf5 and R ( 11 ): ORS995 was 4.5 cM distal to Rf5 and ORS45 was 1.0 cM proximal to R ( 11 ). The advantage of such an introduced alien segment harboring two genes is its large phenotypic effect and simple inheritance, thereby facilitating their rapid deployment in sunflower breeding programs. Suppressed recombination was observed in LGs 2, 9

  1. Molecular cloning, phylogenetic analysis, and expression patterns of LATERAL SUPPRESSOR-LIKE and REGULATOR OF AXILLARY MERISTEM FORMATION-LIKE genes in sunflower (Helianthus annuus L.).

    Science.gov (United States)

    Fambrini, Marco; Salvini, Mariangela; Pugliesi, Claudio

    2017-03-01

    The wild sunflower (Helianthus annuus) plants develop a highly branched form with numerous small flowering heads. The origin of a no branched sunflower, producing a single large head, has been a key event in the domestication process of this species. The interaction between hormonal factors and several genes organizes the initiation and outgrowth of axillary meristems (AMs). From sunflower, we have isolated two genes putatively involved in this process, LATERAL SUPPRESSOR (LS)-LIKE (Ha-LSL) and REGULATOR OF AXILLARY MERISTEM FORMATION (ROX)-LIKE (Ha-ROXL), encoding for a GRAS and a bHLH transcription factor (TF), respectively. Typical amino acid residues and phylogenetic analyses suggest that Ha-LSL and Ha-ROXL are the orthologs of the branching regulator LS and ROX/LAX1, involved in the growth habit of both dicot and monocot species. qRT-PCR analyses revealed a high accumulation of Ha-LSL transcripts in roots, vegetative shoots, and inflorescence shoots. By contrast, in internodal stems and young leaves, a lower amount of Ha-LSL transcripts was observed. A comparison of transcription patterns between Ha-LSL and Ha-ROXL revealed some analogies but also remarkable differences; in fact, the gene Ha-ROXL displayed a low expression level in all organs analyzed. In situ hybridization (ISH) analysis showed that Ha-ROXL transcription was strongly restricted to a small domain within the boundary zone separating the shoot apical meristem (SAM) and the leaf primordia and in restricted regions of the inflorescence meristem, beforehand the separation of floral bracts from disc flower primordia. These results suggested that Ha-ROXL may be involved to establish a cell niche for the initiation of AMs as well as flower primordia. The accumulation of Ha-LSL transcripts was not restricted to the boundary zones in vegetative and inflorescence shoots, but the mRNA activity was expanded in other cellular domains of primary shoot apical meristem as well as AMs. In addition, Ha

  2. Growth and N2-fixation of dhaincha (Sesbania aculata) and sunflower (Helianthus annuus) in an inter cropping system using natural abundances of 15N and 13C

    International Nuclear Information System (INIS)

    Kurdali, F.

    2010-06-01

    A field experiment on dhaincha (Sesbania aculata) and sunflower (Helianthus annuus) plants grown in mono cropping and inter cropping systems was conducted to evaluate seed yield , oil content, dry matter production (DM), land equivalent ratio (LER), N- yield, competition for soil N uptake and N 2 -fixation using 13 C and 15 N natural abundance techniques. Three different combinations of sesbania (ses) and sunflower (sun) were investigated in the inter cropping system (1ses:1sun; 1ses:2sun, and 2ses:1sun, row ratio). The results showed that: From productivity standpoint, the 1ses:1sun surpassed the other treatments in terms of N and DM yields and exhibited a similar distribution of total DM and N uptake in the sesbania and sunflower plant species. The 1ses:2sun was next in order in terms of DM and N uptake showing also a similar distribution of total N in both plant species. On the other hand, the 1ses:2sun gave the greatest seed and oil production and together with 1ses:1sun treatment were satisfactory in terms of LER for DM in both species having almost similar values. However, the former treatment was more appropriate than the latter because of its higher LER value for seed and oil yield of sunflower plants. Nevertheless, 2ses:1sun treatment seemed not to be an appropriate treatment due to the divergence of LER values in both species, where sunflower plants had a low value as compared to sesbania. From ecological standpoint, the best treatment was 1ses:2sun which showed the greatest N 2 -fixation. Sesbania plants fixed almost identical amounts of atmospheric N 2 in both the mono cropping and inter cropping systems although the density of these plants in the latter was only 1/3 that of the former system. Moreover, soil N-uptake in the 1ses:2sun was the lowest among other treatments. These results give an advantage to the 1ses:2sun treatment over other treatments in terms of soil N consumption and N 2 fixation to meet sesbania's N requirements. %Δ 13 C in the

  3. [Agrobacterium-mediated sunflower transformation (Helianthus annuus L.) in vitro and in Planta using strain of LBA4404 harboring binary vector pBi2E with dsRNA-suppressor proline dehydrogenase gene].

    Science.gov (United States)

    Tishchenko, E N; Komisarenko, A G; Mikhal'skaia, S I; Sergeeva, L E; Adamenko, N I; Morgun, B V; Kochetov, A V

    2014-01-01

    To estimate the efficiency of proline dehydrogenase gene suppression towards increasing of sunflower (Helianthus annuus L.) tolerance level to water deficit and salinity, we employed strain LBA4404 harboring pBi2E with double-stranded RNA-suppressor, which were prepared on basis arabidopsis ProDH1 gene. The techniques of Agrobacterium-mediated transformation in vitro and in planta during fertilization sunflower have been proposed. There was shown the genotype-depended integration of T-DNA in sunflower genome. PCR-analysis showed that ProDH1 presents in genome of inbred lines transformed in planta, as well as in T1- and T2-generations. In trans-genic regenerants the essential accumulation of free L-proline during early stages of in vitro cultivation under normal conditions was shown. There was established the essential accumulation of free proline in transgenic regenerants during cultivation under lethal stress pressure (0.4 M mannitol and 2.0% sea water salts) and its decline upon the recovery period. These data are declared about effectiveness of suppression of sunflower ProDH and gene participation in processes connected with osmotolerance.

  4. (Helianthus annuus L.-frijol (Phaseolus vulgaris L. en función del nitrógeno y fósforo

    Directory of Open Access Journals (Sweden)

    Edgar J. Morales Rosales

    2007-01-01

    Full Text Available En 2003 se realizó un estudio en Montecillo, Estado de México, para determinar el efecto de la aplicación de nitrógeno (0, 40 y 80 kg ha–1 y fósforo (0, 30 y 60 kg P2O5 ha–1 en la siembra combinada de girasol (cv. Victoria y frijol (cv. Michoacán. Con el suministro de 80 kg N ha–1 (80 – 00 – 00 se incrementó la producción de biomasa y rendimiento de semilla superando al testigo sin fertilizante en 32% y 35%. Cuando se adicionaron 60 kg P2O5 ha–1 (00 – 60 – 00 se obtuvo una producción de materia seca y rendimiento de semilla superior al testigo en 24 y 27%, respectivamente. Aunque la interacción nitrógeno x fósforo no fue significativa, existió una tendencia positiva a medida de que se incrementaron los niveles de nitrógeno y fósforo (80 – 60 – 00, alcanzando los máximos valores en la producción de biomasa (2667.9 g m–2 y rendimiento de semilla (644.6 g m–2, los cuales superaron en 49 y 50% al testigo sin fertilizante.

  5. Effects of storage and industrial oilseed extraction methods on the quality and stability characteristics of crude sunflower oil (Helianthus annuus L.

    Directory of Open Access Journals (Sweden)

    Demirci, M.

    2011-12-01

    Full Text Available The influence of industrial oilseed extraction methods on the quality and stability of crude sunflower oil (pre-pressed, solvent-extracted, full-pressed and mixed oils was studied by means of the determination of free fatty acids, peroxide value, color value, iron, phosphorus, total and individual tocopherol contents, their stability against oxidation (Rancimat induction time and the fatty acid composition with special emphasis on trans fatty acids. In addition, these crude oils were stored for a period of four months at 40 ± 2°C and analyzed at monthly intervals for free fatty acids, peroxide value, and Rancimat induction time to evaluate their storage stability. The results revealed that the crude sunflower oils obtained by the full-pressed extraction method had worse quality and stability parameters than the crude oils obtained by other extraction methods. Tocopherol content showed a drastic decrease with full-pressed extraction. Also, the crude sunflower oils obtained by the full-pressed extraction presented a higher total trans fatty acid content than the others. On the contrary, the solvent extraction method influenced the phosphorus and iron contents more than the others. The results indicated, however, that pre-pressing the oil appeared to be better than other methods. This study suggests that it is absolutely necessary for the vegetable oil industry to reevaluate the full pressing method as well as the solvent extraction conditions used for sunflowerseeds in order to retain both nutritive value and oxidative stability.La influencia de los métodos industriales de extracción de semillas oleaginosas sobre la calidad y la estabilidad de aceites crudos de girasol (pre-prensado, extraídos con disolventes, prensado completo y mezclas de aceites se ha estudiado mediante la determinación de los ácidos grasos libres, índice de peróxidos, valor del color, hierro, fósforo, contenido de tocoferoles totales e individuales, así como su

  6. Molecular aspects of zygotic embryogenesis in sunflower (Helianthus annuus L.): correlation of positive histone marks with HaWUS expression and putative link HaWUS/HaL1L.

    Science.gov (United States)

    Salvini, Mariangela; Fambrini, Marco; Giorgetti, Lucia; Pugliesi, Claudio

    2016-01-01

    The link HaWUS/ HaL1L , the opposite transcriptional behavior, and the decrease/increase in positive histone marks bond to both genes suggest an inhibitory effect of WUS on HaL1L in sunflower zygotic embryos. In Arabidopsis, a group of transcription factors implicated in the earliest events of embryogenesis is the WUSCHEL-RELATED HOMEOBOX (WOX) protein family including WUSCHEL (WUS) and other 14 WOX protein, some of which contain a conserved WUS-box domain in addition to the homeodomain. WUS transcripts appear very early in embryogenesis, at the 16-cell embryo stage, but gradually become restricted to the center of the developing shoot apical meristem (SAM) primordium and continues to be expressed in cells of the niche/organizing center of SAM and floral meristems to maintain stem cell population. Moreover, WUS has decisive roles in the embryonic program presumably promoting the vegetative-to-embryonic transition and/or maintaining the identity of the embryonic stem cells. However, data on the direct interaction between WUS and key genes for seed development (as LEC1 and L1L) are not collected. The novelty of this report consists in the characterization of Helianthus annuus WUS (HaWUS) gene and in its analysis regarding the pattern of the methylated lysine 4 (K4) of the Histone H3 and of the acetylated histone H3 during the zygotic embryo development. Also, a parallel investigation was performed for HaL1L gene since two copies of the WUS-binding site (WUSATA), previously identified on HaL1L nucleotide sequence, were able to be bound by the HaWUS recombinant protein suggesting a not described effect of HaWUS on HaL1L transcription.

  7. Impact of wheat straw biochar addition to soil on the sorption, leaching, dissipation of the herbicide (4-chloro-2-methylphenoxy)acetic acid and the growth of sunflower (Helianthus annuus L.).

    Science.gov (United States)

    Tatarková, Veronika; Hiller, Edgar; Vaculík, Marek

    2013-06-01

    Biochar addition to agricultural soils might increase the sorption of herbicides, and therefore, affect other sorption-related processes such as leaching, dissipation and toxicity for plants. In this study, the impact of wheat straw biochar on the sorption, leaching and dissipation in a soil, and toxicity for sunflower of (4-chloro-2-methylphenoxy)acetic acid (MCPA), a commonly used ionizable herbicide, was investigated. The results showed that MCPA sorption by biochar and biochar-amended soil (1.0wt% biochar) was 82 and 2.53 times higher than that by the non-amended soil, respectively. However, desorption of MCPA from biochar-amended soil was only 1.17 times lower than its desorption in non-amended soil. Biochar addition to soil reduced both MCPA leaching and dissipation. About 35% of the applied MCPA was transported through biochar-amended soil, while up to 56% was recovered in the leachates transported through non-amended soil. The half-life value of MCPA increased from 5.2d in non-amended soil to 21.5 d in biochar-amended soil. Pot experiments with sunflower (Helianthus annuus L.) grown in MCPA-free, but biochar-amended soil showed no positive effect of biochar on the growth of sunflower in comparison to the non-amended soil. However, biochar itself significantly reduced the content of photosynthetic pigments (chlorophyll a, b) in sunflower. There was no significant difference in the phytotoxic effects of MCPA on sunflowers between the biochar-amended soil and the non-amended soil. Furthermore, MCPA had no effect on the photosynthetic pigment contents in sunflower. Copyright © 2013 Elsevier Inc. All rights reserved.

  8. Contaminação por Aspergillus flavus e A. fumigatus em sementes de girassol (Helianthus annuus utilizados na alimentação de psitacídeos

    Directory of Open Access Journals (Sweden)

    Alexsandro Machado Conceição

    2010-04-01

    Full Text Available http://dx.doi.org/10.5007/2175-7925.2010v23n2p145 Amplamente difundido na alimentação de psitacídeos em razão do preço baixo, elevada palatabilidade, e por razões culturais, o Helianthus annuus, conhecido como girassol, vem se mostrando importante na clínica aviária em decorrência do excesso de calorias, e da alta incidência na contaminação por alguns fungos, principalmente do gênero Aspergillus, especificamente A. flavus e A. fumigatus. O objetivo deste estudo foi avaliar a contaminação por Aspegillus ssp. em sementes de girassol destinada à alimentação de psitacídeos comercializadas em Aracaju, estado de Sergipe. As análises foram realizadas no Laboratório de Microbiologia, do Hospital Veterinário Dr. Vicente Borreli, na Faculdade Pio Décimo. Avaliaram-se quatro amostras de sementes de girassol, sendo uma comercializada no mercado público municipal, de forma granel e três marcas comerciais, envasadas e de diferentes hipermercados, processadas segundo Forsythe (2002. De acordo com a pesquisa realizada, foi possível observar um elevado desenvolvimento de A. flavus e A. fumigatus nas sementes de girassol. Esta contaminação pode estar relacionada a vários fatores: colheita e fases de secagem, beneficiamento e armazenamento do grão inadequado. Além disso, é importante destacar a necessidade de que haja um melhor armazenamento de grãos, com controle de temperatura e umidade relativa, visando reduzir a possibilidade de contaminação por Aspergillus spp. que causa prejuízos na alimentação de psitacídeos, e de outras espécies animais.

  9. Variability in oil tocopherol concentration and composition of traditional and high oleic sunflower hybrids (Helianthus annuus L. in the Pampean region (Argentina

    Directory of Open Access Journals (Sweden)

    Mateo, Carmen

    2006-09-01

    Full Text Available Tocopherols are natural antioxidants that increase the stability of food fat and fulfill an important biological requirement in humans. There are no previous studies on the variability of tocopherol concentration and composition in the oil of sunflower traditional hybrids (TH and high oleic sunflower hybrids (HOH from different environments in Argentina. The objective of this work was to detect and  examine that variability. Seed samples were obtained from i seven TH grown in four locations (Experiment I and, ii five hybrids (three HOH and two traditional ones grown in three locations (Experiment II. Concentrations of total tocopherol in oil ranged from 634 to 1054 μg g oil–1. α-tocopherol accounted for 90.8 to 97% of the total tocopherols. Total and α-tocopherol concentrations were highly genetically determined (more than 80%. In Experiment I, a significant, although low in value, interaction between hybrid and location was found for total and α-tocopherol concentrations. In Experiment II, mean values for total tocopherol concentration in HOH and in each environment were larger than in TH. Significant differences for total and α-tocopherol concentration were not found among HOH and environments. The variation of tocopherol concentration for each hybrid across environments was higher than the variation among hybrids in the same environment. To obtain oil with high tocopherol concentration, both hybrid and environment must be selected.Los tocoferoles son antioxidantes naturales que aumentan la estabilidad de los aceites y cumplen una importante actividad biológica en humanos. No son conocidos estudios sobre la variabilidad del contenido y composición de tocoferoles en el aceite de híbridos de girasol tradicionales (HT y “alto oleico” (HAO sembrados en diferentes ambientes en Argentina. El objetivo de este trabajo fue detectar y examinar esa variabilidad. Las semillas fueron obtenidas de a 7 HT sembrados en 4 localidades

  10. Changes in selected production parameters and fatty acid composition of sunflower (Helianthus annuus, L. in response to nitrogen and phosphorus applications

    Directory of Open Access Journals (Sweden)

    Petr Škarpa

    2008-01-01

    Full Text Available The effect of N and P fertilization on the dry matter content, concentration of nutrients (N, P, K, Ca and Mg and their intake by the plant, production characteristics (achene yields, head diameter, 1000-seed weight, oil content and oil production and the content of fatty acids (palmitic, stearic, palmitooleic, oleic, linoleic and linolenic was evaluated in the one-year pot trial with sunflower (Helianthus an­nuus, L.. Nitrogen application had a positive effect on dry matter production and increased N intake by plants as early as the beginning of vegetation (4th true leaf. The effect of P on dry matter production was not markedly evident until the later growth stage (10th true leaf. At the end of the vegetation period the weight of plants of variants fertilised with N only and variants where P was applied evened out. Achene yields, head diameters, 1000-seed weight, oil content and oil production increased statistically significantly after N application. Of all the monitored characteristics the increased level of P in the soil affected only the 1000-seed weight. The application of both nutrients did not significantly change the content of fatty acids.

  11. Nongenotoxic effects and a reduction of the DXR-induced genotoxic effects of Helianthus annuus Linné (sunflower) seeds revealed by micronucleus assays in mouse bone marrow.

    Science.gov (United States)

    Boriollo, Marcelo Fabiano Gomes; Souza, Luiz Silva; Resende, Marielly Reis; Silva, Thaísla Andrielle da; Oliveira, Nelma de Mello Silva; Resck, Maria Cristina Costa; Dias, Carlos Tadeu dos Santos; Fiorini, João Evangelista

    2014-04-02

    This research evaluated the genotoxicity of oil and tincture of H. annuus L. seeds using the micronucleus assay in bone marrow of mice. The interaction between these preparations and the genotoxic effects of doxorubicin (DXR) was also analysed (antigenotoxicity test). Experimental groups were evaluated at 24-48 h post treatment with N-Nitroso-N-ethylurea (positive control - NEU), DXR (chemotherapeutic), NaCl (negative control), a sunflower tincture (THALS) and two sources of sunflower oils (POHALS and FOHALS). Antigenotoxic assays were carried out using the sunflower tincture and oils separately and in combination with NUE or DXR. For THALS, analysis of the MNPCEs showed no significant differences between treatment doses (250-2,000 mg.Kg-1) and NaCl. A significant reduction in MNPCE was observed when THALS (2,000 mg.Kg-1) was administered in combination with DXR (5 mg.Kg-1). For POHALS or FOHALS, analysis of the MNPCEs also showed no significant differences between treatment doses (250-2,000 mg.Kg-1) and NaCl. However, the combination DXR + POHALS (2,000 mg.Kg-1) or DXR + FOHALS (2,000 mg.Kg-1) not contributed to the MNPCEs reduction. This research suggests absence of genotoxicity of THALS, dose-, time- and sex-independent, and its combination with DXR can reduce the genotoxic effects of DXR. POHALS and FOHALS also showed absence of genotoxicity, but their association with DXR showed no antigenotoxic effects.

  12. Estudio de la estabilidad de aceite comestible de girasol coloreado con pigmentos clorofílicos y con adición de oleorresina de orégano (Origanum vulgare L. durante el almacenamiento en oscuridad.

    Directory of Open Access Journals (Sweden)

    Ihl, Mónica

    2002-09-01

    Full Text Available Sunflower (Helianthus annuus L. oil was coloured with pigments extracted from green leaves. Different amounts (0, 200, 400, 600, and 800 ppm of oleoresin extracted from oregano (Origanum vulgare L. as antioxidant, were added to the coloured oil. As controls, coloured oil without oleoresin (A.C. and pure oil (A.P. were used. The samples were stored at room temperature (10-20 ºC in the dark for up to six months. During this time the oxidation of oleic acid, linoleic acid, peroxides index and the chlorophyll pigments were analized and the colour of the oil was determined. During the first month, only the ratio of chlorophyll to pheophytin changed, whereas all the other parameters stayed constant, independently to the amount of antioxidant added. Since among the treatments A.C. and A.P. not significant differences (p >0,05 were found, for oleic and linoleic methyl ester acids and peroxides index, it can be concluded that the edible, coloured sunflower oil shows an equivalent stability to the pure oil, when stored at darkness for three or six month. There was not observed an evident antioxidant action with the added oregano oleorresin to the coloured oil.Se estudió la estabilidad de aceite comestible de girasol (Helianthus annuus L. de marca comercial sin antioxidantes, coloreado con pigmentos obtenidos de hojas verdes. Al aceite coloreado se adicionó oleorresina de orégano, como antioxidante, en cuatro concentraciones diferentes (200, 400, 600 y 800 ppm. Como controles, se utilizó aceite coloreado sin oleorresina (A.C. y aceite puro (A.P.. Se almacenó en oscuridad y temperatura ambiente (10-20 ºC por seis meses. Se evaluó la oxidación de lípidos (ésteres metílicos de ácidos oleico y linoleico e índice de peróxidos, pigmentos clorofílicos y color.El total de los pigmentos clorofilicos adicionados a las muestras de aceite comestible de girasol se mantuvo estable durante los tres primeros meses, evidenciándose sólo cambios en la

  13. (Helianthus annuus L.) on physiology of wheat

    African Journals Online (AJOL)

    STORAGESEVER

    2009-08-04

    Aug 4, 2009 ... Enzymatic Analysis Vol. II. Acadmic Press, London, pp. 685-690. Salisbury FB, Ross CW (1992). Plant physiology. Fourth Edition. Wadworth Publ. Co., Belmont. p. 682. Wardle DA, Ahmad M, Nicholson KS (1991). Allelopathic influence of nodding thistle (Cardus nutans L.) seed on germination and radicle.

  14. Emulsion properties of sunflower (Helianthus annuus) proteins

    NARCIS (Netherlands)

    Gonzalez-Perez, S.; Koningsveld, van G.A.; Vereijken, J.M.; Merck, K.B.; Gruppen, H.; Voragen, A.G.J.

    2005-01-01

    Emulsions were made with sunflower protein isolate (SI), helianthinin, and sunflower albumins (SFAs). Emulsion formation and stabilization were studied as a function of pH and ionic strength and after heat treatment of the proteins. The emulsions were characterized with respect to average droplet

  15. Phyto-accumulation of heavy metals by sunflower ( Helianthus ...

    African Journals Online (AJOL)

    This study was carried out at the Institute of Biotechnology and Genetic Engineering, KPK Agricultural University, Peshawar, Pakistan to investigate the phyto-accumulation capacity of heavy metals [lead (Pb), chromium (Cr) and cadmium (Cd)] by two cultivars of sunflower (Helianthus annuus L.). The experiment was ...

  16. Patterns of microsatellite evolution inferred from the Helianthus ...

    Indian Academy of Sciences (India)

    2014-08-21

    Aug 21, 2014 ... Abstract. The distribution of microsatellites in exons, and their association with gene ontology (GO) terms is explored to elucidate patterns of microsatellite evolution in the common sunflower, Helianthus annuus. The relative position, motif, size and level of impurity were estimated for each microsatellite in ...

  17. Allelopathic potential of sunflower (Helianthus annus L.) on soil ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-09-17

    Sep 17, 2008 ... The effect of a sunflower (Helianthus annuus L.) variety, namely Hysun 38, on metals and of aqueous extracts of its leaves on germination in two varieties of wheat, namely Margalla 99 and Chakwall 97, were studied under laboratory conditions. In particular, the effect of leaf extract on hormones produced ...

  18. Identification and Pathogenicity of Phytopathogenic Bacteria Associated with Soft Rot Disease of Girasole Tuber

    Directory of Open Access Journals (Sweden)

    Mamdoh Ewis ISMAIL

    2012-02-01

    Full Text Available During 2010-2011 growing seasons six bacterial isolates were separated from naturally infected girasole plants tubers (Helianthus tuberosus L. cv. Balady, showing soft rot, collected from experimental Farm of the Faculty of Agriculture, in El-Minia University, Egypt. Pathogenicity tests showed various virulence for the bacteria isolated from girasole tubers, found pathogenic. These organisms were characterized as rod-shaped, Gram negative, ?-methyl-d-glucoside medium, reducing substances from sucrose, phos, phatase activity and deep cavities on pectate medium. Otherwise, diagnostic tests suggested that the pathogen was Erwinia carotovora ssp. carotovora. The isolated bacteria caused soft rot of wounded tubers when inoculated into tissues. The bacterial isolates were compared for their degree of pathogenicity as well as for differences in specific symptoms, induced in different hosts. The tested isolates could infect several host ranges, such as fruits of apricot, apple, olive, lemon, squash, eggplant and potato tubers, bulbs and garlic and onion cloves, roots radish, carrot, sweet potato and rape. On the other hand, no symptoms were exhibited on pods of bean and cowpea, faba bean, fruits of pepper and tomato. The extracts of experimentally diseased girasole tubers were active in pectinase and also in caboxymethyl cellulose at pH 6 compared to enzyme activities in healthy tissues. Also, the isolated bacteria increased the total and reducing sugars in infected tissues.

  19. Identification and Pathogenicity of Phytopathogenic Bacteria Associated with Soft Rot Disease of Girasole Tuber

    Directory of Open Access Journals (Sweden)

    Mamdoh Ewis ISMAIL

    2012-02-01

    Full Text Available During 2010-2011 growing seasons six bacterial isolates were separated from naturally infected girasole plants tubers (Helianthus tuberosus L. cv. �Balady�, showing soft rot, collected from experimental Farm of the Faculty of Agriculture, in El-Minia University, Egypt. Pathogenicity tests showed various virulence for the bacteria isolated from girasole tubers, found pathogenic. These organisms were characterized as rod-shaped, Gram negative, ?-methyl-d-glucoside medium, reducing substances from sucrose, phos, phatase activity and deep cavities on pectate medium. Otherwise, diagnostic tests suggested that the pathogen was Erwinia carotovora ssp. carotovora. The isolated bacteria caused soft rot of wounded tubers when inoculated into tissues. The bacterial isolates were compared for their degree of pathogenicity as well as for differences in specific symptoms, induced in different hosts. The tested isolates could infect several host ranges, such as fruits of apricot, apple, olive, lemon, squash, eggplant and potato tubers, bulbs and garlic and onion cloves, roots radish, carrot, sweet potato and rape. On the other hand, no symptoms were exhibited on pods of bean and cowpea, faba bean, fruits of pepper and tomato. The extracts of experimentally diseased girasole tubers were active in pectinase and also in caboxymethyl cellulose at pH 6 compared to enzyme activities in healthy tissues. Also, the isolated bacteria increased the total and reducing sugars in infected tissues.

  20. [Study of Chloroplast DNA Polymorphism in the Sunflower (Helianthus L.)].

    Science.gov (United States)

    Markina, N V; Usatov, A V; Logacheva, M D; Azarin, K V; Gorbachenko, C F; Kornienko, I V; Gavrilova, V A; Tihobaeva, V E

    2015-08-01

    The polymorphism of microsatellite loci of chloroplast genome in six Helianthus species and 46 lines of cultivated sunflower H. annuus (17 CMS lines and 29 Rf-lines) were studied. The differences between species are confined to four SSR loci. Within cultivated forms of the sunflower H. annuus, the polymorphism is absent. A comparative analysis was performed on sequences of the cpDNA inbred line 3629, line 398941 of the wild sunflower, and the American line HA383 H. annuus. As a result, 52 polymorphic loci represented by 27 SSR and 25 SNP were found; they can be used for genotyping of H. annuus samples, including cultural varieties: twelve polymorphic positions, of which eight are SSR and four are SNP.

  1. Effect of nitrogen on achene protein, oil, fatty acid profile, and yield of sunflower hybrids Efecto de nitrógeno en la proteína, aceite, y perfil de ácidos grasos del aquenio y rendimiento de híbridos de girasol

    Directory of Open Access Journals (Sweden)

    Amjed Ali

    2012-12-01

    Full Text Available Seed yield and achene oil yield are the main determinants for N application rates rather than seed composition. Nitrogen plays a critical role in producing unsaturated fatty acids (oleic and linoleic acids, which are the main factors determining sunflower oil quality (Helianthus annuus L.. Studies were conducted on the effect of N fertilization on seed yield, achene oil yield, and quality parameters of sunflower hybrids for two successive years (2010 and 2011 in a split plot arrangement under a randomized complete block design. The hybrids (Hysun-33 & S-278 and N levels (0, 75, 150, and 225 kg ha-1 were allotted in main and sub-plots, respectively. Increasing N levels resulted in steady increases in yield, protein contents and linoleic acid, whereas oil contents and percentage of oleic acid responded negatively during both years. At the same time, crop oil yield was positively related to increased N supply with higher achene yield (AY. Palmitic acid varied from 5.27 to 6.42 % and stearic acid ranged from 2.27 to 2.95%. Hybrid S-278 exhibited significantly (P Parece racional que el rendimiento de semilla y rendimiento de aceite de aquenio sigan siendo el foco determinante para tasas de aplicación de N en lugar de la composición de la semilla. El N parece jugar un papel imprescindible en la proporción de ácidos grasos insaturados (ácidos oleico y linoleico, factor principal que determina el aceite de girasol (Helianthus annuus L.. Los estudios fueron realizados para evaluar el efecto de la fertilización N en el rendimiento de semilla, rendimiento de aceite de aquenio, y parámetros de calidad de híbridos de girasol por 2 anos sucesivos (2010 y 2011 en un diseno de bloques completos al azar con arreglo de parcelas divididas. Los híbridos (Hysun-33 y S-278 y niveles de N (0, 75, 150 y 225 kg ha-1 fueron asignados a parcelas principales y sub parcelas, respectivamente. Niveles crecientes de N aumentaron de manera estable el rendimiento

  2. Clonación y caracterización de las aciltransferasas lpaat y dagat implicadas en la síntesis de triacilglicéridos en semillas de girasol (helianthus annuus l.) y obtención de líneas con composición modificada de lípidos

    OpenAIRE

    Fernández García, Juan Diego

    2016-01-01

    Falta palabras clave Las oleaginosas son plantas de cuya semilla o fruto puede extraerse aceite. Los aceites vegetales son muy importantes desde un punto de vista económico, por la gran versatilidad de sus aplicaciones, ya sea en alimentación, tanto animal como humana, como en aplicaciones industriales, desde síntesis química a disolventes o biolubricantes. Sin embargo, no todos los aceites disponibles en la actualidad poseen las características tecnológicas requeridas pa...

  3. Creating Sunflower Mutant Lines (Helianthus Annuus L.) Using Induced Mutagenesis

    International Nuclear Information System (INIS)

    Encheva, J.

    2009-01-01

    Immature sunflower zygotic embryos of sunflower fertility restorer line 374 R were treated with ultrasound and gamma radiation before plating embryos to culture medium. All plants were isolated and self-pollinated for several generations. New sunflower forms with inherited morphological and biochemical changes were obtained. The genetic changes occurring during the mutation procedure included fourteen morphological and biochemical characters. In comparison to the check line 374 R, decreasing of the mean value of the indexes was registered for 33 % of the total number of characters and vise verse, significant increasing was observed for 60 %. Mutation for resistance to the local population of Orobanche cumana race A-E was obtained from the susceptible Bulgarian control line 374 R. Two investigated mutant lines possessed 100 % resistance to Orobanche and stable inheritance in the next generations. Our results showed that induced mutagenesis in sunflower can be successfully used to develop new lines useful for heterosis breeding

  4. (Helianthus annuus L.) extracts on wheat (Triticum aestivum L.)

    African Journals Online (AJOL)

    STORAGESEVER

    2008-11-19

    Nov 19, 2008 ... Seeds of two wheat varieties, namely Margalla 99 and. Chakwall 97, were sown in pots (3 seeds in each pot) and a basal dose consisting of 1 g urea and 1 g diammonium phosphate was ..... Allelopathic effects of sunflower extracts on mustard seed germination and seedling growth. Biol. Plant. (In Press).

  5. Growth rhythms in sunflower ( Helianthus annuus L.) in response to ...

    African Journals Online (AJOL)

    Sunflower hybrids maintain high level of stability in a variety of environments. Environmental variations affect and modify plant attributes like growth, development and assimilation through physio-morphic functions, thus modifying plant phenology. Field experiments, one each in spring and autumn, were conducted at Pir ...

  6. Common sunflower (Helianthus annuus) interference in soybean (Glycine max)

    International Nuclear Information System (INIS)

    Geier, P.W.; Maddux, L.D.; Moshier, L.J.; Stahlman, P.W.

    1996-01-01

    Multiple weed species in the field combine to cause yield losses and can be described using one of several empirical models. Field studies were conducted to compare observed corn yield loss caused by common sunflower and shattercane populations with predicted yield losses modeled using a multiple species rectangular hyperbola model, an additive model, or the yield loss model in the decision support system, WeedSOFT, and to derive competitive indices for common sunflower and shattercane. Common sunflower and shattercane emerged with corn and selected densities established in field experiments at Scandia and Rossville, KS, between 2000 and 2002. The multiple species rectangular hyperbola model fit pooled data from three of five location–years with a predicted maximum corn yield loss of 60%. Initial slope parameter estimate for common sunflower was 49.2 and 4.2% for shattercane. A ratio of these estimates indicated that common sunflower was 11 times more competitive than shattercane. When common sunflower was assigned a competitive index (CI) value of 10, shattercane CI was 0.9. Predicted yield losses modeled for separate common sunflower or shattercane populations were additive when compared with observed yield losses caused by low-density mixed populations of common sunflower (0 to 0.5 plants m −2 ) and shattercane (0 to 4 plants m −2 ). However, a ratio of estimates of these models indicated that common sunflower was only four times as competitive as shattercane, with a CI of 2.5 for shattercane. The yield loss model in WeedSOFT underpredicted the same corn losses by 7.5%. Clearly, both the CI for shattercane and the yield loss model in WeedSOFT need to be reevaluated, and the multiple species rectangular hyperbola model is proposed. (author)

  7. Response of sunflower (Helianthus annuus L.) to nitrogen and ...

    African Journals Online (AJOL)

    Nitrogen applied at 30, 60 and 90 kg N ha-1 significantly increased grain yield by 30, 40 and 50 %, compared with the control. Nitrogen x Phosphorus interaction significantly (P < 0.05) affected head weight, achene number per head and grain yield with N60P30 recording the highest grain yield (1580.68 kg ha-1), achene ...

  8. FORTIFICATION OF SUNFLOWER PLANTS (HELIANTHUS ANNUUS FORTIFICATION OF SUNFL

    Directory of Open Access Journals (Sweden)

    Petr Škarpa

    2013-02-01

    Full Text Available Selenium is a trace element which in small amounts is necessary for human and animal nutrition. In the organism it helps a number of antioxidant enzymes to function normally. In many parts of the world, including the Central European region, its content in agricultural products is very low. Attempts are therefore made to increase its content and cover human requirements with biologically valuable products by incorporating selenium into the system of plant nutrition. In a vegetation trial established in 2010 and 2011 we explored the effect of foliar applications of Se (IV on achenes yields and on content of selenium in the seeds and the uptake of selenium by the sunflower stand. Solutions of sodium selenite at 0.16 and 0.5 g Se.he-1 were applied at rates 50 and 150 g Se.ha-1 at the beginning of elongation growth (stage R-1. Sunflower achenes yields were significantly influenced by the weather in the experimental years. In 2011 sunflower production was by 29.4% lower than in 2010. Se fortification in dose 50 g Se.ha-1 increased sunflower achenes yield by 3.1%. The higher dose of selenium (150 g Se.ha-1 reduced yields by 6.8% compared with the no-fertilized treatment. Due to the effect of foliar Se nutrition the content of selenium in sunflower achenes increased highly significantly from 123 µg.kg-1 to 6,004 µg.kg-1 of achenes. The weight of 1000 achenes, oil content and content of palmitic, palmitoleic, oleic, linoleic acids were not significantly affected by selenium application. Fortification of Se increased stearic acid content from 3.16% to 3.47%.

  9. Effects of sunflower ( Helianthus annuus L .) extracts on wheat ...

    African Journals Online (AJOL)

    Commonly observed effects of allelochemicals were (a) decreased production of indole-3-acetic acid and gibberellic acid and lower values of electrical conductivity, moisture content, weed density, and fresh and dry weight of weeds, and (b) increased production of abscisic acid and higher values of pH, Mn, Fe, Mg, Ca, K, ...

  10. Sorting through the chaff, nDNA gene trees for phylogenetic inference and hybrid identification of annual sunflowers (Helianthus sect. Helianthus).

    Science.gov (United States)

    Moody, Michael L; Rieseberg, Loren H

    2012-07-01

    The annual sunflowers (Helianthus sect. Helianthus) present a formidable challenge for phylogenetic inference because of ancient hybrid speciation, recent introgression, and suspected issues with deep coalescence. Here we analyze sequence data from 11 nuclear DNA (nDNA) genes for multiple genotypes of species within the section to (1) reconstruct the phylogeny of this group, (2) explore the utility of nDNA gene trees for detecting hybrid speciation and introgression; and (3) test an empirical method of hybrid identification based on the phylogenetic congruence of nDNA gene trees from tightly linked genes. We uncovered considerable topological heterogeneity among gene trees with or without three previously identified hybrid species included in the analyses, as well as a general lack of reciprocal monophyly of species. Nonetheless, partitioned Bayesian analyses provided strong support for the reciprocal monophyly of all species except H. annuus (0.89 PP), the most widespread and abundant annual sunflower. Previous hypotheses of relationships among taxa were generally strongly supported (1.0 PP), except among taxa typically associated with H. annuus, apparently due to the paraphyly of the latter in all gene trees. While the individual nDNA gene trees provided a useful means for detecting recent hybridization, identification of ancient hybridization was problematic for all ancient hybrid species, even when linkage was considered. We discuss biological factors that affect the efficacy of phylogenetic methods for hybrid identification.

  11. Contenido de plomo y cadmio en aceites de girasol

    Directory of Open Access Journals (Sweden)

    López Martínez, M. C.

    2001-08-01

    Full Text Available We have studied the lead and cadmium content in 21 samples of sunflower oil from Andalucía (Southern Spain. These elements are toxicological importance and the sunflower oil is widely consumed in Spain. Samples were mineralized with nitric acid and vanadium pentoxide as catalyst, and ana lyzed using electrothermal atomization atomic absorption spectroscopy. The temperature-time programme for the graphite furnace was optimized for each element, and the accuracy, precision, sensitivity and detection limit of the method were evaluated. Concentrations of lead ranged from not detectable to 167.58 μg/kg and cadmium concentrations ranged from 0.87 to 8.30 μg/kg. The data obtained are not excessive and similar to those mentioned by other authors; however, one sample of the total analyzed surpassed the limit of 0.1 ppm of lead proposed by the Spanish and European Legislation. A statistical significative correlation has been established between Pb and Cd levels (p Se ha determinado el contenido de plomo y cadmio en 21 muestras de aceite de girasol, todas ellas producidas en Andalucía (Sur de España. Ambos elementos tienen una gran importancia toxicológica y el aceite de girasol es muy consumido en España. Las muestras han sido mineralizadas con ácido nítrico, utilizando pentóxido de vanadio como catalizador, y analizadas mediante espectroscopia de absorción atómica con atomización electrotérmica. Se ha optimizado el programa temperatura-tiempo del horno de grafito para cada elemento y se ha evaluado la exactitud, precisión, sensibilidad y límite de detección del método. Las concentraciones de plomo han oscilado entre no detectables y 167.58 μg/kg y las concentraciones de cadmio entre 0.87 y 8.30 μg/kg. Estos datos no resultan excesivos y concuerdan con los aportados por otros autores; no obstante, una de las muestras analizadas supera el límite máximo de 0.1 ppm de Pb establecido en las Legislaciones Española y Europea. Se

  12. Comportamiento recolector de la abeja Apis mellifera en cultivos comerciales: estudios descriptivos y evaluación de herramientas que mejoran su eficacia como polinizador

    OpenAIRE

    Susic Martín, Cinthia S.

    2015-01-01

    En esta Tesis se estudiaron aspectos del comportamiento recolector de la abeja Apis mellifera vinculados con el rendimiento de diferentes cultivos agrícolas. Estos estudios abarcaron la descripción de la conducta de la abeja en campos de girasol Helianthus annuus (L.) cultivados para producir semilla híbrida (girasol-semilla) y la evaluación de los efectos de formulaciones sintéticas aplicadas en colmenas que se utilizaron para la polinización de cultivos de girasol-semilla, de manzana Malus ...

  13. Diterpene acids from Helianthus species and their microbiological conversion by Gibberella fujikuroi, mutant B1-41a

    OpenAIRE

    松尾,昭彦; Bearder,John R.; Macmillan,Jake; Beale,Michael H.; Phinney,Bernard O.

    1983-01-01

    The diterpene acid content in 10 species of Helianthus has been investigated. Ent-12,16-cyclokauranoic acid, isolated from H. annuus, is converted into a series of 12,16-cyclogibberellins by cultures of Gibberella fujikuroi, mutant B1-41a, and 12,16-cyclogibberellins A9, and A12 have been isolated. Ent-12β-acetoxykaurenoic acid and ent-13(S)-angeloxyatisenoic acid have been isolated from H. decapetalus; the metabolism of ent-13(S)-hydroxyatisenoic acid and atisenoic acid by B1-41a is also des...

  14. Aceite de semilla de girasol con alto contenido en δ-tocoferol

    OpenAIRE

    Velasco Varo, Leonardo; Fernández Martínez, José María

    2006-01-01

    Aceite de semilla de girasol con alto contenido en δ-tocoferol. La presente invención se refiere a un aceite de semillas de girasol modificadas genéticamente a través de dos ciclos de inducción artificial de mutaciones seguidos en cada caso por procesos de identificación de individuos mutantes que poseen el carácter deseado. Dicho aceite se caracteriza por poseer entre el 26% y el 80% de los tocoferoles en forma de delta-tocoferol. Esta elevada producción de delta-tocoferol está determinada p...

  15. MEDICAL IMPORTANCE OF HELIANTHUS TUBEROSUS- A REVIEW

    OpenAIRE

    Ali Esmail Al-Snafi

    2018-01-01

    Phytochemical analysis of Helianthus tuberosus showed that it contained coumarins, unsaturated fatty acids, polyacetylenic derivatives, phenols, flavonoids, sesquiterpenes, protein, amino acid, reducing sugars, organic acids, lactones and cardiac glycoside. The pharmacological investigations revealed that Helianthus tuberosus exerted antioxidant, anticancer, antidiabetic, antifungal and α-Glucosidase inhibitory activity, as well as it produced inulin which used as functional food and possesse...

  16. La fertilización nitrogenada en el rendimiento del girasol en México

    OpenAIRE

    Luis Enrique Escalante-Estrada; Yolanda Isabel Escalante-Estrada; Carmen Linzaga-Elizalde

    2007-01-01

    Con el fin de evaluar el efecto de la fertilización nitrogenada aplicada al suelo sobre el rendimiento del girasol, se realizó la presente investigación en el campo del CEP-CSAEGRO. Se utilizó la línea 58 de girasol. Los niveles de N evaluados fueron: 0, 40, 80 y 120 kg ha-1, aplicados a los 9 días después de la siembra, con sulfato de amonio (20,5% N). El análisis de varianza indicó que el N aplicado aumentó el rendimiento en semilla, el diámetro del capítulo, el peso del capítulo sin semill...

  17. Ontogenetic changes in radiation use efficiency of sunflower (Helianthus annuus L.) crops

    International Nuclear Information System (INIS)

    Trapani, N.; Hall, A.J.; Sadras, V.O.; Vilella, F.

    1992-01-01

    Radiation use efficiency (ϵ) values for sunflower were derived using data from periodic determinations of crop aerial or total (aerial + root) biomass and radiation interception in two experiments conducted at Junin and Buenos Aires, Argentina. Analysis showed that three distinct phases, each characterized by a different value of ϵ, could be distinquished. The phases were establishment (0–47 days after emergence (dae)), rapid growth (47 dae-anthesis) and postanthesis (anthesis-physiologcial maturity). The crops had reached the bud-visible stage and intercepted at least 85% of incident radiation by 47 dae. Efficiency values based on aerial biomass were highest during the rapid growth (ϵrg = 2.4 ± 0.22 g/MJ PAR) phase and lower during the establishment (ϵ e = 1.01 ± 0.25 g/MJ PAR) and postanthesis (ϵ pa = 1.3 ± 0.15 g/MJ PAR) phases. The differences between ϵ pa and ϵ rg are attributed to the increased respiration load, high synthesis costs of the oil-rich grains and leaf senescence during grain filling. The value of ϵe was less than of ϵ rg even when efficiencies were calculated on the basis of total crop biomass (i.e. including root biomass). Hence, ontogenetic changes in partitioning of biomass between the root and aerial organs do not seem to be the cause of the changes in the value of ϵ. No variations in photosynthetic capacity with leaf position could be found, and it is concluded that the most likely reason for the lower values of ϵ e lies in saturation of canopy photosynthesis at less than full sunlight while crop cover is incomplete. (author)

  18. Effects of ultraviolet radiation on Hibiscus rosa-sinensis, Beta vulgaris and Helianthus annuus

    International Nuclear Information System (INIS)

    Panagopoulos, I.

    1992-01-01

    It is believed that increased levels of ultraviolet B-radiation (UV-B;280-320 nm) will result in serious threat to plant. In the present study the effects of UV (particularly UV-B) were studied on chlorophyll fluorescence, ultraweak luminescence (UL) and plant growth. Parameters related to light emission were determined, and the effects of UV-B on hypocotyl elongation and levels of free IAA were examined. The plants were grown in greenhouse or in growth chambers and exposed to short or long term UV-B simulating different levels of ozone depletion. Short exposure of Hibiscus leaves to UV resulted in a gradual increase in both UL and peroxidase activity followed by a decline after 72 h and a decrease in variable chlorophyll fluorescence. The action of UV-B on sugar beet plants depended on light quality and irradiance and infection by Cercospora beticola Sacc. The interaction between UV-B and the disease resulted in a large reduction of dry weight and enhanced UL. The lowest Chl a and growth was found in plants grown under low irradiance and exposed to UV-B supplemented with UV-A (320-400 nm). UVB also inhibited photosystem II, increased UL and peroxidase activity. Under relatively high PAR, UV-B increased dry weight of laminae and UL but no effect on Chl content. Sugar beet plants grown with light depleted in the 320-400 nm region of the spectrum and exposed to UV-B died. Low levels of UV-B did neither affected hypocotyl elongation nor amounts of free IAA in sunflower plants grown under low (LL; 143 μmol m -2 s -1 ) or high PAR (HL; 800 μmol m -2 s -1 ). Three times more daily UV-B increased the amount of free IAA, but inhibited hypocotyl elongation. Higher F v /F max and F690/F735, Chl a and carotenoids were found in plants exposed to low UV-B. Indeed, UV-B can be harmful but may also have enhancing effects on plants. (au) (114 refs.)

  19. Genetic variability and heritability for resistance to black stem (Phoma macdonaldii) in sunflower (Helianthus annuus L.)

    International Nuclear Information System (INIS)

    Abou Al Fadil, T.; Dechamp-Guillaume, G.; Poormohammad Kiani, S.; Sarrafi, A.

    2004-01-01

    Black stem, caused by Phoma macdonaldii, is one of the most important diseases of sunflower in many Countries. In order to study the genetic control of the disease, seeds of the inbred line AS-613 were exposed to 75 Grays of gamma rays and M1 and M2 plants were self-pollinated to obtain the M3 generation. Among M3 mutants, M3-8, a relatively resistant line to black stem, was crossed with AS-613. Seeds from this cross were grown and F1 plants were self-pollinated to produce F2 seeds from which the F3 generation was produced. Eighty-eight F3 families and two parents were used to determine the genetic variability of partial resistance to black stem in sunflower. Twelve-day-old seedlings were inoculated at the junction of the cotyledon petiole and hypocotyl with 20 micronl of pycniospore suspension. Seven days after inoculation, both cotyledon petioles of the seedling were scored according to the percentage of petiole area exhibiting symptoms (necrosis). Significant difference in resistance between the two parents, M3-8 and AS-613, indicates that mutagenesis can be considered as important tool to produce genetic variation for resistance to Phoma in sunflower. Results showed that F3 families included extreme genotypes with a relatively high resistance rate compared with the parents. Ten percent of F3 families showed a resistance rate higher than the one of the best parent, indicating transgressive segregation for resistance to black stem among families. The percentage of heritability was 69.6, which indicates that progeny selection for resistance to the disease is possible [it

  20. Genetic control of some morphological mutants in sunflower [Helianthus annuus L.

    International Nuclear Information System (INIS)

    Nabipour, A.; Sarrafi, A.; Yazdi-Samadi, B.

    2004-01-01

    Inheritance study of induced mutants is an important tool in genetic and breeding programs. Sunflower is one of the most important oil crops for which mutant collection is meager. Seeds of sunflower line AS-613 were irradiated with gamma rays and mutant phenotypes were traced until M4 generation. In M5 generation, the following traits were studied: dwarfing, branching, leaf shape, albinism, rosette, lack of apex and alternative leaves. In most cases, the mutated characters were controlled by a single recessive gene, while in two cases they were controlled by two recessive genes. In M5 progenies, segregation for two albino, one alternative leaves, one dwarfism, 5 branching, one rosette, 2 lacks of apex and 5 leaf shape mutants was recorded. Amongst five cases of branching, one was controlled by two recessive genes, where at least one homozygote recessive locus was necessary for branching. In one case, the lack of apex was controlled by two recessive genes and even only one dominant allele could provoke the normal plant [it

  1. Effect of salinity and sodicity stresses on physiological response and productivity in Helianthus annuus.

    Science.gov (United States)

    Farghaly, Fatma Aly; Radi, Abeer Ahmed; Abdel-Wahab, Dalia Ahmed; Hamada, Afaf Mohamed

    2016-06-01

    Soil salinity and sodicity (alkalinity) are serious land degradation issues worldwide that are predicted to increase in the future. The objective of the present study is to distinguish the effects of NaCl and Na(2)CO(3) salinity in two concentrations on the growth, lipoxygenase (LOX) activity, membrane integrity, total lipids, yield parameters and fatty acids (FAs) composition of seeds of sunflower cultivar Sakha 53. Plant growth, LOX activity and malondialdehyde (MDA) content were reduced by salts stresses. On the contrary, salinity and alkalinity stress induced stimulatory effects on membrane permeability, leakage of UV-metabolites from leaves and total lipids of sunflower shoots and roots. Crop yield (plant height, head diameter, seed index and number of seeds for each head) that is known as a hallmark of plant stress was decreased by increasing concentrations of NaCl and Na(2)CO(3) in the growth media. Fatty acid methyl esters (FAME) composition of salt-stressed sunflower seeds varied with different levels of NaCl and Na(2)CO(3).

  2. Resistance to broomrape (Orobanche spp.) in sunflower (Helianthus annuus L.) is temperature dependent.

    Science.gov (United States)

    Eizenberg, H; Plakhine, D; Hershenhorn, J; Kleifeld, Y; Rubin, B

    2003-04-01

    The effects of various temperature regimes in the range 29-17/21-9 degrees C day/night on each stage of the parasitism process of Orobanche cumana and O. aegyptiaca on sunflower were studied under controlled conditions in polyethylene bags. The response of the resistant sunflower variety 'Ambar' was expressed as the degeneration of the parasite tissues after its establishment in the plant roots, and this stage was found to be temperature dependent. The degeneration rate of Orobanche tubercles in the resistant sunflower variety was also found to be temperature dependent and was about five times as great as that in the sensitive variety in the highest temperature regime tested of 29/21 degrees C day/night. The ability to reject the parasite by causing its degeneration and death is the main factor that determines the resistance. As the temperature rises, more tubercles degenerate and die, that is the sunflower plant expresses higher levels of resistance.

  3. The effects of gamma rays and genotypes on sunflower organogenesis traits [Helianthus annuus L.

    International Nuclear Information System (INIS)

    Rachid Al-Chaarani, G.; Gentzbittel, L.; Berrault, G.; Lenoble, S.; Sarrafi, A.

    2004-01-01

    Seeds of two inbred lines (AS613 and AS616) and their hybrid were irradiated with seven gamma rays doses (5, 15, 25, 35, 45, 55 and 65 Grays). Organogenesis traits were studied for all irradiated seeds as well as non irradiated ones used as control. The experiment was designed as a randomized complete block with three replications. Each replication consisted of 16 Petri dishes with four explants per gamma rays dose and per genotype. The regeneration ability of genotypes and the effects of gamma rays on regeneration were scored by assessing the percentage of explants forming shoots (ES/100E), the average number of shoots per explant shooting (S/ES) and the average number of shoots per explant plated (S/E). Genetic variability was observed among the three genotypes for all studied traits. The effect of irradiation and the interaction between genotype and irradiation were also significant for all the studied traits. Heterosis, when the hybrid was compared with the mean of the two parents, was significant for the different gamma rays doses in all traits except for 15 and 55 Grays, which were not significant for the percentage of explants forming shoots (ES/100E). Seed irradiation by 5 and 15 Grays is likely to have a significant effect by increasing the regeneration ability by cotyledon culture in sunflower [it

  4. HISTORY OF in vitro CULTURE STUDIES ON Helianthus annuus L. IN TURKEY

    Directory of Open Access Journals (Sweden)

    Sergun DAYAN

    2016-12-01

    Full Text Available Tissue culture techniques offer important approaches about sunflower breeding and germplasm conservation. The available data on the subject in Turkey was reviewed in order to encourage the researchers to study on tissue culture of sunflower. In vitro studies on sunflower in Turkey started in the first half of the 90s. A large number of in vitro culture studies on sunflower using anthers, hypocotyls, cotyledons, petioles of cotyledon, shoot-tips, mature embryos, immature embryos, leaves, petioles, immature cotyledons and microspores as different explants have been published. Microspore culture, anther culture, embryo culture, slow growth storage, micropropagation and gene transfer with Agrobacterium were also used in these culture studies. Although these studies formed an important scientific knowledge about sunflower tissue culture in the country, it is still not sufficient. Therefore, there is an urgent need to make more in vitro studies on sunflower which is an important agricultural plant for Turkey. The transfer of the results of these studies to agricultural applications is also essential from a sectoral standpoint.

  5. Effects of ultraviolet radiation on Hibiscus rosa-sinensis, Beta vulgaris and Helianthus annuus

    Energy Technology Data Exchange (ETDEWEB)

    Panagopoulos, I.

    1992-01-01

    It is believed that increased levels of ultraviolet B-radiation (UV-B;280-320 nm) will result in serious threat to plant. In the present study the effects of UV (particularly UV-B) were studied on chlorophyll fluorescence, ultraweak luminescence (UL) and plant growth. Parameters related to light emission were determined, and the effects of UV-B on hypocotyl elongation and levels of free IAA were examined. The plants were grown in greenhouse or in growth chambers and exposed to short or long term UV-B simulating different levels of ozone depletion. Short exposure of Hibiscus leaves to UV resulted in a gradual increase in both UL and peroxidase activity followed by a decline after 72 h and a decrease in variable chlorophyll fluorescence. The action of UV-B on sugar beet plants depended on light quality and irradiance and infection by Cercospora beticola Sacc. The interaction between UV-B and the disease resulted in a large reduction of dry weight and enhanced UL. The lowest Chl a and growth was found in plants grown under low irradiance and exposed to UV-B supplemented with UV-A (320-400 nm). UVB also inhibited photosystem II, increased UL and peroxidase activity. Under relatively high PAR, UV-B increased dry weight of laminae and UL but no effect on Chl content. Sugar beet plants grown with light depleted in the 320-400 nm region of the spectrum and exposed to UV-B died. Low levels of UV-B did neither affected hypocotyl elongation nor amounts of free IAA in sunflower plants grown under low (LL; 143 [mu]mol m[sup -2]s[sup -1]) or high PAR (HL; 800 [mu]mol m[sup -2]s[sup -1]). Three times more daily UV-B increased the amount of free IAA, but inhibited hypocotyl elongation. Higher F[sub v]/F[sub max] and F690/F735, Chl a and carotenoids were found in plants exposed to low UV-B. Indeed, UV-B can be harmful but may also have enhancing effects on plants. (au) (114 refs.).

  6. Effects of ultraviolet radiation on Hibiscus rosa-sinensis, Beta vulgaris and Helianthus annuus

    Energy Technology Data Exchange (ETDEWEB)

    Panagopoulos, I.

    1992-12-31

    It is believed that increased levels of ultraviolet B-radiation (UV-B;280-320 nm) will result in serious threat to plant. In the present study the effects of UV (particularly UV-B) were studied on chlorophyll fluorescence, ultraweak luminescence (UL) and plant growth. Parameters related to light emission were determined, and the effects of UV-B on hypocotyl elongation and levels of free IAA were examined. The plants were grown in greenhouse or in growth chambers and exposed to short or long term UV-B simulating different levels of ozone depletion. Short exposure of Hibiscus leaves to UV resulted in a gradual increase in both UL and peroxidase activity followed by a decline after 72 h and a decrease in variable chlorophyll fluorescence. The action of UV-B on sugar beet plants depended on light quality and irradiance and infection by Cercospora beticola Sacc. The interaction between UV-B and the disease resulted in a large reduction of dry weight and enhanced UL. The lowest Chl a and growth was found in plants grown under low irradiance and exposed to UV-B supplemented with UV-A (320-400 nm). UVB also inhibited photosystem II, increased UL and peroxidase activity. Under relatively high PAR, UV-B increased dry weight of laminae and UL but no effect on Chl content. Sugar beet plants grown with light depleted in the 320-400 nm region of the spectrum and exposed to UV-B died. Low levels of UV-B did neither affected hypocotyl elongation nor amounts of free IAA in sunflower plants grown under low (LL; 143 {mu}mol m{sup -2}s{sup -1}) or high PAR (HL; 800 {mu}mol m{sup -2}s{sup -1}). Three times more daily UV-B increased the amount of free IAA, but inhibited hypocotyl elongation. Higher F{sub v}/F{sub max} and F690/F735, Chl a and carotenoids were found in plants exposed to low UV-B. Indeed, UV-B can be harmful but may also have enhancing effects on plants. (au) (114 refs.).

  7. Effects of exogenous application of nano particles and compatible organic solutes on sunflower (Helianthus annuus L.

    Directory of Open Access Journals (Sweden)

    Janmohammadi Mohsen

    2017-04-01

    Full Text Available Mediterranean semi-arid regions in northwestern Iran receive precipitation below potential evapotranspiration and are characterised by excessive heat and terminal drought stress. Exogenous application of some nanoparticles and growth regulators appears to alleviate the adverse effects of abiotic stress and improve plant performance. In the present paper, an attempt is made to evaluate the effects of foliar application of salicylic acid (SA, glycine betaine (GB, ascorbic acid (AA, nano-silica (nSiO2 and nano titanium dioxide (nTiO2 suspensions on growth and yield components of sunflower (cv. Azargol in the semi-arid highland region of Maragheh, Iran. Plants were grown under rain-fed conditions with supplemental irrigation applied three times during the reproductive growth stages of growth. The results revealed that foliar application of SA considerably improved head diameter, chlorophyll content of plant leaves, and days to flowering, while it delayed physiological maturity for a fairly long time. Evaluation of the achene yield component indicated that application of GB significantly increased the weight of achenes when compared with other treatments. The percentage of empty achenes was considerably affected by treatments, the lowest percentage of hollow achenes being recorded for plants sprayed with GB, followed by ones sprayed with AA and nTiO2. The percentage of oil in sunflower achenes was substantially increased by foliar application of nano particles, the highest oil percentage being recorded in plants treated with nTiO2. The results also showed that the highest number of achenes per head, greatest kernel weight, and largest achene size were obtained by spraying with nanoparticle suspensions. Although all treatments improved the achene yield, the effect of nTiO2 was most prominent. The results of the present experiment support the conclusion that foliar application of nanoparticles may alleviate adverse environmental factors and improve the performance of plants in semi-arid regions.

  8. Florets of sunflower (Helianthus annuus L.): potential new sources of dietary fiber and phenolic acids.

    Science.gov (United States)

    Liang, Qiang; Cui, Jun; Li, Hang; Liu, Jia; Zhao, Guohua

    2013-04-10

    Ray florets (Rf) and disc florets (Df) are agricultural byproducts of sunflower seeds. Their nutrition-related compounds were determined. The dietary fiber contents in Rf and Df were 42.90 mg/100 g and 58.97 mg/100 g. In both florets, palmitic, linoleic, and linolenic acids were identified as the three most abundant fatty acids, and the saturated ones constitute approximately two-thirds (w/w) of the total fatty acids. Lysine was the limiting amino acid in both florets by World Health Organization standards. Sixteen phenolic compounds, nine free and eight bound, mainly depsides, were identified in florets by RP-HPLC-DAD/ESI-TOF-MS. The free and bound phenolic compounds in Df were higher than in Rf. 1,5-di-O-caffeoylquinic acid was the predominant free phenolic compound in both florets. The present study revealed that the florets of sunflower are rich sources of dietary fiber, Fe, and phenols.

  9. Kinetics modeling of the drying of sunflower stem (Helianthus annuus L.) in a forced convection tunnel

    Science.gov (United States)

    López, R.; Vaca, M.; Terres, H.; Lizardi, A.; Morales, J.; Flores, J.; Chávez, S.

    2015-01-01

    The sunflower is an annual plant native to the Americas. It possesses a large inflorescence (flowering head), and its name is derived from the flower's shape and image, which is often used to capture the sun. The plant has a rough, broad, hairy stem, coarsely toothed, with rough leaves, and circular flower heads. The sunflower seeds are appreciated for their oil, which has become a widespread cooking ingredient. Leaves of the sunflower can be used as cattle feed, while the stems contain a fiber that may be used in paper production. Recently this flower has been used in phytoremediation of soils, contaminated with heavy metals. Sunflower has been probed as an efficient phytoextractor of chromium, lead, aluminum, zinc, cadmium from soil. In this work we present the experimental results of the drying of the sunflower stem, cut in 100 mm longitudinal sections, with diameters in the range of 11-18 mm. The aim was to obtain a dry and easy-to-handle final product, since these plants were originally cultivated in order to extract heavy metals from a polluted soil. The dried stems could then be easily confined or sent to recycle premises to concentrate the metals. The drying process was done in forced convection within a hot air tunnel. The used temperature was 60 °C, the velocity of air was 3 m/s and the required times were 8 hours. The initial average wet mass was 28 g and the final value was 5 g, resulting in the aimed product.

  10. Class FH sunflower seeds (Helianthus annuus) as an energy/protein ...

    African Journals Online (AJOL)

    The digestible energy (DE) content of milled and whole class FH sunflower seed (SS) was determined in a digestion trial and found to be respectively 18,7 and 9,9 MJ/kg on an air dry basis. Two diets for early weaned piglets formulated to be equal in protein, lysine and DE and respectively containing 18,0% roasted full-fat.

  11. Mapping the quantitative trait loci (QTL) controlling seed morphology in sunflower (Helianthus annuus L.)

    Science.gov (United States)

    This paper reports the results of analyzing the quantitative trait loci (QTL) underlying sunflower seed morphological traits in a segregating population derived from an oilseed by confection cross. A linkage map containing 165 target region amplification polymorphism (TRAP) and 44 simple sequence re...

  12. Induction of leaf senescence by low nitrogen nutrition in sunflower (Helianthus annuus) plants.

    Science.gov (United States)

    Agüera, Eloísa; Cabello, Purificación; de la Haba, Purificación

    2010-03-01

    Different parameters which vary during the leaf development in sunflower plants grown with nitrate (2 or 20 mM) for a 42-day period have been determined. The plants grown with 20 mM nitrate (N+) showed greater leaf area and specific leaf mass than the plants grown with 2 mM nitrate (N-). The total chlorophyll content decreased with leaf senescence, like the photosynthetic rate. This decline of photosynthetic activity was greater in plants grown with low nitrogen level (N-), showing more pronounced senescence symptoms than with high nitrogen (N+). In both treatments, soluble sugars increased with aging, while starch content decreased. A significant increase of hexose to sucrose ratio was observed at the beginning of senescence, and this raise was higher in N- plants than in N+ plants. These results show that sugar senescence regulation is dependent on nitrogen, supporting the hypothesis that leaf senescence is regulated by the C/N balance. In N+ and N- plants, ammonium and free amino acid concentrations were high in young leaves and decreased progressively in the senescent leaves. In both treatments, asparagine, and in a lower extent glutamine, increased after senescence start. The drop in the (Glu+Asp)/(Gln+Asn) ratio associated with the leaf development level suggests a greater nitrogen mobilization. Besides, the decline in this ratio occurred earlier and more rapidly in N- plants than in N+ plants, suggesting that the N- remobilization rate correlates with leaf senescence severity. In both N+ and N- plants, an important oxidative stress was generated in vivo during sunflower leaf senescence, as revealed by lipid peroxidation and hydrogen peroxide accumulation. In senescent leaves, the increase in hydrogen peroxide levels occurred in parallel with a decline in the activity of antioxidant enzymes. In N+ plants, the activities of catalase and ascorbate peroxidase (APX) increased to reach their highest values at 28 days, and later decreased during senescence, whereas in N- plants these activities started to decrease earlier, APX after 16 days and catalase after 22 days, suggesting that senescence is accelerated in N-leaves. It is probable that systemic signals, such as a deficit in amino acids or other metabolites associated with the nitrogen metabolism produced in plants grown with low nitrogen, lead to an early senescence and a higher oxidation state of the cells of these plant leaves.

  13. Molecular and physiological responses of sunflower (helianthus annuus l.) to pgpr and sa under salt stress

    International Nuclear Information System (INIS)

    Naz, R.

    2015-01-01

    This paper presents the efficacy of PGPR (Azospirillum and Pseudomonas) and its modulation by salicylic acid. Two hybrids of sunflower (Hysun and Parsun) were inoculated with Azospirillum spp. and Pseudomonas spp. prior to sowing. Salt stress (20 dSm-1) was applied 28 d after sowing followed by foliar spray of salicylic acid (100 micro M) after 4 h of salt treatment. Azospirillum and Pseudomonas inoculation alone and in combination with salicylic acid alleviated the effects of salt stress on both the sunflower hybrids. The salt tolerance in these treatments was mediated by an increase in relative water content, carotenoids, proline, ABA, induction of new polypeptide bands and yield of sunflower hybrids. In response to salt stress four new polypeptide bands were synthesized in both Hysun, whereas, a group of six polypeptide bands were observed in Parsun. Application of salicylic acid alone and in combination with Azospirillum found to induce four new polypeptide bands in Hysun and Parsun. It is inferred that synthesis of new proteins in response to the combined application of salicylic acid and Azospirillum under salt stress, may play an important role as stress proteins in tolerance of sunflower hybrids to salt stress. (author)

  14. Use of tritium-labelled water in the study of transfers and exchanges in Helianthus annuus

    International Nuclear Information System (INIS)

    Puard, M.

    1982-01-01

    A labelling method with tritium-labelled water was developed and an experiment was carried out to study the kinetics of water transfer in the plant, to measure the extend of water vapour exchange between the leaves and atmosphere and the migration of this water towards the root systems [fr

  15. Allelopathic sorghum water extract helps to improve yield of sunflower (helianthus annuus l.)

    International Nuclear Information System (INIS)

    Shah, S.; Khan, E.A.

    2016-01-01

    Allelopathy provides eco-friendly environment in managing weeds by reducing the use of synthetic herbicides that cause environmental pollution and herbicide resistance problems. Therefore, weeds have been controlling by plant derived organic compounds as an alternative of inorganic herbicides since the last two decades. In this study, sorghum aqueous extracts were applied individually as well as accumulatively with reduced levels of Dual Gold at the rate (S-Metolachlor) as foliar sprays in sunflower at 50, 70 and 90 DAS. For comparison, standard level of S-Metolachlor was also applied as foliar sprays along with weedy check. The highest reduction of total weed density (93.7%) was recorded by three sprays of sorghum aqueous extracts at rate of 15 L/ha mixed with 1/3rd S-Metolachlor at 1.6 L/ha as foliar applications. This reduction rate was statistically similar to one that was obtained by standard level of S-Metolachlor (1.6 L/ha). The highest achene yield was achieved by applying three foliar sprays of aqueous sorghum extracts along with reduced doses of S-Metolachlor, which was almost similar to full recommended dose of S-Metolachlor. These findings demonstrate that allelopathy offers environment friendly and economical opportunity for weed control in sunflower reducing the dependence and cost of herbicides. (author)

  16. Potential of sunflower (helianthus annuus L.) for phytoremediation of nickle (Ni) and lead (Pb) contaminated water

    International Nuclear Information System (INIS)

    Mukhtar, S.M.; HAQ Bhatti, H.N.; Khalid, M.; Haq, M.A; Shahzad, S.M.

    2010-01-01

    Heavy metals are contaminants of much environmental apprehension, as they are hazardous to human being and other biota. Buildup of heavy metals in crop plants is of great concern due to the probability of food contamination through the soil-root interface. For this purpose, a hydroponic study was conducted to evaluate the efficacy of sunflower plant to phytoremediate Pb and Ni contaminated water in the absence and presence of synthetic chelator. Results showed that application of Ni and Pb reduced the dry weights of shoot and root (up to 55.1 and 38.3%; 50.5 and 33.6%), shoot and root length (up to 64.5 and 58.1%; 64.1 and 55.8%), chlorophyll content (up to 63.8 and 54.4%), and photosynthetic activity (up to 66.1 and 62.7%), respectively with EDTA as compared to control. While, maximum concentration of Ni and Pb in shoot and root (up to 18.43 and 20.73 mg kg/sup -1/; 12.82 and 18.67 mg kg/sup -1/), total accumulation (up to 55.82 and 72.28 mg kg/sup -1/), and proline content (up to 128.2 and 98.3%) were recorded in the presence of EDTA respectively as compared to control. Generally, it was observed that concentration and total accumulation of Pb was more than Ni in sunflower plant. The study concludes that the use of synthetic chelator increased the uptake and translocation of heavy metals in plant biomass that could enhance the phytoremediation of Ni and Pb from contaminated water. (author)

  17. PATH COEFFICIENT ANALYSIS OF SEVERAL COMPONENTS OIL YIELD IN SUNFLOWER (HELIANTHUS ANNUUS L.

    Directory of Open Access Journals (Sweden)

    A. MIjić

    2006-06-01

    Full Text Available The objective of investigation was to analyse oil yield components and their relations by simple coefficient correlations as well as direct and indirect effects to oil yield by path analysis. Twenty-four sunflower hybrids were included in the investigation and their seven traits (plant height, head diameter, 1000 seed weight, hec- tolitar mass, grain yield, oil content and oil yield. Very strong positive correlation was estimated between grain yield and oil yield, strong positive correlation between hectolitar mass and oil yield, and middle corre- lation among oil yield and: 1000 seed weight, plaint height and oil content. There was no correlation between grain yields and oil content. Grain yield showed the strongest effect to oil yield. Oil content had lower effect to oil yield. Other traits showed no significant effect to oil yield, and their effect to oil yield was covered by indirect effect of grain yield.

  18. Exogenous ascorbic acid improves defence responses of sunflower (Helianthus annuus) exposed to multiple stresses.

    Science.gov (United States)

    Kaya, Armagan

    2017-09-01

    Ascorbic acid is an important antioxidant that plays role both on growth and development and also stress response of the plant. The purpose of this study was to determine the effect of ascorbate on physiological and biochemical changes of sunflower that was exposed to multiple stresses. Chlorophyll and carotenoid contents decreased and glutathione, ascorbate and malondialdehyde contents as well as antioxidant enzyme activities increased for sunflower plant that was exposed to 50 mM NaCl and pendimethalin at different concentrations. These changes were found to be more significant in groups simultaneously exposed to both stress factors. While malondialdehyde content decreased, chlorophyll, carotenoid, ascorbate, glutathione contents and antioxidant enzyme activities increased in plants treated exogenously with ascorbate, compared to the untreated samples. According to the findings of our study; compared to individual stress, the effect of stress is more pronounced in sunflower exposed to multiple stresses, and treatment with exogenous ascorbate reduces the negative effects of stress.

  19. Chemical composition of open pollinated and hybrid population of sunflower (helianthus annuus l.)

    International Nuclear Information System (INIS)

    Nisar, M.; Hussain, S.; Nausheen, A.; Siddique, F.

    2011-01-01

    Sunflower is the world fourth most important sources of edible oil. A lot of work has been done for varietal improvement through conventional breeding in Pakistan. Sunflower is the cash crop and is easily adapted to many region of Pakistan, genetic and agronomical improvement was needed so that economically valuable crop could be harvested. In the present work, 16 cultivars (open pollinated population 'OPP' and hybrid population 'HP' eight each) of sunflower was evaluated. The study was aimed at evaluating the mineral composition, estimation of moisture contents, measuring electrical conductivity and 100 seeds weight. The mineral composition was fractionated though Atomic Absorption Spectrometer, which indicate that Zn +2 was 8.54 and 9.35%; Cu/sup +2/ 0.5 and 0.02%; Mn/sup +2/ 3.48 and 9.72%; Co/sup +2/ 18.67 and 16.81%; Mg/sup +2/ 68.27 and 83.53%; Fe/sup +3/ 4.32 and 4.35% were estimated in HP and OPP respectively. Similarly, moisture contents 6.26 and 6.78%, and 1000-seeds weight 510.8 and 598 g were calculated in the HP and OPP respectively. In comparative picture the mineral concentration, moisture contents and 100 seeds weight in open pollinated population were high as compared to hybrid. A total of 11.7 % genetic diversity was observed in mineral composition of both the populations. The EC was high in HP ranging from 70. 85-137.8, while comparatively low in OPP ranged 46.81 - 120.18. (author)

  20. Breeding sunflower for drought tolerance: genetic variability for drought torrance in sunflower (Helianthus Annuus L.)

    International Nuclear Information System (INIS)

    Hussain, M.K.; Ilyas, M.; Rehman, O.U.

    1994-01-01

    Five inbred lines and their all possible crosses excluding reciprocals were evaluated for tolerance to drought and effect of drought adversely influenced the traits of leaf area, days to maturity, head diameter, 100-achene weight and achene yield per plant, whereas number of leaves per plant and plant height were comparatively less affected. Average performance of sunflower cross/hybrids was far more better than parental lines. Inbred lines GIMSUN-420x-431 and GIMSUN-498x-477 produced higher achene yield under drought conditions and showed less loses than other. Effect of drought on various growth stages showed that button (R1 stage) was the most critical as compared to 50% flowering (R5 stage) and seed formation (R6 stage) which reduced leaf area, head diameter, 100-achene weight and achene yield per plant by 40-59, 32-14 and 31-07 percent respectively. (author)

  1. Formation and Stability of Foams Made with Sunflower (Helianthus annuus) Proteins

    NARCIS (Netherlands)

    Gonzalez-Perez, S.; Vereijken, J.M.; Koningsveld, van G.A.; Gruppen, H.; Voragen, A.G.J.

    2005-01-01

    Foam properties of a sunflower isolate (SI), as well as those of helianthinin and sunflower albumins (SFAs), were studied at various pH values and ionic strengths and after heat treatment. Less foam could be formed from helianthinin than from SFAs, but foam prepared with helianthinin was more stable

  2. Physiological and gene expression responses of sunflower (Helianthus annuus L.) plants differ according to irrigation placement.

    Science.gov (United States)

    Aguado, Ana; Capote, Nieves; Romero, Fernando; Dodd, Ian C; Colmenero-Flores, José M

    2014-10-01

    To investigate effects of soil moisture heterogeneity on plant physiology and gene expression in roots and leaves, three treatments were implemented in sunflower plants growing with roots split between two compartments: a control (C) treatment supplying 100% of plant evapotranspiration, and two treatments receiving 50% of plant evapotranspiration, either evenly distributed to both compartments (deficit irrigation - DI) or unevenly distributed to ensure distinct wet and dry compartments (partial rootzone drying - PRD). Plants receiving the same amount of water responded differently under the two irrigation systems. After 3 days, evapotranspiration was similar in C and DI, but 20% less in PRD, concomitant with decreased leaf water potential (Ψleaf) and increased leaf xylem ABA concentration. Six water-stress responsive genes were highly induced in roots growing in the drying soil compartment of PRD plants, and their expression was best correlated with local soil water content. On the other hand, foliar gene expression differed significantly from that of the root and correlated better with xylem ABA concentration and Ψleaf. While the PRD irrigation strategy triggered stronger physiological and molecular responses, suggesting a more intense and systemic stress reaction due to local dehydration of the dry compartment of PRD plants, the DI strategy resulted in similar water savings without strongly inducing these responses. Correlating physiological and molecular responses in PRD/DI plants may provide insights into the severity and location of water deficits and may enable a better understanding of long-distance signalling mechanisms. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

  3. Growth under elevated atmospheric CO(2) concentration accelerates leaf senescence in sunflower (Helianthus annuus L.) plants.

    Science.gov (United States)

    de la Mata, Lourdes; Cabello, Purificación; de la Haba, Purificación; Agüera, Eloísa

    2012-09-15

    Some morphogenetic and metabolic processes were sensitive to a high atmospheric CO(2) concentration during sunflower primary leaf ontogeny. Young leaves of sunflower plants growing under elevated CO(2) concentration exhibited increased growth, as reflected by the high specific leaf mass referred to as dry weight in young leaves (16 days). The content of photosynthetic pigments decreased with leaf development, especially in plants grown under elevated CO(2) concentrations, suggesting that high CO(2) accelerates chlorophyll degradation, and also possibly leaf senescence. Elevated CO(2) concentration increased the oxidative stress in sunflower plants by increasing H(2)O(2) levels and decreasing activity of antioxidant enzymes such as catalase and ascorbate peroxidase. The loss of plant defenses probably increases the concentration of reactive oxygen species in the chloroplast, decreasing the photosynthetic pigment content as a result. Elevated CO(2) concentration was found to boost photosynthetic CO(2) fixation, especially in young leaves. High CO(2) also increased the starch and soluble sugar contents (glucose and fructose) and the C/N ratio during sunflower primary leaf development. At the beginning of senescence, we observed a strong increase in the hexoses to sucrose ratio that was especially marked at high CO(2) concentration. These results indicate that elevated CO(2) concentration could promote leaf senescence in sunflower plants by affecting the soluble sugar levels, the C/N ratio and the oxidative status during leaf ontogeny. It is likely that systemic signals produced in plants grown with elevated CO(2), lead to early senescence and a higher oxidation state of the cells of these plant leaves. Copyright © 2012 Elsevier GmbH. All rights reserved.

  4. Effect of some Evaporation Matters on Storability of Sunflower ( Helianthus annuus L.) Seed.

    Science.gov (United States)

    El-Saidy, Aml E A; El-Hai, K M Abd

    This study focuses on finding compounds that are safe to humans and environment, such as propionic and acetic acids that may provide an alternative control of seed-borne pathogens and decrease seed deterioration during storage. The objectives of this study were to reduce sunflower seed deterioration and improve the viability of sunflower seed using environmentally safe organic acids. Propionic and acetic acids were applied on sunflower seed at different concentrations under laboratory conditions during different storage periods. After 6 months storage period, the viability of sunflower seed as well as morphological and physiological characteristics of seedlings were evaluated under greenhouse conditions. Laboratory experiment was conducted in a factorial completely randomized design and randomized complete block design for greenhouse experiment. Propionic and acetic acids at different concentrations showed inhibitory effects on the presence of different fungal genera in all storage periods. Propionic acid was most effective followed by acetic acid. Increasing storage periods from 0-6 months significantly decreased germination percentage, germination energy, seedling characters, survived healthy seedlings and seed oil and protein percentages but dead and rotted seeds, as well as rotted seedlings were increased. Treating sunflower seeds with propionic acid (100%) improved germination criteria, seedling characters and seed chemical characters as well as survival seedlings and minimized the dead seeds, rotted seeds and rotted seedlings as compared with the control under all storage periods. Under greenhouse conditions, the maximum growth parameter and physiological characters (chlorophylls a, b, carotenoids and total phenols) were recorded from seed treated with 100% propionic acid after 6 months of storage. It may be concluded that propionic and acetic acids vapors can have considerable fungicidal activity against sunflower pathogens and improve seed viability. Therefore, it is recommended using 100% propionic acid to reduce deterioration and seed-borne pathogens of sunflower under storage conditions.

  5. Sunflower (Helianthus annuus) pollination in California's Central Valley is limited by native bee nest site location.

    Science.gov (United States)

    Sardiñas, Hillary S; Tom, Kathleen; Ponisio, Lauren Catherine; Rominger, Andrew; Kremen, Claire

    2016-03-01

    The delivery of ecosystem services by mobile organisms depends on the distribution of those organisms, which is, in turn, affected by resources at local and landscape scales. Pollinator-dependent crops rely on mobile animals like bees for crop production, and the spatial relationship between floral resources and nest location for these central-place foragers influences the delivery of pollination services. Current models that map pollination coverage in agricultural regions utilize landscape-level estimates of floral availability and nesting incidence inferred from expert opinion, rather than direct assessments. Foraging distance is often derived from proxies of bee body size, rather than direct measurements of foraging that account for behavioral responses to floral resource type and distribution. The lack of direct measurements of nesting incidence and foraging distances may lead to inaccurate mapping of pollination services. We examined the role of local-scale floral resource presence from hedgerow plantings on nest incidence of ground-nesting bees in field margins and within monoculture, conventionally managed sunflower fields in California's Central Valley. We tracked bee movement into fields using fluorescent powder. We then used these data to simulate the distribution of pollination services within a crop field. Contrary to expert opinion, we found that ground-nesting native bees nested both in fields and edges, though nesting rates declined with distance into field. Further, we detected no effect of field-margin floral enhancements on nesting. We found evidence of an exponential decay rate of bee movement into fields, indicating that foraging predominantly occurred in less than 1% of medium-sized bees' predicted typical foraging range. Although we found native bees nesting within agricultural fields, their restricted foraging movements likely centralize pollination near nest sites. Our data thus predict a heterogeneous distribution of pollination services within sunflower fields, with edges receiving higher coverage than field centers. To generate more accurate maps of services, we advocate directly measuring the autecology of ecosystem service providers, which vary by crop system, pollinator species, and region. Improving estimates of the factors affecting pollinator populations can increase the accuracy of pollination service maps and help clarify the influence of farming practices on wild bees occurring in agricultural landscapes.

  6. Evaluation of proteome alterations induced by cadmium stress in sunflower (Helianthus annuus L.) cultures.

    Science.gov (United States)

    Lopes Júnior, Cícero Alves; Barbosa, Herbert de Sousa; Moretto Galazzi, Rodrigo; Ferreira Koolen, Hector Henrique; Gozzo, Fábio Cesar; Arruda, Marco Aurélio Zezzi

    2015-09-01

    The present study evaluates, at a proteomic level, changes in protein abundance in sunflower leaves in the absence or presence (at 50 or 700mg) of cadmium (as CdCl2). At the end of the cultivation period (45 days), proteins are extracted from leaves with phenol, separated by two-dimensional difference gel electrophoresis (2-D DIGE), and excised from the gels. The differential protein abundances (for proteins differing by more than 1.8 fold, which corresponds to 90% variation) are characterized using nESI-LC-MS/MS. The protein content decreases by approximately 41% in plants treated with 700mg Cd compared with control plants. By comparing all groups of plants evaluated in this study (Control vs. Cd-lower, Control vs. Cd-higher and Cd-lower vs. Cd-higher), 39 proteins are found differential and 18 accurately identified; the control vs. Cd-higher treatment is that presenting the most differential proteins. From identified proteins, those involved in energy and disease/defense (including stress), are the ribulose bisphosphate carboxylase large chain, transketolase, and heat shock proteins are the most differential abundant proteins. Thus, at the present study, photosynthesis is the main process affected by Cd in sunflowers, although these plants are highly tolerant to Cd. Copyright © 2015 Elsevier Inc. All rights reserved.

  7. Genetic Architecture of Capitate Glandular Trichome Density in Florets of Domesticated Sunflower (Helianthus annuus L.).

    Science.gov (United States)

    Gao, Qing-Ming; Kane, Nolan C; Hulke, Brent S; Reinert, Stephan; Pogoda, Cloe S; Tittes, Silas; Prasifka, Jarrad R

    2017-01-01

    Capitate glandular trichomes (CGT), one type of glandular trichomes, are most common in Asteraceae species. CGT can produce various secondary metabolites such as sesquiterpene lactones (STLs) and provide durable resistance to insect pests. In sunflower, CGT-based host resistance is effective to combat the specialist pest, sunflower moth. However, the genetic basis of CGT density is not well understood in sunflower. In this study, we identified two major QTL controlling CGT density in sunflower florets by using a F 4 mapping population derived from the cross HA 300 × RHA 464 with a genetic linkage map constructed from genotyping-by-sequencing data and composed of 2121 SNP markers. One major QTL is located on chromosome 5, which explained 11.61% of the observed phenotypic variation, and the second QTL is located on chromosome 6, which explained 14.06% of the observed phenotypic variation. The QTL effects and the association between CGT density and QTL support interval were confirmed in a validation population which included 39 sunflower inbred lines with diverse genetic backgrounds. We also identified two strong candidate genes in the QTL support intervals, and the functions of their orthologs in other plant species suggested their potential roles in regulating capitate glandular trichome density in sunflower. Our results provide valuable information to sunflower breeding community for developing host resistance to sunflower insect pests.

  8. Kinetics modeling of the drying of sunflower stem (Helianthus annuus L.) in a forced convection tunnel

    International Nuclear Information System (INIS)

    López, R; Vaca, M; Terres, H; Lizardi, A; Morales, J; Flores, J; Chávez, S

    2015-01-01

    The sunflower is an annual plant native to the Americas. It possesses a large inflorescence (flowering head), and its name is derived from the flower's shape and image, which is often used to capture the sun. The plant has a rough, broad, hairy stem, coarsely toothed, with rough leaves, and circular flower heads. The sunflower seeds are appreciated for their oil, which has become a widespread cooking ingredient. Leaves of the sunflower can be used as cattle feed, while the stems contain a fiber that may be used in paper production. Recently this flower has been used in phytoremediation of soils, contaminated with heavy metals. Sunflower has been probed as an efficient phytoextractor of chromium, lead, aluminum, zinc, cadmium from soil. In this work we present the experimental results of the drying of the sunflower stem, cut in 100 mm longitudinal sections, with diameters in the range of 11-18 mm. The aim was to obtain a dry and easy-to-handle final product, since these plants were originally cultivated in order to extract heavy metals from a polluted soil. The dried stems could then be easily confined or sent to recycle premises to concentrate the metals. The drying process was done in forced convection within a hot air tunnel. The used temperature was 60 °C, the velocity of air was 3 m/s and the required times were 8 hours. The initial average wet mass was 28 g and the final value was 5 g, resulting in the aimed product

  9. Seed yield and oil content of some sunflower ( Helianthus annuus L ...

    African Journals Online (AJOL)

    This research was carried out to determine the effects of irrigation applied at different growth stages on yield, yield components and oil content of sunflower during 2002 and 2003. Sunflower cultivars Sanbro, Tarsan-1018 and Ozdemirbey were used as materials in the experiment which was designed in a split plot of ...

  10. Selenium alleviates cadmium toxicity by preventing oxidative stress in sunflower (Helianthus annuus) seedlings.

    Science.gov (United States)

    Saidi, Issam; Chtourou, Yacine; Djebali, Wahbi

    2014-03-01

    The present study investigated the possible mediatory role of selenium (Se) in protecting plants from cadmium (Cd) toxicity. The exposure of sunflower seedlings to 20μM Cd inhibited biomass production, decreased chlorophyll and carotenoid concentrations and strongly increased accumulation of Cd in both roots and shoots. Similarly, Cd enhanced hydrogen peroxides content and lipid peroxidation as indicated by malondialdehyde accumulation. Pre-soaking seeds with Se (5, 10 and 20μM) alleviated the negative effect of Cd on growth and led to a decrease in oxidative injuries caused by Cd. Furthermore, Se enhanced the activities of catalase, ascorbate peroxidase and glutathione reductase, but lowered that of superoxide dismutase and guaiacol peroxidase. As important antioxidants, ascorbate and glutathione contents in sunflower leaves exposed to Cd were significantly decreased by Se treatment. The data suggest that the beneficial effect of Se during an earlier growth period could be related to avoidance of cumulative damage upon exposure to Cd, thus reducing the negative consequences of oxidative stress caused by heavy metal toxicity. Copyright © 2013 Elsevier GmbH. All rights reserved.

  11. Acetohydroxyacid synthase (AHAS) in vivo assay for screening imidazolinone-resistance in sunflower (Helianthus annuus L.).

    Science.gov (United States)

    Vega, T; Breccia, G; Gil, M; Zorzoli, R; Picardi, L; Nestares, G

    2012-12-01

    The objective of this work was to evaluate the in vivo acetohydroxyacid synthase (AHAS) activity response to imidazolinones and its possible use as a selection method for evaluating AHAS inhibitor resistance. In vivo AHAS assay and the comparison of parameters from dose-response curves have been used as a valid tool for comparing sunflower lines and hybrids differing in imidazolinone resistance. The sunflower resistant genotypes evaluated here were 100-fold and 20-fold more resistant compared with the susceptible line for imazethapyr and imazapyr, respectively. This assay also allowed discrimination of homozygous from heterozygous genotypes for I(mr1) locus that codify for the catalytic subunit of AHAS. The in vivo AHAS assay described in this study was useful for the selection of sunflower genotypes differing in herbicide resistance and could be a useful tool when breeding for imidazolinone resistance in sunflower. Copyright © 2012 Elsevier Masson SAS. All rights reserved.

  12. Molecular evolution of candidate genes for crop-related traits in sunflower (Helianthus annuus L.).

    Science.gov (United States)

    Mandel, Jennifer R; McAssey, Edward V; Nambeesan, Savithri; Garcia-Navarro, Elena; Burke, John M

    2014-01-01

    Evolutionary analyses aimed at detecting the molecular signature of selection during crop domestication and/or improvement can be used to identify genes or genomic regions of likely agronomic importance. Here, we describe the DNA sequence-based characterization of a pool of candidate genes for crop-related traits in sunflower. These genes, which were identified based on homology to genes of known effect in other study systems, were initially sequenced from a panel of improved lines. All genes that exhibited a paucity of sequence diversity, consistent with the possible effects of selection during the evolution of cultivated sunflower, were then sequenced from a panel of wild sunflower accessions an outgroup. These data enabled formal tests for the effects of selection in shaping sequence diversity at these loci. When selection was detected, we further sequenced these genes from a panel of primitive landraces, thereby allowing us to investigate the likely timing of selection (i.e., domestication vs. improvement). We ultimately identified seven genes that exhibited the signature of positive selection during either domestication or improvement. Genetic mapping of a subset of these genes revealed co-localization between candidates for genes involved in the determination of flowering time, seed germination, plant growth/development, and branching and QTL that were previously identified for these traits in cultivated × wild sunflower mapping populations.

  13. Physicochemical properties of 2S Albumins and the corresponding protein isolate from Sunflower (Helianthus annuus)

    NARCIS (Netherlands)

    Gonzalez-Perez, S.; Vereijken, J.M.; Koningsveld, van G.A.; Gruppen, H.; Voragen, A.G.J.

    2005-01-01

    Sunflower albumins (SFAs) are a diverse group of proteins present in sunflower isolates, with a sedimentation coefficient of approximately 2S. This research presents a detailed study of the influence of pH on the structure and solubility of SFAs. The effect of temperature on the structure of SFAs

  14. Isolation and characterization of undenatured chlorogenic acid free sunflower (Helianthus annuus) Proteins

    NARCIS (Netherlands)

    Gonzales-Perez, S.; Merck, K.B.; Vereijken, J.M.; Koningsveld, van G.A.; Gruppen, H.; Voragen, A.G.J.

    2002-01-01

    A method for obtaining sunflower protein (SFP) isolate, nondenatured and free of chlorogenic acid (CGA), has been developed. During the isolating procedure, the extent of CGA removal and protein denaturation was monitored. The defatted flour contained 2.5 percent CGA as the main phenolic compound.

  15. The lipidome and proteome of oil bodies from Helianthus annuus (common sunflower).

    Science.gov (United States)

    Furse, Samuel; Liddell, Susan; Ortori, Catharine A; Williams, Huw; Neylon, D Cameron; Scott, David J; Barrett, David A; Gray, David A

    2013-04-01

    In this paper we report the molecular profiling, lipidome and proteome, of the plant organelle known as an oil body (OB). The OB is remarkable in that it is able to perform its biological role (storage of triglycerides) whilst resisting the physical stresses caused by changes during desiccation (dehydration) and germination (rehydration). The molecular profile that confers such extraordinary physical stability on OBs was determined using a combination of (31)P/(1)H nuclear magnetic resonance (NMR), high-resolution mass spectrometry and nominal mass-tandem mass spectrometry for the lipidome, and gel-electrophoresis-chromatography-tandem mass spectrometry for the proteome. The integrity of the procedure for isolating OBs was supported by physical evidence from small-angle neutron-scattering experiments. Suppression of lipase activity was crucial in determining the lipidome. There is conclusive evidence that the latter is dominated by phosphatidylcholine (∼60 %) and phosphatidylinositol (∼20 %), with a variety of other head groups (∼20 %). The fatty acid profile of the surface monolayer comprised palmitic, linoleic and oleic acids (2:1:0.25, (1)H NMR) with only traces of other fatty acids (C24:0, C22:0, C18:0, C18:3, C16:2; by MS). The proteome is rich in oleosins (78 %) with the remainder being made up of caleosins and steroleosins. These data are sufficiently detailed to inform an update of the understood model of this organelle and can be used to inform the use of such components in a range of molecular biological, biotechnological and food industry applications. The techniques used in this study for profiling the lipidome throw a new light on the lipid profile of plant cellular compartments.

  16. Rhizopus oryzae associated with Melanagromyza splendida and stem disease of sunflowers (Helianthus annuus) in California

    Science.gov (United States)

    In September 2012, a female parental line in a Yolo, CA in sunflower seed-production field began displaying external stem symptoms that could not be attributed to any known disease. Symptoms appeared to be associated with tunneling caused by an un-identified insect. Stems were collected and Rhizopu...

  17. Cultivo de girassol ornamental (Helianthus annuus L. em vaso sob diferentes doses de paclobutrazol

    Directory of Open Access Journals (Sweden)

    JOSÉ GERALDO BARBOSA

    2008-07-01

    Full Text Available O girassol apresenta facilidade de propagação – tempo curto para colheita, e uma inflorescência atrativa, o que aumenta sua procura para a confecção de arranjos e vasos. O grande crescimento natural tem sido um dos entraves para que o girassol seja explorado como planta ornamental. O paclobutrazol é um regulador de crescimento que inibe a biossíntese de giberelina e reduz o alongamento da haste, podendo ser usado em diversas espécies ornamentais. Assim, para verificar a resposta de plantas de girassol, variedade Golden, dobrado, cultivado em vaso com diferentes substratos à aplicação de paclobutrazol, instalou-se experimento, utilizando-se o delineamento experimental em blocos casualizados em arranjo fatorial 4 x 4 com quatro substratos (solo:areia:casca de arroz carbonizada 2:0,5:2 v/v; solo:areia:carvão de cana, 2:0,5:2 v/v; solo:areia:carvão vegetal 2:0,5:2 v/v e substrato comercial e quatro doses de paclobutrazol (0; 2; 4; 6 mg i.a./vaso com 3 repetições. Avaliaram-se os parâmetros altura de planta (cm, número de folhas, concentração de clorofila em unidades SPAD. Verificou-se melhor qualidade nas plantas cultivadas nos substratos que continham casca de arroz carbonizada e carvão de cana. Houve aumento da unidade SPAD com o aumento das doses de paclobutrazol, sendo o máximo estimado na dose de 5,08 mg i.a./vaso. Observou-se uma relação inversa entre a dosagem de paclobutrazol e a altura da planta, o que permite constatar que a aplicação da dose de 6 mg i.a./vaso reduziu o porte das plantas de girassol,possibilitando boa harmonia de vaso, sendo, portanto, a mais recomendada.

  18. RESPONSE OF TWO SUNFLOWER (HELIANTHUS ANNUUS L. GENOTYPES TO VA-MYCORRHIZAL INOCULATION AND PHOSPHORUS LEVELS

    Directory of Open Access Journals (Sweden)

    C.P. CHANDRASHEKARA, V.C. PATIL

    1995-01-01

    Full Text Available The performance of two sunflower genotypes (Morden and MSFH-8 with and without VA-mycorrhizal fungi at three P levels (38, 56 and 75 kg P2O5 ha-1 in vertisol of Dharwad was studied to determine the effect of mycorrhizal inoculation on plant growth, yield and P uptake. The results showed that the VAM inoculation increased sunflower yield (14%, total biomass (16%, oil content (3.1% and P uptake (30.5% over uninoculated control. The percent root colonization and chlamydo-spore count decreased with increasing P levels. The total biomass production, seed yield and P uptake of mycorrhizal plants at 38 kg P2O5 ha-1 more than the non-mycorrhizal plants at 75 kg P2O5 ha-1. The biomass and seed yield of mycorrhizal plants at same P level were more than the non-mycorrhizal plants. Mycorrhizal plants of Morden at 38 kg P2O5 ha-1 and MSFH-8 at 56 kg P2O5 ha-1 produced higher seed yield, oil content and total biomass than non-mycorrhizal plants supplied with 75 kg P2O5 ha-1. The results indicated that, VA-mycorrhizal inoculation helps in saving 25 and 50 percent of recommended dose of phosphatic fertilizer (75 kg P2O5 ha-1 in MSFH-8 (single cross hybrid and Morden (open pollinated variety, respectively.

  19. Genetic analysis of agro-morphological traits in promising hybrids of sunflower (Helianthus annuus L.

    Directory of Open Access Journals (Sweden)

    Maryam GOLABADI

    2015-11-01

    Full Text Available The main objective underlying sunflower breeding programs is to develop high-yielding productive F1 hybrid cultivars. This study was conducted to investigate the genetic control of some agro-morphological traits of new sunflower F1 hybrids. For this purpose, fourteen inbred lines of sunflower were crossed with three male sterile inbred lines. Their hybrids (14 hybrids were then evaluated against three control cultivars. The data thus obtained were analyzed using the nested model (North Carolina Design І as a completely randomized block design (CRBD with four replications. Analysis of variance showed that the hybrids were significantly different in all the traits studied, except for head and stem diameters. From among the hybrids evaluated, Cms19 × Rn1-81 was found to have the highest seed yield and oil content. Cluster analysis classified the hybrids into four different groups. Genetic analysis showed that days to maturity, seed weight, and oil content (% were under the additive gene action. Breeding strategies based on selection could be suggested for the improvement of these traits. Head angle, head diameter, seed yield, and oil yield were under the dominance gene action; breeding based on hybridization methods is, therefore, proposed for these traits. Finally, both additive and dominance gene actions were observed to play important roles in the genetic control of plant height and stem diameter.

  20. Prestaciones de un dosificador neumático para la siembra monogramo de semillas de girasol

    OpenAIRE

    Maroni, Jorge Raúl; Fernández Asenjo, Carlos; Dalla Marta, Néstor

    2004-01-01

    La densidad poblacional y la distribución espacial de las plantas son factores asociados al manejo eficaz de un cultivo para que éste exprese su máximo potencial de rendimiento. Ambos factores están vinculados con la capacidad del dosificador de la sembradora para entregar las semillas una por una. Las semillas de girasol, aún cuando se encuentren calibradas en tamaño y forma, presentan dificultades para manejarlas mediante los dosificadores mecánicos tradicionales, requiriendo un ajuste prec...

  1. La fertilización nitrogenada en el rendimiento del girasol en México

    Directory of Open Access Journals (Sweden)

    Luis Enrique Escalante-Estrada

    2007-01-01

    Full Text Available Con el fin de evaluar el efecto de la fertilización nitrogenada aplicada al suelo sobre el rendimiento del girasol, se realizó la presente investigación en el campo del CEP-CSAEGRO. Se utilizó la línea 58 de girasol. Los niveles de N evaluados fueron: 0, 40, 80 y 120 kg ha-1, aplicados a los 9 días después de la siembra, con sulfato de amonio (20,5% N. El análisis de varianza indicó que el N aplicado aumentó el rendimiento en semilla, el diámetro del capítulo, el peso del capítulo sin semilla, el peso de 100 semillas, la altura de la planta, la eficiencia del N, y la rentabilidad económica, ya que se presentaron diferencias estadísticas significativas entre sus medias. Los valores más altos de las variables se obtuvieron cuando se aplicó 120 kg de N ha-1.

  2. Aceite de girasol, semillas y plantas con distribución modificada de ácidos grasos en la molécula de triacil-glicerol

    OpenAIRE

    Garcés Mancheño, Rafael; Martínez-Force, Enrique

    2003-01-01

    El objeto de la presente invención es un aceite de girasol que se obtiene directamente de la semilla de girasol con de 12-40,8% de ácido esteárico calculado en relación al contenido total de ácidos grasos y con una distribución de ácidos grasos modificada entre las posiciones sn-1 y sn-3 de la molécula de triacilglicerol (TAG) comparado con el aceite obtenido del tipo silvestre de semillas de girasol. La invención también se refiere a una planta de girasol y a semillas que contien...

  3. Epocas de siembra de girasol intercalado en caña de azúcar

    Directory of Open Access Journals (Sweden)

    Domínguez Pablo

    1989-12-01

    Full Text Available Con el objeto de determinar la época más oportuna de siembra de girasol intercalado de caña se estableció un experimento en el Ingenio Providencia en el Cerrito, (Colombia, utilizando los híbridos de girasol DO 664 Y DO 855, en seis épocas soca (10, 15,20,25,30 y 35 días después del corte de caña CP 57603. La caña estaba sembrada entre surcos a 1.5 m y se le intercaló un surco de girasol en una población aproximada de 27 000 plantas/ha. El experimento se diseñó en bloques al azar y se arregló en parcelas divididas. En girasol se logró una producción promedia máxima de 1085 kg/ha cuando se sembró a los 10 días después del corte de la caña y decrecio el rendimiento significativamente a medida que se sembró más tarde. La siembra más aconsejable ocurrió dentro de los 10 a 25 días después de cortada la caña. El tamaño de la semilla se afectó notablemente a medida que se sembró más tarde, los porcentajes de cáscara y almendra no sufrieron variación. El diámetro del capítulo, la altura y diámetro del tallo fueron mayores en las siembras más cercanas al corte de la caña. Después de cosechado el girasol se obtuvieron 142 t/ha/ caña y 11.9 t de azúcar/ha, demostrando una recuperación total de la gramínea, lo cual se reflejó en el poco efecto que tuvo el girasol en la población, altura y diámetro final del tallo de la caña.An experiment to evaluate the most convenient planting date of sunflower intercropped in sugarcane ratoons, was carried out at the sugar mill Providencia, located at the Cerrito county (Colombia. The research included two sunflower hybrids (DO 855 and DO 664 and the sugar variety CP 57603 in six dates after of harvesting of sugarcane (10, 15, 20,25,30 and 35 days. Between the distance of the rows of sugarcane (1.50 m an intercropped line of sunflower was planted using 4 plant per meter in a density population of 27000 plants/ha. The plot was formed by 10 rows of sunflower with 10 m long. A

  4. Inheritance of resistance to sunflower broomrape (Orobanche cumana Wallr.) in an interspecific cross between Helianthus annuus and Helianthus debilis subsp. tardiflorus

    Science.gov (United States)

    Sunflower broomrape (Orobanche cumana Wallr.) constrains sunflower cultivation in increasing areas of Europe and Asia. Populations classified as race G that overcome all known resistance genes have recently appeared. The objective of this research was to study the inheritance of resistance to broomr...

  5. Estudio proteico de híbridos de girasol cultivados en Argentina

    Directory of Open Access Journals (Sweden)

    Santalla, E.

    1993-10-01

    Full Text Available Protein content of residual meals of two sunflower cultivar during two harvest are evaluated. The relation between this component and the oil content of hull, achene and seed are showed. Negative tendency of correlation are observed between hull oil content and hull protein content, on achene oil content and achene protein content and on seed oil content and seed protein content along the harvest studied. Although the protein content for second harvest studied was lower, the apparent competitive behaviour between oil-protein was ratified.

    Se analizaron los contenidos proteicos de las harinas seminales residuales de extracción, correspondientes a cultivos de girasol (durante dos cosechas, con el fin de estudiar el comportamiento de esta variable en relación con los contenidos de aceite de los constituyentes de la semilla. Se realizaron correlaciones entre los contenidos proteicos de la cáscara, la pipa y la semilla, y la cantidad de aceite que éstos aportan, obteniendo tendencias de correlación negativas entre los mismos. A pesar que los contenidos proteicos obtenidos para la segunda cosecha fueron menores respecto de la primera, el comportamiento aparentemente competitivo entre aceite-proteína se ratificó con similar relevancia.

  6. Procedimiento para la discriminación y mapeo de los rodales de nerdo en cultivos de girasol mediante teledetección

    OpenAIRE

    López Granados, Francisca; García Torres, Luis; Peña Barragán, José Manuel; Jurado-Expósito, Montserrat

    2006-01-01

    Procedimiento para la discriminación y mapeo de los rodales de nerdo en cultivos de girasol mediante teledetección. Procedimiento para mapear zonas infestadas de la mala hierba conocida como nerdo (Ridolfia segetum Moris) en plantaciones de girasol mediante teledetección. Tiene aplicación en Agricultura, y más concretamente en Empresas de Asistencia Técnica Agraria o Medioambiental, o en Auditorias Agroambientales Públicas o Privadas. Principalmente consiste en el anál...

  7. EVALUATION OF YEAR WEATHER CONDITIONS AND HYBRIDS IMPACT ON THE SUNFLOWER (HELIANTHUS ANNUUS L. ACHENE YIELD AND FAT CONTENT

    Directory of Open Access Journals (Sweden)

    Ivan Černý

    2013-02-01

    Full Text Available The field polyfactorial trials were carried out on experimental fields of the Plant Biology and Ecology Centre, the Faculty of Agrobiology and Food Resources of the Slovak University of Agriculture (SUA in Nitra Dolná Malanta in two experimental years 2010 and 2011. Experimental locality is situated in the corn production area (climatic region: warm; climatic sub-region dry; climatic zone: warm, dry with mild winter and long sunshine, in altitude 250 m above sea level, with brown soil. On the trials was observed the influence of both temperature and moisture conditions of experimental area on sunflower yield of achenes and fat content. Fore crop of sunflower was spring barley (Hordeum vulgare L. Technological system of sunflower cultivation was realized in accordance with conventional technology of cultivation. The basic fertilization was made by balance method on the base of agrochemical analysis of soil for expected yield 3 t ha-1. The meteorological data were got out from agro-meteorological station the Faculty of Horticulture and Land Engineering SUA in Nitra. The results show statistically high significant impact of the year weather conditions on the both achenes yield and fat content. In the range of weather conditions, year 2011 have better impact on the values of both indicators than year 2010. The effect of hybrids on monitored production parameters was statistically high significant. In the year 2010 and 2011, in terms of yield quantity but also fat content had hybrid NK Kondi the most stable production. In 2010 and 2011 were reported negative correlations of fat content from achenes yield except of hybrid NK Tristan, which reach positive addiction in 2010.

  8. Recognition of Orobanche cumana Below-Ground Parasitism Through Physiological and Hyper Spectral Measurements in Sunflower (Helianthus annuus L.).

    Science.gov (United States)

    Cochavi, Amnon; Rapaport, Tal; Gendler, Tania; Karnieli, Arnon; Eizenberg, Hanan; Rachmilevitch, Shimon; Ephrath, Jhonathan E

    2017-01-01

    Broomrape ( Orobanche and Phelipanche spp.) parasitism is a severe problem in many crops worldwide, including in the Mediterranean basin. Most of the damage occurs during the sub-soil developmental stage of the parasite, by the time the parasite emerges from the ground, damage to the crop has already been done. One feasible method for sensing early, below-ground parasitism is through physiological measurements, which provide preliminary indications of slight changes in plant vitality and productivity. However, a complete physiological field survey is slow, costly and requires skilled manpower. In recent decades, visible to-shortwave infrared (VIS-SWIR) hyperspectral tools have exhibited great potential for faster, cheaper, simpler and non-destructive tracking of physiological changes. The advantage of VIS-SWIR is even greater when narrow-band signatures are analyzed with an advanced statistical technique, like a partial least squares regression (PLS-R). The technique can pinpoint the most physiologically sensitive wavebands across an entire spectrum, even in the presence of high levels of noise and collinearity. The current study evaluated a method for early detection of Orobanche cumana parasitism in sunflower that combines plant physiology, hyperspectral readings and PLS-R. Seeds of susceptible and resistant O. cumana sunflower varieties were planted in infested (15 mg kg -1 seeds) and non-infested soil. The plants were examined weekly to detect any physiological or structural changes; the examinations were accompanied by hyperspectral readings. During the early stage of the parasitism, significant differences between infected and non-infected sunflower plants were found in the reflectance of near and shortwave infrared areas. Physiological measurements revealed no differences between treatments until O. cumana inflorescences emerged. However, levels of several macro- and microelements tended to decrease during the early stage of O. cumana parasitism. Analysis of leaf cross-sections revealed differences in range and in mesophyll structure as a result of different levels of nutrients in sunflower plants, manifesting the presence of O. cumana infections. The findings of an advanced PLS-R analysis emphasized the correlation between specific reflectance changes in the SWIR range and levels of various nutrients in sunflower plants. This work demonstrates potential for the early detection of O. cumana parasitism on sunflower roots using hyperspectral tools.

  9. Recognition of Orobanche cumana Below-Ground Parasitism Through Physiological and Hyper Spectral Measurements in Sunflower (Helianthus annuus L.

    Directory of Open Access Journals (Sweden)

    Amnon Cochavi

    2017-06-01

    Full Text Available Broomrape (Orobanche and Phelipanche spp. parasitism is a severe problem in many crops worldwide, including in the Mediterranean basin. Most of the damage occurs during the sub-soil developmental stage of the parasite, by the time the parasite emerges from the ground, damage to the crop has already been done. One feasible method for sensing early, below-ground parasitism is through physiological measurements, which provide preliminary indications of slight changes in plant vitality and productivity. However, a complete physiological field survey is slow, costly and requires skilled manpower. In recent decades, visible to-shortwave infrared (VIS-SWIR hyperspectral tools have exhibited great potential for faster, cheaper, simpler and non-destructive tracking of physiological changes. The advantage of VIS-SWIR is even greater when narrow-band signatures are analyzed with an advanced statistical technique, like a partial least squares regression (PLS-R. The technique can pinpoint the most physiologically sensitive wavebands across an entire spectrum, even in the presence of high levels of noise and collinearity. The current study evaluated a method for early detection of Orobanche cumana parasitism in sunflower that combines plant physiology, hyperspectral readings and PLS-R. Seeds of susceptible and resistant O. cumana sunflower varieties were planted in infested (15 mg kg-1 seeds and non-infested soil. The plants were examined weekly to detect any physiological or structural changes; the examinations were accompanied by hyperspectral readings. During the early stage of the parasitism, significant differences between infected and non-infected sunflower plants were found in the reflectance of near and shortwave infrared areas. Physiological measurements revealed no differences between treatments until O. cumana inflorescences emerged. However, levels of several macro- and microelements tended to decrease during the early stage of O. cumana parasitism. Analysis of leaf cross-sections revealed differences in range and in mesophyll structure as a result of different levels of nutrients in sunflower plants, manifesting the presence of O. cumana infections. The findings of an advanced PLS-R analysis emphasized the correlation between specific reflectance changes in the SWIR range and levels of various nutrients in sunflower plants. This work demonstrates potential for the early detection of O. cumana parasitism on sunflower roots using hyperspectral tools.

  10. Interactive effect of salinity and boron application on growth and physiological traits of sunflower (Helianthus annuus L. genotypes

    Directory of Open Access Journals (Sweden)

    Muhammad Atif Riaz, Muhammad Saqib, Javaid Akhtar and Riaz Ahmad

    2012-11-01

    Full Text Available Soil salinity is a major problem of agriculture in Pakistan. Permanent solution of salinity problem is removal of salts by leaching and drainage whic is expensive. So research efforts should involve profitable utilization of these lands through biological approaches. Considering these observations, this study was designed with the objectives to explore changes in growth and physiological attributes of different sunflower genotypes under interactive effect of salinity and boron. Vigorous seeds of selected genotypes (two tolerant, two sensitive were sown in gravels. One week old seedlings were transplanted to ½ strength Hoagland’s nutrients solution. Three days after transplantation the requisite salinity (control and 100 mM NaCl and boron levels (0.05 mM B, 0.5 mM B and 1.0 mM B as H3BO3 were established in three installments. The arrangement of the experiment was split plot with three replications. The data regarding shoot and root fresh weights, relative water contents (RWC, membrane stability index (MSI, and leaf area (LA were recorded. The results revealed that salinity and boron adversely affected the growth and physiology of sunflower genotypes with a higher effect in the case of combined stress. This study also showed that the growth reduction was more in the salt susceptible genotypes (Hysun-33, Hysun-38 than in the salt tolerant genotypes (SF-187, S-278.

  11. Abscisic acid, a stress hormone helps in improving water relations and yield of sunflower (helianthus annuus l.) hybrids under drought

    International Nuclear Information System (INIS)

    Hussain, S.; Saleem, M.F.; Cheema, M.A.; Ashraf, M.Y.; Haq, M.A.

    2010-01-01

    Genotypic variation in water relations under drought is an important index of studying drought tolerance of crops. Abscisic acid (ABA) application helped in mitigating drought stress by improving water relations and yield. Three sunflower hybrids viz., DK-4040 (tall stature), S-278 (medium stature) and SF-187 (short stature) were subjected to different irrigation and ABA application regimes i.e., four irrigations (25 days after sowing (DAS), at bud initiation, at flower initiation and at achene formation) and with no ABA spray, three irrigations (25 days after sowing, at flower initiation and at achene formation) and with no ABA spray, three irrigations (25 days after sowing, at flower initiation and at achene formation) and with ABA spray at bud initiation, three irrigations (25 days after sowing), at bud initiation and at achene formation) and with no ABA spray, three irrigations (25 days after sowing), at bud initiation and at achene formation) and with ABA spray at flower initiation. The experiment was laid out in randomized complete block design with split plot arrangement and had three replications. Exogenous application of ABA under drought at either stage (bud or flower initiation) was helpful in ameliorating drought stress by improving water relations and yield of sunflower hybrids; however response was better when ABA was applied under drought at bud initiation than at flower initiation stage. Sunflower hybrid DK- 4040 showed better enhancement of drought tolerance by exogenous application of ABA under drought than SF-187 and S-278 because it showed more improvement in water potential, osmotic potential, turgor pressure, relative leaf water contents and achene yield. (author)

  12. Growth, yield and ionic concentration of two sunflower (Helianthus annuus L. genotypes exposed to brackish water irrigation

    Directory of Open Access Journals (Sweden)

    Syed Azhar Hussain*, Javaid Akhtar, Muhammad Anwar-ul-haq and Rashid Ahmad

    2011-04-01

    Full Text Available The effects of brackish water application were assessed on the growth, uptake of sodium (Na+, potassium (K+, waterrelations, membrane stability index, proline accumulation, and yield of two sunflower genotypes (SF-187 and hysun-33. Treatments of irrigation water with different ECiw, SAR and RSC were T1, control; T2, EC: 8 dS m-1; T3, SAR: 16(mmol L-11/2; T4, RSC: 4 meq L-1, and T5, EC: 8 dS m-1 + SAR 16 (mmol L-11/2 + RSC 4 meq L-1. Genotypesdisplayed a substantial variability for salinity and/or sodicity tolerance and salt tolerant behavior of SF-187regarding, high K:Na ratio, increased water contents, higher membrane stability index and higher yield ascompared to Hysun-33, was confirmed under various treatments. Saline-sodic water caused maximum reductionin plant growth and yield in both sunflower genotypes followed by saline water treatment. However, no significantdifferences were noted between high SAR (T3 and high RSC (T4 treatments. In conclusion, SF-187 exhibited someimportant features of salt tolerance that can be successfully exploited under brackish water irrigation.

  13. Genetic variation for germination and physiological traits in sunflower mutants induced by gamma rays [Helianthus annuus L.

    International Nuclear Information System (INIS)

    Alejo-Jaimes, A.; Jardinaud, M.F.; Maury, P.; Alibert, G.; Gentzbittel, L.; Sarrafi, A.; Grieu, P.; Petiprez, M.

    2004-01-01

    Seeds of sunflower line AS-613 were irradiated with gamma rays and 1,559 M4 progenies were studied for their germination characteristics and the following traits were studied: thousand seed weight, seed size, time before emergence, percentage of emerged seedlings, hypocotyl length and diameter, number of cotyledons and cotyledons pigmentation intensity. A high genetic variability was observed for all the studied traits. Through M4 progenies, 9 mutants presenting the most differences with the original genotype (AS-613) were planted in a randomized blocks design with 8 replications in a controlled greenhouse and some morphological and physiological traits were studied, which are: plant height, number of leaves, total leaf area, net photosynthesis, transpiration, stomatal conductance, water use efficiency and net carbon assimilation. When harvesting, flower head diameter, head weight, stem weight, leaves weight, total number of seeds per plant and thousand seed weight were measured. The differences between mutants and also non irradiated genotype (AS-613) were significant for most of studied traits suggesting that several developmental processes have been modified [it

  14. THE CYTOGENETIC EFFECTS WITH LEAD NITROGENOUS TREATMENT AT HELIANTHUS ANNUUS L. FAVORIT AND PR64A83 CULTIVARS

    Directory of Open Access Journals (Sweden)

    Felicia Vlad-Rusen

    2007-08-01

    Full Text Available The analysis of some cytogenetic parameters shows that the nitrogenous lead application on Favorit and PR64A83 cultivars of sunflower exercises a light mutagenic effect on the cells of the root apex. At same time an intensification of the frequency of the ana-telophases with aberration takes place, especially of those with bridges, with lagging chromosomes, but also of those with fragments, demonstrating the perturbatory action that this substance exercises on the division axle. The apparition of a great number of metaphases with displayed chromosomes proves the perturbation of well function to division axle, effect signalized especially at the Favorit cultivar.

  15. Effect of Nitrogen and Phosphorus Sources on Soil Chemical Properties and Elements Concentration in Sunflower (Helianthus annuus L.

    Directory of Open Access Journals (Sweden)

    A. i Yadav

    2016-02-01

    Full Text Available Introduction: Soil fertility management is a key factor in achieving sustainable agriculture. Use of organic fertilizers is one of the methods that without environmental harmful effects with improvement of chemical and biological conditions increases soil fertility. Nitroxin contains a collection of the best strains of nitrogen fixation bacteria of the genus Azospirillum and Azotobacter. These bacteria through atmospheric nitrogen fixation and the balance of macro and microelements needed for plant uptake, stimulate the growth and development of roots and aerial parts of the plant. Phosphate Barvar2 is another bio-fertilizer which contains set of phosphate solubilizing bacteria of different genera Bacillus and Pseudomonas that can change soil insoluble phosphorus into available forms for plants. The purpose of this study was to evaluate some chemical properties of soil and nutrient concentrations in leaves and seeds of sunflower under the influence of chemical and biological form of nitrogen and phosphorus fertilizers to reduce the use of chemical inputs and to improve quality traits in sunflower. Material and Methods :The experiment was carried out in a split factorial based on RCBD with three replications in a field in Eivanegharb (Ilam province in summer of 2011. The main plot included four levels of phosphorus and nitrogen chemical fertilizer (0, 33, 66 and 100% of nitrogen and phosphorus fertilizer requirements and subplot included factorial of Nitroxin bio-fertilizer application with two levels (inoculation and non inoculation and Phosphate Barvare2 bio fertilizer with two levels (inoculation and non inoculation. Each plot consisted of 5 rows at a distance of 60 cm and a length of 6 m and 20 cm plant spacing. At the time of flowering, leaves were harvested for measurement of nitrogen, phosphorus, potassium, zinc and manganese. After harvesting, the amount of total nitrogen, phosphorus and potassium and pH of the soil and the concentrations of nitrogen, phosphorus, potassium, zinc and manganese seed were measured. Results and Discussion: The residual soil nitrogen: Based on these results, the effect of any of the factors tested for the residual soil nitrogen was not significant. The remaining soil phosphorus: With the increased use of chemical fertilizer, soil phosphorus increased so that the maximum (54.5 mg kg-1 soil and minimum (40 mg kg-1 soil, available soil phosphorus levels were recorded in consumption of 100% of the required fertilizer and control treatments. Nitroxin and Phosphate Barvare2 applications increased percentage of soil phosphorus, i.e. 12.7 and 23.6 %, respectively, compared to no fertilizer application. The remaining soil potassium: Comparison of mean values showed that the increase in use of nitrogen and phosphorus fertilizer requirements reduced potassium levels in the soil, so that the maximum amount of soil potassium (624.9 mg kg-1 soil belonged to control chemical fertilizer treatment and the minimum value of this attribute (514.4 mg per kg of soil was related to the use of 100% chemical fertilizer consumption with no significant difference with use of 66% chemical fertilizers treatment. Soil pH: Among the experimental factors studied only bio-fertilizer Phosphate Barvar2 had a significant effect on soil pH at 5% probability so that the use of bio-fertilizer Phosphate Barvar2 significantly decreased soil pH. Leaf nitrogen: By increasing the amount of chemical fertilizer used, leaf nitrogen content increased, so that the maximum amount of leaf nitrogen (2.5% was observed in the use of 100% chemical fertilizer consumption treatment. However, no significant difference was recorded in the use of 66% chemical fertilizers tratment. The lowest of this trait (2.2% belonged to control chemical fertilizer treatment without significant difference with use of 33% chemical fertilizers consumption treatment. Seed nitrogen: Chemical fertilizer and Phosphate Barvar2 had significant effects on the amount of seed nitrogen content. With the increasing use of chemical fertilizers seed nitrogen increased so that the maximum (2.9% and minimum (2.6% seed nitrogen content belonged to use 100% of the chemical fertilizer and non-application of fertilizer, respectively. Mean comparison effect of Phosphate Barvar2 inoculation revealed that seed nitrogen increased by 3.7%. Seed phosphorus: Analysis of variance showed that the amount of seed phosphorus significantly was affected by the treatments, i.e. Nitroxin and Phosphate Barvare2 as well as the interaction of chemical fertilizer and Nitroxin. Application of Phosphate Barvar2 increased the amount of seed phosphorus by 14.8%. Seed potassium: Increasing application of chemical fertilizer requirement increased seed potassium. Among the 0, 33, 66 and 100% chemical fertilizer application treatments, Phosphate Barvare2 inoculation increased seed potassium by 23.3, 31.2, 31.3 and 11.4%, respectively. Seed zinc: According to the analysis of variance, effect of bio-fertilizer Phosphate Barvar2 and interaction of Phosphate Barvar2 and chemical fertilizer on the amount of seed zinc were significant different. However, only in 100% chemical fertilizer requirement, Phosphate Barvare2 inoculation showed significant difference in this trait (63.4% increase. Seed manganese: The results showed that factors of Nitroxin and Phosphate Barvar2 and also the interaction of Phosphate Barvar2 and chemical fertilizer had significant effects on seed manganese content. Sunflower seed inoculation with Nitroxin increased the amount of seed manganese by 37%. Conclusion: According to the results, the maximum increase in the amount of nutrients studied in leaves and seeds of sunflower and soil was obtained in combined use of chemical and biological fertilizers. Keywords: Biofertilizer, Chemical Fertilizer, Nitroxin, Phosphate Barvare2, Seed Elements, Sunflower

  16. Mapping the quantitative trait loci (QTL) controlling seed morphology and disk diameter in sunflower (Helianthus annuus L.)

    Science.gov (United States)

    Several seed morphological traits, along with disk diameter, differ greatly between oilseed and confection sunflower types, which are bred for different end-use purposes. This paper reports the results of analyzing the quantitative trait loci (QTL) underlying seed morphological traits and disk diam...

  17. Selection on crop-derived traits and QTL in sunflower (Helianthus annuus crop-wild hybrids under water stress.

    Directory of Open Access Journals (Sweden)

    Birkin R Owart

    Full Text Available Locally relevant conditions, such as water stress in irrigated agricultural regions, should be considered when assessing the risk of crop allele introgression into wild populations following hybridization. Although research in cultivars has suggested that domestication traits may reduce fecundity under water stress as compared to wild-like phenotypes, this has not been investigated in crop-wild hybrids. In this study, we examine phenotypic selection acting on, as well as the genetic architecture of vegetative, reproductive, and physiological characteristics in an experimental population of sunflower crop-wild hybrids grown under wild-like low water conditions. Crop-derived petiole length and head diameter were favored in low and control water environments. The direction of selection differed between environments for leaf size and leaf pressure potential. Interestingly, the additive effect of the crop-derived allele was in the direction favored by selection for approximately half the QTL detected in the low water environment. Selection favoring crop-derived traits and alleles in the low water environment suggests that a subset of these alleles would be likely to spread into wild populations under water stress. Furthermore, differences in selection between environments support the view that risk assessments should be conducted under multiple locally relevant conditions.

  18. Enhanced accumulation of copper and lead in amaranth (Amaranthus paniculatus), Indian mustard (Brassica juncea) and sunflower (Helianthus annuus).

    Science.gov (United States)

    Rahman, Motior M; Azirun, Sofian M; Boyce, Amru N

    2013-01-01

    Soil contamination by copper (Cu) and lead (Pb) is a widespread environmental problem. For phytoextraction to be successful and viable in environmental remediation, strategies that can improve plant uptake must be identified. In the present study we investigated the use of nitrogen (N) fertilizer as an efficient way to enhance accumulation of Cu and Pb from contaminated industrial soils into amaranth, Indian mustard and sunflower. Plants were grown in a greenhouse and fertilized with N fertilizer at rates of 0, 190 and 380 mg kg⁻¹ soil. Shoots, roots and total accumulation of Cu and Pb, transfer factor (TF), translocation index were assessed to evaluate the transport and translocation ability of tested plants. Addition of N fertilizer acidified the industrial soil and caused the pH to decrease to 5.5 from an initial pH of 6.9. Industrial soil amended with N fertilizer resulted in the highest accumulation of Pb and Cu (for Pb 10.1-15.5 mg kg⁻¹, for Cu 11.6-16.8 mg kg⁻¹) in the shoots, which was two to four folds higher relative to the concentration in roots in all the three plants used. Sunflower removed significantly higher Pb (50-54%) and Cu (34-38%) followed by amaranth and Indian mustard from industrial soils with the application of N fertilizer. The TF was Sunflower is the best plant species to carry out phytoextraction of Pb and Cu. In contrast, Pb and Cu removal by Indian mustard and amaranth shows great potential as quick and short duration vegetable crops. The results suggest that the application of N fertilizer in contaminated industrial soil is an effective amendment for the phytoextraction of Pb and Cu from contaminated industrial soils.

  19. Rhizosphere colonization and arsenic translocation in sunflower (Helianthus annuus L.) by arsenate reducing Alcaligenes sp. strain Dhal-L.

    Science.gov (United States)

    Cavalca, Lucia; Corsini, Anna; Bachate, Sachin Prabhakar; Andreoni, Vincenza

    2013-10-01

    In the present study, six arsenic-resistant strains previously isolated were tested for their plant growth promoting characteristics and heavy metal resistance, in order to choose one model strain as an inoculum for sunflower plants in pot experiments. The aim was to investigate the effect of arsenic-resistant strain on sunflower growth and on arsenic uptake from arsenic contaminated soil. Based on plant growth promoting characteristics and heavy metal resistance, Alcaligenes sp. strain Dhal-L was chosen as an inoculum. Beside the ability to reduce arsenate to arsenite via an Ars operon, the strain exhibited 1-amino-cyclopropane-1-carboxylic acid deaminase activity and it was also able to produce siderophore and indole acetic acid. Pot experiments were conducted with an agricultural soil contaminated with arsenic (214 mg kg⁻¹). A real time PCR method was set up based on the quantification of ACR3(2) type of arsenite efflux pump carried by Alcaligenes sp. strain Dhal-L, in order to monitor presence and colonisation of the strain in the bulk and rhizospheric soil. As a result of strain inoculation, arsenic uptake by plants was increased by 53 %, whereas ACR3(2) gene copy number in rhizospheric soil was 100 times higher in inoculated than in control pots, indicating the colonisation of strain. The results indicated that the presence of arsenate reducing strains in the rhizosphere of sunflower influences arsenic mobilization and promotes arsenic uptake by plant.

  20. Root colonization and growth promotion of sunflower (Helianthus annuus L.) by phosphate solubilizing Enterobacter sp. Fs-11.

    Science.gov (United States)

    Shahid, Muhammad; Hameed, Sohail; Imran, Asma; Ali, Saira; van Elsas, Jan Dirk

    2012-08-01

    An Enterobacter sp. Fs-11 was isolated from sunflower rhizosphere, identified on the basis of 16S rRNA gene sequence analysis (GeneBank accession no. GQ179978) and studied for its root colonization and growth promotion ability in sunflower. Morphologically, it was rod shaped Gram-negative, motile bacterium, producing 4.5 μg mL(-1) indole acetic acid in tryptophan-supplemented medium. It utilized 27 out of 95 substrates in BIOLOG GN2 micro plate system. It was able to convert insoluble tri-calcium phosphate to soluble phosphorus up to 43.5 μg mL(-1) with decrease in pH of the medium up to 4.5 after 10 days incubation at 28 ± 2 °C in the Pikovskaya's broth. High performance liquid chromatography of cell free supernatant showed that Fs-11 produced malic acid and gluconic acid (2.43 and 16.64 μg mL(-1), respectively) in Pikovskaya's broth. Analysis of 900 bp fragment of pyrroloquinoline quinine pqqE gene sequence showed 98 % homology with that of E. cloacae pqqE gene. Confocal laser scanning microscope revealed strong colonization of fluorescently labeled Fs-11 with sunflower roots. Sunflower inoculation with Fs-11 and its rifampicin resistant derivative in sterile sand and natural soil showed that Fs-11 colonized sunflower roots up to 30 days after transplanting in both sterile sand as well as natural soil. Moreover, Fs-11 inoculation resulted in increased plant height, fresh weight, dry weight and total phosphorus contents as compared to un-inoculated plants. The data showed that Enterobacter sp. Fs-11 is an efficient phosphate solubilizing and plant growth promoting rhizobacterium and has great potential to be used as bio-inoculant for sunflower under phosphorus deficient conditions.

  1. Toxic effect of nickel (Ni) on growth and metabolism in germinating seeds of sunflower (Helianthus annuus L.).

    Science.gov (United States)

    Ashraf, Muhammad Yasin; Sadiq, Rumana; Hussain, Mumtaz; Ashraf, Muhammad; Ahmad, M Sajid Aqeel

    2011-12-01

    To assess the toxic effect of nickel (Ni) on the growth and some key metabolic processes in sunflower, varying levels of Ni as Ni(NO(3))(2) up to 60 mg L(-1) were applied once to sunflower cultivars SF-187 and Hysun-33 at sowing time in sand culture. An increase in Ni in the growth medium adversely affected growth parameters, sugar concentration (both reducing and non-reducing), as well as the activities of α-amylase and protease. It also slowed down mobilization of stored proteins and amino acids in the germinating seeds. However, an increase in the activities of α-amylase and protease was observed over time from 24 to 120 h after sowing. Cultivar Hysun-33 showed better performance than SF-187 in the presence of excess Ni. Overall, Ni-induced reduction in germination of sunflower seed appeared to be due to disturbance in biochemical metabolism as the availability of sugars for the synthesis of metabolic energy as well as necessary amino acids for the synthesis of proteins and enzymes essential for the growing embryo are generally reduced due to suppression in α-amylase and protease activities.

  2. Identification and characterization of contrasting sunflower genotypes to early leaf senescence process combining molecular and physiological studies (Helianthus annuus L.).

    Science.gov (United States)

    López Gialdi, A I; Moschen, S; Villán, C S; López Fernández, M P; Maldonado, S; Paniego, N; Heinz, R A; Fernandez, P

    2016-09-01

    Leaf senescence is a complex mechanism ruled by multiple genetic and environmental variables that affect crop yields. It is the last stage in leaf development, is characterized by an active decline in photosynthetic rate, nutrients recycling and cell death. The aim of this work was to identify contrasting sunflower inbred lines differing in leaf senescence and to deepen the study of this process in sunflower. Ten sunflower genotypes, previously selected by physiological analysis from 150 inbred genotypes, were evaluated under field conditions through physiological, cytological and molecular analysis. The physiological measurement allowed the identification of two contrasting senescence inbred lines, R453 and B481-6, with an increase in yield in the senescence delayed genotype. These findings were confirmed by cytological and molecular analysis using TUNEL, genomic DNA gel electrophoresis, flow sorting and gene expression analysis by qPCR. These results allowed the selection of the two most promising contrasting genotypes, which enables future studies and the identification of new biomarkers associated to early senescence in sunflower. In addition, they allowed the tuning of cytological techniques for a non-model species and its integration with molecular variables. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  3. Sequence-Based Analysis of Structural Organization and Composition of the Cultivated Sunflower (Helianthus annuus L.) Genome

    Science.gov (United States)

    Gill, Navdeep; Buti, Matteo; Kane, Nolan; Bellec, Arnaud; Helmstetter, Nicolas; Berges, Hélène; Rieseberg, Loren H.

    2014-01-01

    Sunflower is an important oilseed crop, as well as a model system for evolutionary studies, but its 3.6 gigabase genome has proven difficult to assemble, in part because of the high repeat content of its genome. Here we report on the sequencing, assembly, and analyses of 96 randomly chosen BACs from sunflower to provide additional information on the repeat content of the sunflower genome, assess how repetitive elements in the sunflower genome are organized relative to genes, and compare the genomic distribution of these repeats to that found in other food crops and model species. We also examine the expression of transposable element-related transcripts in EST databases for sunflower to determine the representation of repeats in the transcriptome and to measure their transcriptional activity. Our data confirm previous reports in suggesting that the sunflower genome is >78% repetitive. Sunflower repeats share very little similarity to other plant repeats such as those of Arabidopsis, rice, maize and wheat; overall 28% of repeats are “novel” to sunflower. The repetitive sequences appear to be randomly distributed within the sequenced BACs. Assuming the 96 BACs are representative of the genome as a whole, then approximately 5.2% of the sunflower genome comprises non TE-related genic sequence, with an average gene density of 18kbp/gene. Expression levels of these transposable elements indicate tissue specificity and differential expression in vegetative and reproductive tissues, suggesting that expressed TEs might contribute to sunflower development. The assembled BACs will also be useful for assessing the quality of several different draft assemblies of the sunflower genome and for annotating the reference sequence. PMID:24833511

  4. Pl(17) is a novel gene independent of known downy mildew resistance genes in the cultivated sunflower (Helianthus annuus L.).

    Science.gov (United States)

    Qi, L L; Long, Y M; Jan, C C; Ma, G J; Gulya, T J

    2015-04-01

    Pl 17, a novel downy mildew resistance gene independent of known downy mildew resistance genes in sunflowers, was genetically mapped to linkage group 4 of the sunflower genome. Downy mildew (DM), caused by Plasmopara halstedii (Farl.). Berl. et de Toni, is one of the serious sunflower diseases in the world due to its high virulence and the variability of the pathogen. DM resistance in the USDA inbred line, HA 458, has been shown to be effective against all virulent races of P. halstedii currently identified in the USA. To determine the chromosomal location of this resistance, 186 F 2:3 families derived from a cross of HA 458 with HA 234 were phenotyped for their resistance to race 734 of P. halstedii. The segregation ratio of the population supported that the resistance was controlled by a single dominant gene, Pl 17. Simple sequence repeat (SSR) and single nucleotide polymorphism (SNP) primers were used to identify molecular markers linked to Pl 17. Bulked segregant analysis using 849 SSR markers located Pl 17 to linkage group (LG) 4, which is the first DM gene discovered in this linkage group. An F2 population of 186 individuals was screened with polymorphic SSR and SNP primers from LG4. Two flanking markers, SNP SFW04052 and SSR ORS963, delineated Pl 17 in an interval of 3.0 cM. The markers linked to Pl 17 were validated in a BC3 population. A search for the physical location of flanking markers in sunflower genome sequences revealed that the Pl 17 region had a recombination frequency of 0.59 Mb/cM, which was a fourfold higher recombination rate relative to the genomic average. This region can be considered amenable to molecular manipulation for further map-based cloning of Pl 17.

  5. Sunflower (Helianthus annuus) long-chain acyl-coenzyme A synthetases expressed at high levels in developing seeds.

    Science.gov (United States)

    Aznar-Moreno, Jose A; Venegas Calerón, Mónica; Martínez-Force, Enrique; Garcés, Rafael; Mullen, Robert; Gidda, Satinder K; Salas, Joaquín J

    2014-03-01

    Long chain fatty acid synthetases (LACSs) activate the fatty acid chains produced by plastidial de novo biosynthesis to generate acyl-CoA derivatives, important intermediates in lipid metabolism. Oilseeds, like sunflower, accumulate high levels of triacylglycerols (TAGs) in their seeds to nourish the embryo during germination. This requires that sunflower seed endosperm supports very active glycerolipid synthesis during development. Sunflower seed plastids produce large amounts of fatty acids, which must be activated through the action of LACSs, in order to be incorporated into TAGs. We cloned two different LACS genes from developing sunflower endosperm, HaLACS1 and HaLACS2, which displayed sequence homology with Arabidopsis LACS9 and LACS8 genes, respectively. These genes were expressed at high levels in developing seeds and exhibited distinct subcellular distributions. We generated constructs in which these proteins were fused to green fluorescent protein and performed transient expression experiments in tobacco cells. The HaLACS1 protein associated with the external envelope of tobacco chloroplasts, whereas HaLACS2 was strongly bound to the endoplasmic reticulum. Finally, both proteins were overexpressed in Escherichia coli and recovered as active enzymes in the bacterial membranes. Both enzymes displayed similar substrate specificities, with a very high preference for oleic acid and weaker activity toward stearic acid. On the basis of our findings, we discuss the role of these enzymes in sunflower oil synthesis. © 2013 Scandinavian Plant Physiology Society.

  6. Root colonization and growth promotion of sunflower (Helianthus annuus L.) by phosphate solubilizing Enterobacter sp. Fs-11

    NARCIS (Netherlands)

    Shahid, Muhammad; Hameed, Sohail; Imran, Asma; Ali, Saira; van Elsas, Jan Dirk

    An Enterobacter sp. Fs-11 was isolated from sunflower rhizosphere, identified on the basis of 16S rRNA gene sequence analysis (GeneBank accession no. GQ179978) and studied for its root colonization and growth promotion ability in sunflower. Morphologically, it was rod shaped Gram-negative, motile

  7. Selection on crop-derived traits and QTL in sunflower (Helianthus annuus) crop-wild hybrids under water stress.

    Science.gov (United States)

    Owart, Birkin R; Corbi, Jonathan; Burke, John M; Dechaine, Jennifer M

    2014-01-01

    Locally relevant conditions, such as water stress in irrigated agricultural regions, should be considered when assessing the risk of crop allele introgression into wild populations following hybridization. Although research in cultivars has suggested that domestication traits may reduce fecundity under water stress as compared to wild-like phenotypes, this has not been investigated in crop-wild hybrids. In this study, we examine phenotypic selection acting on, as well as the genetic architecture of vegetative, reproductive, and physiological characteristics in an experimental population of sunflower crop-wild hybrids grown under wild-like low water conditions. Crop-derived petiole length and head diameter were favored in low and control water environments. The direction of selection differed between environments for leaf size and leaf pressure potential. Interestingly, the additive effect of the crop-derived allele was in the direction favored by selection for approximately half the QTL detected in the low water environment. Selection favoring crop-derived traits and alleles in the low water environment suggests that a subset of these alleles would be likely to spread into wild populations under water stress. Furthermore, differences in selection between environments support the view that risk assessments should be conducted under multiple locally relevant conditions.

  8. Impact of extraneous proteins on the gastrointestinal fate of sunflower seed (Helianthus annuus) oil bodies: a simulated gastrointestinal tract study.

    Science.gov (United States)

    Makkhun, Sakunkhun; Khosla, Amit; Foster, Tim; McClements, David Julian; Grundy, Myriam M L; Gray, David A

    2015-01-01

    In this study, we examined the physicochemical nature of sunflower seed oil bodies (in the absence and presence of added protein) exposed to gastrointestinal conditions in vitro: crude oil bodies (COB); washed oil bodies (WOB); whey protein isolate-enriched oil bodies (WOB-WPI); and, sodium caseinate enriched-oil bodies (WOB-SC). All oil body emulsions were passed through an in vitro digestion model that mimicked the stomach and duodenal environments, and their physicochemical properties were measured before, during, and after digestion. Oil bodies had a positive charge under gastric conditions because the pH was below the isoelectric point of the adsorbed protein layer, but they had a negative charge under duodenal conditions which was attributed to changes in interfacial composition resulting from adsorption of bile salts. Oil bodies were highly susceptible to flocculation and coalescence in both gastric and duodenal conditions. SDS-PAGE analysis indicated degradation of oleosin proteins (ca. 18-21 kDa) to a greater or lesser extent (dependent on the emulsion) during the gastric phase in all emulsions tested; there is evidence that some oleosin remained intact in the crude oil body preparation during this phase of the digestion process. Measurements of protein displacement from the surface of COBs during direct exposure to bile salts, without inclusion of a gastric phase, indicated the removal of intact oleosin from native oil bodies.

  9. Identification of differentially expressed genes in sunflower (Helianthus annuus) leaves and roots under drought stress by RNA sequencing.

    Science.gov (United States)

    Liang, Chunbo; Wang, Wenjun; Wang, Jing; Ma, Jun; Li, Cen; Zhou, Fei; Zhang, Shuquan; Yu, Ying; Zhang, Liguo; Li, Weizhong; Huang, Xutang

    2017-10-25

    Sunflower is recognized as one of the most important oil plants with strong tolerance to drought in the world. In order to study the response mechanisms of sunflower plants to drought stress, gene expression profiling using high throughput sequencing was performed for seedling leaves and roots (sunflower inbred line R5) after 24 h of drought stress (15% PEG 6000). The transcriptome assembled using sequences of 12 samples was used as a reference. 805 and 198 genes were identified that were differentially expressed in leaves and roots, respectively. Another 71 genes were differentially expressed in both organs, in which more genes were up-regulated than down-regulated. In agreement with results obtained for other crops or from previous sunflower studies, we also observed that nine genes may be associated with the response of sunflower to drought. The results of this study may provide new information regarding the sunflower drought response, as well as add to the number of known genes associated with drought tolerance.

  10. Search for Allergens from the Pollen Proteome of Sunflower (Helianthus annuus L.): A Major Sensitizer for Respiratory Allergy Patients.

    Science.gov (United States)

    Ghosh, Nandini; Sircar, Gaurab; Saha, Bodhisattwa; Pandey, Naren; Gupta Bhattacharya, Swati

    2015-01-01

    Respiratory allergy triggered by pollen allergens is increasing at an alarming rate worldwide. Sunflower pollen is thought to be an important source of inhalant allergens. Present study aims to identify the prevalence of sunflower pollinosis among the Indian allergic population and characterizes the pollen allergens using immuno-proteomic tools. Clinico-immunological tests were performed to understand the prevalence of sensitivity towards sunflower pollen among the atopic population. Sera from selected sunflower positive patients were used as probe to detect the IgE-reactive proteins from the one and two dimensional electrophoretic separated proteome of sunflower pollen. The antigenic nature of the sugar moiety of the glycoallergens was studied by meta-periodate modification of IgE-immunoblot. Finally, these allergens were identified by mass-spectrometry. Prevalence of sunflower pollen sensitization was observed among 21% of the pollen allergic population and associated with elevated level of specific IgE and histamine in the sera of these patients. Immunoscreening of sunflower pollen proteome with patient sera detected seven IgE-reactive proteins with varying molecular weight and pI. Hierarchical clustering of 2D-immunoblot data highlighted three allergens characterized by a more frequent immuno-reactivity and increased levels of IgE antibodies in the sera of susceptible patients. These allergens were considered as the major allergens of sunflower pollen and were found to have their glycan moiety critical for inducing IgE response. Homology driven search of MS/MS data of these IgE-reactive proteins identified seven previously unreported allergens from sunflower pollen. Three major allergenic proteins were identified as two pectate lyases and a cysteine protease. Novelty of the present report is the identification of a panel of seven sunflower pollen allergens for the first time at immuno-biochemical and proteomic level, which substantiated the clinical evidence of sunflower allergy. Further purification and recombinant expression of these allergens will improve component-resolved diagnosis and therapy of pollen allergy.

  11. Antimony (SbIII) reduces growth, declines photosynthesis, and modifies leaf tissue anatomy in sunflower (Helianthus annuus L.).

    Science.gov (United States)

    Vaculík, Marek; Mrázová, Anna; Lux, Alexander

    2015-12-01

    The role of antimony (Sb)--a non-essential trace metalloid--in physiological processes running in crops is still poorly understood. Present paper describes the effect of Sb tartrate (SbIII) on growth, Sb uptake, photosynthesis, photosynthetic pigments, and leaf tissue organization in young sunflower plants grown in hydroponics. We found that growth of below- and aboveground part was reduced with increasing concentration of Sb in the medium. Although Sb was mostly taken up by sunflower roots and only small part (1-2%) was translocated to the shoots, decline in photosynthesis, transpiration, and decreased content of photosynthetic pigments were observed. This indicates that despite relatively low mobility of Sb in root-shoot system, Sb in shoot noticeably modifies physiological status and reduced plant growth. Additionally, leaf anatomical changes indicated that Sb reduced the size of intercellular spaces and made leaf tissue more compact.

  12. Integration of transcriptomic and metabolic data reveals hub transcription factors involved in drought stress response in sunflower (Helianthus annuus L.).

    Science.gov (United States)

    Moschen, Sebastián; Di Rienzo, Julio A; Higgins, Janet; Tohge, Takayuki; Watanabe, Mutsumi; González, Sergio; Rivarola, Máximo; García-García, Francisco; Dopazo, Joaquin; Hopp, H Esteban; Hoefgen, Rainer; Fernie, Alisdair R; Paniego, Norma; Fernández, Paula; Heinz, Ruth A

    2017-07-01

    By integration of transcriptional and metabolic profiles we identified pathways and hubs transcription factors regulated during drought conditions in sunflower, useful for applications in molecular and/or biotechnological breeding. Drought is one of the most important environmental stresses that effects crop productivity in many agricultural regions. Sunflower is tolerant to drought conditions but the mechanisms involved in this tolerance remain unclear at the molecular level. The aim of this study was to characterize and integrate transcriptional and metabolic pathways related to drought stress in sunflower plants, by using a system biology approach. Our results showed a delay in plant senescence with an increase in the expression level of photosynthesis related genes as well as higher levels of sugars, osmoprotectant amino acids and ionic nutrients under drought conditions. In addition, we identified transcription factors that were upregulated during drought conditions and that may act as hubs in the transcriptional network. Many of these transcription factors belong to families implicated in the drought response in model species. The integration of transcriptomic and metabolomic data in this study, together with physiological measurements, has improved our understanding of the biological responses during droughts and contributes to elucidate the molecular mechanisms involved under this environmental condition. These findings will provide useful biotechnological tools to improve stress tolerance while maintaining crop yield under restricted water availability.

  13. Enhanced accumulation of copper and lead in amaranth (Amaranthus paniculatus, Indian mustard (Brassica juncea and sunflower (Helianthus annuus.

    Directory of Open Access Journals (Sweden)

    Motior M Rahman

    Full Text Available BACKGROUND: Soil contamination by copper (Cu and lead (Pb is a widespread environmental problem. For phytoextraction to be successful and viable in environmental remediation, strategies that can improve plant uptake must be identified. In the present study we investigated the use of nitrogen (N fertilizer as an efficient way to enhance accumulation of Cu and Pb from contaminated industrial soils into amaranth, Indian mustard and sunflower. METHODS/PRINCIPAL FINDINGS: Plants were grown in a greenhouse and fertilized with N fertilizer at rates of 0, 190 and 380 mg kg⁻¹ soil. Shoots, roots and total accumulation of Cu and Pb, transfer factor (TF, translocation index were assessed to evaluate the transport and translocation ability of tested plants. Addition of N fertilizer acidified the industrial soil and caused the pH to decrease to 5.5 from an initial pH of 6.9. Industrial soil amended with N fertilizer resulted in the highest accumulation of Pb and Cu (for Pb 10.1-15.5 mg kg⁻¹, for Cu 11.6-16.8 mg kg⁻¹ in the shoots, which was two to four folds higher relative to the concentration in roots in all the three plants used. Sunflower removed significantly higher Pb (50-54% and Cu (34-38% followed by amaranth and Indian mustard from industrial soils with the application of N fertilizer. The TF was <1 while the shoot and root concentration (SC/RC ratios of Pb and Cu were between 1.3-4.3 and 1.8-3.8, respectively, regardless of plant species. CONCLUSIONS: Sunflower is the best plant species to carry out phytoextraction of Pb and Cu. In contrast, Pb and Cu removal by Indian mustard and amaranth shows great potential as quick and short duration vegetable crops. The results suggest that the application of N fertilizer in contaminated industrial soil is an effective amendment for the phytoextraction of Pb and Cu from contaminated industrial soils.

  14. Effects of supplement with sanitary landfill leachate in gas exchange of sunflower (Helianthus annuus L.) seedlings under drought stress.

    Science.gov (United States)

    Nunes Junior, Francisco H; Freitas, Valdineia S; Mesquita, Rosilene O; Braga, Brennda B; Barbosa, Rifandreo M; Martins, Kaio; Gondim, Franklin A

    2017-10-01

    Sanitary landfill leachate is one of the major problems arising from disposal of urban waste. Sanitary landfill leachate may, however, have use in agriculture. This study, therefore, aimed to analyze initial plant growth and gas exchange in sunflower seedlings supplemented with sanitary landfill leachate and subjected to drought stress through variables of root fresh mass (RFM), shoot fresh mass (SFM), total fresh mass (TFM), relative chlorophyll content (CL), stomatal conductance (g s ), transpiration rate (E), net photosynthetic rate (A), ratio of internal to external CO 2 concentration (Ci/Ca),water use efficiency (EUA), instantaneous carboxylation efficiency (A/Ci), and electron transport rate (ETR). The experimental design was a completely randomized 2 (irrigated and non-irrigated) × 4 (sand, sand + 100 kg N ha -1 organic fertilizer, sand + 100 kg N ha -1 sanitary landfill leachate, and sand + 150 kg N ha -1 sanitary landfill leachate) factorial with five replicates. Under drought stress conditions, leachate treatment supplemented with 100 kg N ha -1 exhibited higher plant fresh weights than those of the treatment containing 150 kg N ha -1 . Increases in fresh mass in plant treatments supplemented with 100 and 150 kg N ha -1 sanitary landfill leachate were related to higher photosynthetic rates.

  15. Marcha de absorção de macronutrientes na cultura do girassol Macronutrient uptake of sunflower (Helianthus annuus L.

    Directory of Open Access Journals (Sweden)

    Luiz Henrique Saes Zobiole

    2010-04-01

    Full Text Available Este trabalho teve como objetivo estabelecer curvas de acúmulo de macronutrientes na cultura do girassol. Para isso, foi instalado um experimento em campo sobre Latossolo Vermelho distroférrico de textura muito argilosa, localizado na fazenda experimental da Embrapa Soja, em Londrina/PR. As parcelas foram constituídas de 14 linhas com 25 m de comprimento cada e espaçamento entrelinhas de 0,70 m, resultando em área total de 245 m². Cada parcela foi repetida quatro vezes. A adubação de semeadura foi de 300 kg ha-1 da fórmula 5-20-20, aplicada a lanço, antes do plantio. A adubação de cobertura foi parcelada em duas aplicações: 25 e 1 kg ha-1 de N e B, respectivamente, sendo a primeira aos 21 e a segunda aos 35 dias após a semeadura. O híbrido utilizado foi o BRS-191, e a densidade final de plantas foi de 40.000 plantas ha-1. Amostras de plantas foram coletadas em intervalos de 14 dias após a emergência e separadas em pecíolos, folhas, caules e, quando existentes, em capítulo e em aquênios. Após secagem, cada parte da planta foi pesada e moída para, em seguida, determinarem-se os teores de N, P, K, Ca, Mg e S. A partir desses nutrientes e da matéria seca de cada parte da planta, foram obtidas as curvas de acúmulo. Verificou-se que, para obtenção de produtividades superiores a 3.000 kg ha-1, o híbrido BRS 191 extrai aproximadamente 150, 24, 286, 116, 42 e 24 kg ha-1 de N, P, K, Ca, Mg e S, respectivamente, resultando na seguinte ordem de extração: K > N > Ca > Mg > P = S. Em relação à exportação, a ordem dos nutrientes foi a seguinte: N > P = K > Mg = S > Ca. Portanto, atenção especial deve ser dada à manutenção da adequada disponibilidade de N, K e Ca, devido à alta demanda da cultura por esses nutrientes.This study aimed to establish curves of macronutrient accumulation in sunflower. The experiment was conducted in the field on a Typic Hapludox, at the experimental station of Embrapa Soja in Londrina, State of Paraná. The plots consisted of 14 25 m long rows spaced 0.70 m apart, resulting in a total area of 245 m², with four replications. Prior to sowing a fertilization seeding of 300 kg ha-1 of 05-20-20 NPK fertilizer was applied. Fertilization was split in two applications of 25 + 1 kg ha-1 N and B, which were applied 21 and 35 days after sowing, respectively. The hybrid BRS 191 and a final plant density of 40,000 plants ha-1 were used. Plant samples were collected every two weeks after emergence and separated in the different parts (petioles, leaves, stems and, when applicable, capitula and achenes. After drying, each plant part was weighed and ground to determine the N, P, K, Ca, Mg, and S content. From the contents of these nutrients and dry mass of each plant, the accumulation curve was obtained. It was found that for yields > 3,000 kg ha-1, BRS 191 extracted about 150, 24, 286, 116, 42, and 24 kg ha-1 of N, P, K, Ca, Mg, and S, respectively, in the following order of extraction: K> N> Ca> P = S. In addition to the relation to exportation, the nutrient order was: N> P = K> S = Mg> Ca. Therefore, special attention should be paid to the maintenance of an adequate supply of N, K and Ca, due to the high demand of sunflower.

  16. TILLAGE EFFECTS ON SUNFLOWER (HELIANTHUS ANNUUS, L. EMERGENCE, YIELD, QUALITY, AND FUEL CONSUMPTION IN DOUBLE CROPPING SYSTEM

    Directory of Open Access Journals (Sweden)

    ABDULLAH SESSIZ

    2009-06-01

    Full Text Available The relation between crop growing and soil tillage treatment are play important role in agricultural production. Soils under conventional tillage (CT generally have lower bulk density and associated higher total porosity within the plough layer than under no tillage (NT. No-till farming can reduce soil erosion, conserve soil moisture and minimize labor and fuel consumption. The aim of this study were to investigate the effects of conventional, reduced and notillage methods on soil physical properties, sunfl ower yield and yield components, protein and oil content and fuel consumption in Southeastern of Turkey. Six tillage methods for the second crop sunfl ower were tested and compared each other within after lentil harvesting at 2003 and 2004 years in a clay loam soil. According to results, the fi rst year, the bulk density had decreased from 1.29 to 1.09 g cm-3, the second year the δb had decreased from 1.41 to 1.23 g cm-3. Differences between years and tillage methods in terms of yield were found signifi cant (p<0.05. However, no differences were found between the NT and CT. There were also no signifi cance differences in content of protein, oil and ash among six tillage methods. The highest fuel consumption was measured in conventional method (CT whereas the lowest value was found in direct seeding method as 33.48 L ha-1 and 6.6 L ha-1, respectively.

  17. Detection of herbicide effects on pigment composition and PSII photochemistry in Helianthus annuus by Raman spectroscopy and chlorophyll a fluorescence

    Czech Academy of Sciences Publication Activity Database

    Vítek, Petr; Novotná, Kateřina; Hodaňová, Petra; Rapantová, Barbora; Klem, Karel

    2017-01-01

    Roč. 170, Jan (2017), s. 234-241 ISSN 1386-1425 R&D Projects: GA MŠk(CZ) LO1415; GA MZe QJ1530373 Institutional support: RVO:67179843 Keywords : Raman mapping * Chlorophyll fluorescence * Carotenoids * Flavonoids * Photosynthesis * Secondary metabolites Subject RIV: EH - Ecology, Behaviour OBOR OECD: Environmental sciences (social aspects to be 5.7) Impact factor: 2.536, year: 2016

  18. AUMENTO NA PRODUÇÃO DE SEMENTES DE GIRASSOL (Helianthus annuus PELA AÇÃO DE INSETOS POLINIZADORES

    Directory of Open Access Journals (Sweden)

    A.C. de C.C. MORETI

    1996-05-01

    Full Text Available Foram realizados dois ensaios nos quais compararam-se plantas de girassol, do cultivar Anhandy, livremente visitadas por insetos(testemunhas e outras impedidas de visitação por dois métodos (cobertura de plantas com gaiolas teladas, de 3m de largura, 4m de comprimento e 2m de altura, e ensacamento de capítulos com filó. O número, o peso e a porcentagem de sementes granadas foram significativamente maiores (PSunflower plants, cv Anhandy, freely visited by insects (control were compared to plants protected from insects. Two flower isolation methods were used: covering the plants with net cages (width 3m, lenght 4m, height 2m and bagging the flowers with gauze. The number, the weight and the percentage of seed setting were significantly higher (P<0.05 in the visited plants (579.28; 41.17g and 82.37%; 456.97; 23.44g 79.70%, in two trials than in plants protected by cages (81.53; 2.23g and 1.16% in the first trial and 111.92; 3.16g e 28.49%, in the second. The number and the weight of no seed settings were significantly higher (P<0.05 in the plants covered with cages (416.29 and 6.58g; 375.25 and 5.04g in two trials than in the control (142.69 and 1.71g; 182.38 and 2.53g. The percentage of seed setting in the bagged flowers with gauze was intermediate to the control plants and the covered plants. (64.56% in the first trial and 68.61%, in the second. It is concluded that the sunflower, cv Anhandy, presents a significant increase of seed production due to visits of pollinating insects, mainly honey bees. Cage is the most indicated method to protect plants from pollinating insects.

  19. Efecto de la inclusión de semillas de girasol entera y reconstituida en raciones de pollos broiler

    OpenAIRE

    Arija, I.; Viveros, Agustín; Brenes, Agustín; Canales, R

    2000-01-01

    Se ha realizado un experimento para comparar el valor nutritivo de la semilla de girasol entera (SGE) respecto a su correspondiente semilla reconstituida con aceite extraído por presión (SGRP) y por solvente (SGRR), en raciones de pollos de aptitud cárnica a los 21 y 28 días de edad. Para ello se utilizaron un total de 224 aves de un día de edad a las cuales se les administraron cuatro raciones experimentales isocalóricas e isoproteicas formuladas de la siguiente manera: 1) ración control tri...

  20. Fine mapping of the sunflower resistance locus Pl(ARG) introduced from the wild species Helianthus argophyllus.

    Science.gov (United States)

    Wieckhorst, S; Bachlava, E; Dussle, C M; Tang, S; Gao, W; Saski, C; Knapp, S J; Schön, C-C; Hahn, V; Bauer, E

    2010-11-01

    Downy mildew, caused by Plasmopara halstedii, is one of the most destructive diseases in cultivated sunflower (Helianthus annuus L.). The dominant resistance locus Pl(ARG) originates from silverleaf sunflower (H. argophyllus Torrey and Gray) and confers resistance to all known races of P. halstedii. We mapped Pl(ARG) on linkage group (LG) 1 of (cms)HA342 × ARG1575-2, a population consisting of 2,145 F(2) individuals. Further, we identified resistance gene candidates (RGCs) that cosegregated with Pl(ARG) as well as closely linked flanking markers. Markers from the target region were mapped with higher resolution in NDBLOS(sel) × KWS04, a population consisting of 2,780 F(2) individuals that does not segregate for Pl(ARG). A large-insert sunflower bacterial artificial chromosome (BAC) library was screened with overgo probes designed for markers RGC52 and RGC151, which cosegregated with Pl(ARG). Two RGC-containing BAC contigs were anchored to the Pl(ARG) region on LG 1.

  1. Modelled hydraulic redistribution by sunflower (Helianthus annuus L.) matches observed data only after including night-time transpiration.

    Science.gov (United States)

    Neumann, Rebecca B; Cardon, Zoe G; Teshera-Levye, Jennifer; Rockwell, Fulton E; Zwieniecki, Maciej A; Holbrook, N Michele

    2014-04-01

    The movement of water from moist to dry soil layers through the root systems of plants, referred to as hydraulic redistribution (HR), occurs throughout the world and is thought to influence carbon and water budgets and ecosystem functioning. The realized hydrologic, biogeochemical and ecological consequences of HR depend on the amount of redistributed water, whereas the ability to assess these impacts requires models that correctly capture HR magnitude and timing. Using several soil types and two ecotypes of sunflower (Helianthus annuus L.) in split-pot experiments, we examined how well the widely used HR modelling formulation developed by Ryel et al. matched experimental determination of HR across a range of water potential driving gradients. H. annuus carries out extensive night-time transpiration, and although over the last decade it has become more widely recognized that night-time transpiration occurs in multiple species and many ecosystems, the original Ryel et al. formulation does not include the effect of night-time transpiration on HR. We developed and added a representation of night-time transpiration into the formulation, and only then was the model able to capture the dynamics and magnitude of HR we observed as soils dried and night-time stomatal behaviour changed, both influencing HR. © 2013 John Wiley & Sons Ltd.

  2. Fine mapping of the sunflower resistance locus PlARG introduced from the wild species Helianthus argophyllus

    Science.gov (United States)

    Wieckhorst, S.; Bachlava, E.; Dußle, C. M.; Tang, S.; Gao, W.; Saski, C.; Knapp, S. J.; Schön, C.-C.; Hahn, V.

    2010-01-01

    Downy mildew, caused by Plasmopara halstedii, is one of the most destructive diseases in cultivated sunflower (Helianthus annuus L.). The dominant resistance locus PlARG originates from silverleaf sunflower (H. argophyllus Torrey and Gray) and confers resistance to all known races of P. halstedii. We mapped PlARG on linkage group (LG) 1 of (cms)HA342 × ARG1575-2, a population consisting of 2,145 F2 individuals. Further, we identified resistance gene candidates (RGCs) that cosegregated with PlARG as well as closely linked flanking markers. Markers from the target region were mapped with higher resolution in NDBLOSsel × KWS04, a population consisting of 2,780 F2 individuals that does not segregate for PlARG. A large-insert sunflower bacterial artificial chromosome (BAC) library was screened with overgo probes designed for markers RGC52 and RGC151, which cosegregated with PlARG. Two RGC-containing BAC contigs were anchored to the PlARG region on LG 1. Electronic supplementary material The online version of this article (doi:10.1007/s00122-010-1416-4) contains supplementary material, which is available to authorized users. PMID:20700574

  3. Sunflower/Girasol: Spanish/English Elementary School Science Activity Curriculum. Evaluation of the Educational Efficacy of the Plant and Water Units.

    Science.gov (United States)

    Intercultural Center for Research in Education, Arlington, MA.

    The Sunflower/Girasol program is a Spanish/English bilingual science discovery program for Hispanic children in grades 2-6, designed to improve science instruction and educational opportunity for this group. The report describes the program's proposed activities and products, progress to date, and results of an evaluation of the first two units of…

  4. Alteración termoxidativa en un aceite de girasol utilizado en 75 frituras de patatas

    Directory of Open Access Journals (Sweden)

    Cuesta, O.

    1993-10-01

    Full Text Available The alteration of a sunflower oil used in 75 repeated deep fat frying of potatoes performed with addition of unused oil every 4-5 fryings with the aim to keep constant the proportion food/oil in 500 g / 3 liters, was evaluated by column and high performance size exclusion chromatographies. The polar components increased from 5.09 ± 0.21 (unused oil to 19.11 ± 0,40 mg/100 mg oil mainly due to the formation of polymers and dimers of triacylglycerides, and to oxidized triacylglycerides. Oils, unused and from the 75 frying, were included at a rate of 15% on rat-diets. Dietary food intakes were similar, however body weight gain was a 22.3% lower in rat fed with the used oil-diet. Apparent digestibility ratios of fat and protein were similar in both groups of rats, however both. Alimentary and Protein Efficiency ratios decreased on the 75 frying oil fed rats.

    Se evalúa la alteración de un aceite de girasol utilizado en 75 frituras repetidas de patatas, efectuadas con adición de aceite sin usar cada 4-5 frituras con la finalidad de mantener constante la proporción alimento/aceite en 500 g / 3 litros, mediante cromatografías en columna y de alta eficacia por exclusión de tamaño de partícula. El contenido de los compuestos polares se incrementó de 5.09 ± 0.21 (aceite sin usar a 19.11 ± 0.40 mg/100 mg de aceite, predominando los polímeros y dímeros de triacilglicéridos y los triacilglicéridos oxidados. Dichos aceites, sin usar y utilizado en 75 frituras, se incluyeron en la proporción del 15% en las dietas del lote basal y del lote fritura 75, respectivamente. La ingesta de ambas dietas fue similar, pero la ganancia de peso resultó ser un 22,3% menor en el lote fritura 75. Los coeficientes de digestibilidad aparente de grasa y proteína fueron similares en ambos lotes, pero la utilización nutritiva en términos de coeficientes de Eficacia Alimentaria y Proteica fue menor en el lote fritura 75.

  5. Digestibilidad in vitro de dietas energéticas para ovinos con inclusión de semilla de girasol.

    OpenAIRE

    Herrera Pérez, Jerónimo

    2013-01-01

    Cinco dietas integrales isoenergéticas e isoprotéicas fueron evaluadas con el objetivo de medir la producción de gas in vitro y asociarla con la digestibilidad de la materia seca en dietas para corderos elaboradas con 0, 3, 6, 9 y 12 % de inclusión de semilla de girasol. Se midió la producción de gas in vitro (PGSIV) (volumen máximo de gas (Vmax; mL g-1) para materia seca (MS), materia orgánica (MO) y materia seca degradada (MSD), la digestibilidad in vitro de la MS (DIVMS), y producción de á...

  6. Karyological investigations on Erigeron canadensis L. and E. annuus (L. Pers. from natural stands in Poland

    Directory of Open Access Journals (Sweden)

    K. Bijok

    2015-01-01

    Full Text Available The number of chromosomes in metaphases root meristems of Erigeron canadensis L. (2n= 18 and E. annuus (L. Pers. (2n=27 was determined. The chromosomes of both species showed a morphological differentiation - they were heterobrachial or isobrachial; E. annuus had an additional unpaired isobrachial chromosome.

  7. Broomrape (Orobanche cumana Wallr.) resistance breeding utilizing wild Helianthus species

    Science.gov (United States)

    Wild Helianthus species possess valuable resistance genes for sunflower broomrape (Orobanche cumana Wallr.), especially the 39 largely under-utilized perennial species. Resistance to race F has been transferred into cultivated background via bridging of interspecific amphiploids. More recently, a si...

  8. Utilización de freidora doméstica entre universitarios madrileños. Aceptación de alimentos congelados fritos en aceite de oliva virgen extra, girasol y girasol alto oleico

    Directory of Open Access Journals (Sweden)

    Sánchez-Muniz, F. J.

    2001-02-01

    replenishment with unused oil.La finalidad del estudio fue obtener información sobre el uso de freidoras domésticas, tipo de aceite utilizado para freír, alimentos que se fríen y número de frituras tras el que se elimina el aceite. Para ello se realizó una encuesta preliminar en 50 personas pertenecientes a la Universidad Complutense de Madrid para conocer qué tipo de aceite y qué alimentos se emplean en fritura doméstica. Ninguna de ellas usaba un aceite diferente del de oliva o girasol. Con estos datos se realizó otra encuesta entre 250 universitarios en cuyos hogares se empleaba freidora acerca del aceite empleado, los alimentos que se fríen más habitualmente y el número de fritura tras el que se desecha el aceite usado. Los resultados señalan que en los hogares de estos universitarios, el aceite más utilizado para freír es el de oliva. La mayoría de ellos usa el aceite de 11 a 20 veces y aproximadamente la mitad de los encuestados fríen sólo un tipo de alimento en el mismo aceite. Los alimentos que se fríen con más frecuencia en sartén eran las patatas, las patatas prefritas congeladas y el pescado, observándose una preferencia al uso de la sartén respecto al de la freidora para los alimentos frescos, mientras que no había preferencias respecto a los precocinados. Teniendo en cuenta los resultados de la segunda encuesta se realizaron un total de 20 frituras de alimentos congelados en freidoras domésticas en aceite de oliva virgen extra, girasol y girasol con alto contenido en ácido oleico. Las croquetas fritas se valoraron mediante cata, realizándose pruebas triangulares de identificación y de puntuación con la finalidad de estudiar el efecto del aceite empleado en su fritura. También se evaluó la calidad organoléptica global de las croquetas fritas en función de la modalidad de fritura (con o sin adición de aceite sin usar y del tipo de aceite. La aceptación de las croquetas fue bastante buena, con una puntuación de 6,8 sobre una escala

  9. El soldado/poeta, el miedo, la derrota: una lectura de Segunda Derrota: 1940, de Los Girasoles Ciegos

    Directory of Open Access Journals (Sweden)

    Magnólia Brasil Barbosa do Nascimento

    2016-07-01

    Full Text Available Se propone en este artículo una reflexión sobre los duros años de la inmediata posguerra civil española, privilegiando la “Segunda Derrota: 1940 o Manuscrito encontrado en el olvido”, uno de los cuentos de Los girasoles ciegos (2004, de Alberto Méndez (1941-2004, quien escribe para grabar la memoria del miedo vigente en aquel momento histórico. Por la importancia de la apropiación del pasado (Benjamin, se optó por acompañar las vicisitudes de un joven soldado/poeta que busca escapar hacia Francia con la novia embarazada y es sorprendido por la muerte de la joven durante el parto. En la obra, es fuerte el poder de la palabra (Agamben, 2008. El escritor tematiza la crueldad que interrumpió, de manera violenta, muchas vidas. En “Segunda Derrota”, se evidencia la importancia de la manutención de la memoria para que esas infames sombras no se pierdan en los silencios, y luego no caigan en el olvido.

  10. Triploid production from interspecific crosses of two diploid perennial Helianthus with cultivated sunflower

    Science.gov (United States)

    Wild Helianthus species are a valuable genetic source for the improvement of cultivated sunflower. We report the discovery and characterization of a unique high frequency production of triploids when cultivated sunflower was pollinated by specific accessions of diploid Helianthus nuttallii T. &. G. ...

  11. Genotypic diversity and clonal structure of Erigeron annuus (Asteraceae in Lithuania

    Directory of Open Access Journals (Sweden)

    Tunaitienė, Virginija

    2014-02-01

    Full Text Available This study was conducted to assess the clonal structure and genetic diversity of alien herbaceous plant species Erigeron annuus. The global warming and changes in agriculture practice in the past few decades were favourable for the expansion of this species in Lithuania. We used RAPD and ISSR assays to assess genetic variation within and among 29 populations of E. annuus. A total of 278 molecular markers were revealed. Our study detected reduced level of genetic diversity of invasive populations of E. annuus. Significant differences in DNA polymorphism among populations of E. annuus were also found. Some populations of this species are composed of genetically identical plants, while others were polymorphic. Clonal diversity of study populations ranged from 0.083 to 0.4 for both DNA marker systems. The Simpsons diversity index values ranged from 0.0 to 0.636. The average number of genotypes per population established using both assays was about 1.7. Out of 328 E. annuus individuals only 16 showed unique RAPD and 14 unique ISSR banding patterns. The remaining plants were clones of different size. The most common genotype of E. annuus identified in our study was represented by predominate in nine populations.

  12. Nuevas estrategias para la transformación y expresión de genes de interés en girasol

    OpenAIRE

    Radonic, Laura Mabel

    2010-01-01

    El girasol es una especie de la familia Asteraceae (Compositae) de gran importancia económica, considerada hasta hace una década recalcitrante al cultivo in vitro y la transformación genética. En un trabajo previo (Radonic, 2005) se logró establecer el protocolo de selección por enraizamiento en kanamicina con una eficiencia del 0,7 %. En esta tesis se mejoró este protocolo utilizando una construcción portadora de los genes antifúngicos glucanasa y quitinasa, ambos bajo el control del promoto...

  13. Gene transfer from wild Helianthus to sunflower: topicalities and limits

    Directory of Open Access Journals (Sweden)

    Breton Catherine

    2010-03-01

    Full Text Available Sunflower (2n=17 belongs to the Helianthus genus (Asteraceae. Wild Helianthus species display morphological variation for branching and stem number, for architecture and seed size, and for resistance to abiotic and biotic stresses due to which they thrive in different environments in North America. The genus is divided into botanical sections, two for annual as sunflower, and two for perennial species as Jerusalem artichoke that produces rhizomes (tubers. We explain the difficulties and successes obtained by crossing sunflower with these species to improve the agronomic traits of the sunflower crop. It is easier to cross the annual species than the perennials’ with sunflower. Several traits such as Cytoplasmic male sterility and restorer Rf-PET1 genes, Downy mildew resistance, Phomopsis resistance, Sclerotinia resistance, Rust resistance, and Orobanche resistance have already been introduced from annual species into sunflower crop, but the complex genomic organization of these species compared to sunflower limits their important potential. Perennial species are much more diverse, and their genomes display 2n, 4n, or 6n chromosomes for n 17. The realities of inter-specific hybridization are relatively disappointing due to the introgression lines that have low oil and low seed yield. We report here several attempts to introgress agronomic traits from these species to sunflower, and we present as a case study, an introgressed progenies from H. mollis, a diploid species with sessile small leaves. We constructed a preliminary genetic map with AFLP markers in 21 BC1 plants, and we then showed that some progenies display 6 to 44% of introgression from H. mollis. Although this study is promising due to the novel compact architecture of the progenies, we cannot estimate the transferability from H. mollis to other perennial Helianthus to improve sunflower.

  14. Aplicación de subproductos de chía (Salvia hispanica L.) y girasol (Helianthus annuss L.) en alimentos

    OpenAIRE

    Guiotto, Estefanía Nancy

    2014-01-01

    Recientemente, la semilla de chía (Salvia hispanica L.) ha sido redescubierta como una importante fuente de ácidos grasos omega-3, proteínas, fibra dietética y antioxidantes, a partir de la cual puede obtenerse aceite con una elevada proporción de ácidos grasos esenciales. Su incorporación en la dieta permite disminuir la incidencia de enfermedades coronarias, refuerza el sistema nervioso; la fibra dietaria es una valiosa alternativa para regular el tránsito intestinal, lo cual ayuda a preven...

  15. Economically Viable Components from Jerusalem Artichoke (Helianthus tuberosus L.) in a Biorefinery Concept

    DEFF Research Database (Denmark)

    Johansson, Eva; Prade, Thomas; Angelidaki, Irini

    2015-01-01

    Biorefinery applications are receiving growing interest due to climatic and waste disposal issues and lack of petroleum resources. Jerusalem artichoke (Helianthus tuberosus L.) is suitable for biorefinery applications due to high biomass production and limited cultivation requirements. This paper...

  16. Ceba a corral de vaquillas con ramas de eucaliptus, henos, grano de maíz y harina de girasol

    Directory of Open Access Journals (Sweden)

    A. E. Fernández

    2012-01-01

    Full Text Available Este trabajo se diseñó para evaluar dietas ante sequías, inundaciones u otras emergencias, se estudió la respuesta productiva y económica de doce vaquillas Angus en crecimiento, encerradas en un corral. Se establecieron tres tratamientos con dos repeticiones, bajo un diseño completamente aleatorizado y se replicaron en dos etapas: la primera, en el verano de 2007 y la segunda en el invierno de 2008. Las dietas estuvieron compuestas por: ramas de eucaliptus frescas (re a voluntad, heno de mijo (hm (1ª. etapa y de centeno (hc (2ª. etapa y un concentrado energético-proteico (c similar en ambas etapas y común a los tres tratamientos, compuesto por 1.6 kg ms grano de maíz (seco y molido cabeza.-1 día-1 y 0.9 kg ms harina de girasol, cabeza-1 día-1. T1: C + hm o hc a voluntad; T2: C + 3.5 kg tal cual de hm o hc + re a voluntad; T3: C + re a voluntad. La primera y segunda etapas duraron 61 y 62 días, respectivamente. Se midieron: el consumo de ms eucaliptus y henos (cms, eficiencia de conversión (efc, ganancias diarias de peso (gdp y el costo de producción de cada tratamiento (cp. Las efc, medios, fueron 7.98, 9.04 y 12.51 kg alimentos kg producido-1 y las gdp (verano fueron: 1.01, 0.83 y 0.53 e (invierno fueron: 0.95, 0.68 y 0.51 kg cab-1 día-1, respectivamente. Mientras que los cp, medios, fueron $0.79, 0.68 y 0.51 dólares/kilo producido-1, respectivamente. La inclusión de RE puede ser una alternativa posible ante emergencias climáticas.

  17. The ribosomal small-subunit protein S28 gene from Helianthus annuus (Asteraceae) is down-regulated in response to drought, high salinity, and abscisic acid.

    Science.gov (United States)

    Liu, Xianan; Baird, W Vance

    2003-04-01

    A partial cDNA for the ribosomal S28 gene from sunflower was initially cloned and identified to be down-regulated by high salinity, using differential display reverse transcriptase-polymerase chain reaction (PCR). Using this sequence, a 502-base pair (bp) full-length cDNA was cloned by rapid amplification of cDNA ends. This cDNA (designated Ha-RPS28) encodes a protein component of the small subunit of cytoplasmic ribosomes. The predicted 65 amino acid residue sequence of Ha-RPS28, with an estimated molecular mass of 7.5 kD, has 92, 89, and 86% identity with the S28 ribosomal proteins from peach, maize, and Arabidopsis, respectively. Ha-RPS28 was expressed in all organs examined, and the highest level was detected in fully expanded leaves. Furthermore, expression of Ha-RPS28 was down-regulated in both seedling roots and shoots in response to drought, high salinity, or abscisic acid.

  18. Interactive effect of salinity and boron application on growth and physiological traits of sunflower (Helianthus annuus L.) genotypes

    OpenAIRE

    Muhammad Atif Riaz, Muhammad Saqib, Javaid Akhtar and Riaz Ahmad

    2012-01-01

    Soil salinity is a major problem of agriculture in Pakistan. Permanent solution of salinity problem is removal of salts by leaching and drainage whic is expensive. So research efforts should involve profitable utilization of these lands through biological approaches. Considering these observations, this study was designed with the objectives to explore changes in growth and physiological attributes of different sunflower genotypes under interactive effect of salinity and boron. Vigorous seeds...

  19. Allelopathic potential of Jimsonweed (Datura stramonium L. on the early growth of maize (Zea mays L. and sunflower (Helianthus annuus L.

    Directory of Open Access Journals (Sweden)

    Zvonko Pacanoski

    2014-09-01

    Full Text Available Laboratory and glasshouse experiments were carried out to investigate the allelopathic potential of different plant parts of D. stramonium on maize and sunflower on early growth stages. The aqueous leachates of D. stramonium roots and shoot did not produc a significant effect on germination and shoot length of maize, but root length of maize was significantly reduced at the highest (1/1 D. stramonium roots leachate compared to control. From the other side, germination of sunflower was significantly reduced at the highest (1/1 D. stramonium shoot leachate concentration, but lower (1/5 and 1/2 D. stramonium roots leachate concentrations significantly increased root and shoot length of sunflower compared to control. In glasshouse experiment, no one treatment with different D. stramonium plant residues significantly affected density, height and fresh weight of maize plants compared to control. Contrary, D. stramonium mixtures with 1/1 root and shoot residues significantly reduced plants density and fresh weight of sunflower plants compared to control. Lower (1/2 and 1/5 mixtures of D. stramonium roots residues and mixture with 1/5 D. stramonium shoot residues significantly increased the height of the sunflower plants.

  20. The influences of Cr-tolerant rhizobacteria in phytoremediation and attenuation of Cr (VI) stress in agronomic sunflower (Helianthus annuus L.).

    Science.gov (United States)

    Bahadur, Ali; Ahmad, Rizwan; Afzal, Aftab; Feng, Huyuan; Suthar, Vishandas; Batool, Asfa; Khan, Aman; Mahmood-Ul-Hassan, Muhammad

    2017-07-01

    Chromium contamination of agronomic soil has to turn into a serious global problem. This research was pointed to assess the effects of three Cr-tolerant rhizobacteria (SS1, SS3, and SS6) on sunflower growth and heavy metal uptake under Cr smog i.e. 20, 30 and 40 ppm using K 2 Cr 2 O 7 . Root promotion assay and pot experiment were conducted to investigate and evaluate the effects of Cr tolerance rhizobacteria and Cr accumulation capacity of sunflower. From root promotion assay non-significant variation was observed in the root length between SS1 and SS3 compared with un-inoculated whereas SS6 enhanced the root length in the absence and presence of chromium. In addition, inoculation with rhizobacteria alleviated the Cr concentration and endorsed plant growth by enhancing Cr accumulation in sunflower. At different Cr levels, the Cr concentration in shoot was improved by each rhizobacterium though their difference was non-significant with each other, while the percentage increase was half as the Cr level doubled. Different rhizobacterium inoculation significantly (P plant height, stem diameter, head diameter, grain yield, oil content of seeds, and total biomass, and among them, SS6 observed best followed by SS1 and SS3 comparing with un-inoculated. Our study illustrates an assessment about Cr-tolerant bacteria and their influences and recommends that these bacteria can effectively be used for crop improvement which provides a potential approach for Cr phytoremediation. Copyright © 2017 Elsevier Ltd. All rights reserved.

  1. Efecto y tolerancia de semillas de Helianthus Annuus (Asteraceae), Mentha Pepirita (Lamiaceae) y Medicago Sativa (Fabaceae) a diferentes concentraciones de Cadmio

    OpenAIRE

    Panchi Campues, Fabiola Elizabeth

    2015-01-01

    Cadmium is a heavy metal, which by their nature have a high threat to not be chemically or biologically degradable, why is one of the causes of environmental degradation, and causes direct damage in man. In Ecuador this metal is as a result of industrial activities present in the effluents and soil, causing an environmental impact due to their involvement to be directly related to water sources. At present there are proposed various types of wastewater treatment for removal of ...

  2. ISOLATION OF ENT-KAUR-16-EN-19-OIC AND ENT-TRACHILOBAN-19-OIC ACIDS FROM THE SUNFLOWER HELIANTHUS ANNUUS L.DRY WASTE

    Directory of Open Access Journals (Sweden)

    Nicon Ungur

    2008-12-01

    Full Text Available A relatively simple method for isolation of the mixture of ent-kaur-16-en-19-oic (1 and ent-trachiloban-19-oic (2 acids from dry waste of sunflower processing has been elaborated, and it has been shown that the waste can serve as an accessible source of ent-kauranic and ent-trachilobanic diterpenoids.

  3. Modulation of salt (NaCl)-induced effects on oil composition and fatty acid profile of sunflower (Helianthus annuus L.) by exogenous application of salicylic acid.

    Science.gov (United States)

    Noreen, Sibgha; Ashraf, Muhammad

    2010-12-01

    Salicylic acid (SA) is a potential endogenous plant hormone that plays an important role in plant growth and development. Since sunflower yield and its seed oil yield are adversely affected by salinity, in this study the role of SA in modulating salt (NaCl)-induced effects on various yield and oil characteristics of sunflower was investigated. For this purpose a greenhouse experiment comprising two sunflower hybrid lines (Hysun-33 and SF-187), two NaCl levels (0 and 120 mmol L(-1)) and four SA levels (0, 100, 200 and 300 mg L(-1)) was conducted. Salt stress markedly reduced yield, oil content, linoleic acid and δ-tocopherol in both sunflower lines, while it increased linolenic acid, palmitic acid, stearic acid and α- and γ-tocopherols. However, increasing levels of foliar-applied SA resulted in improved achene yield and hundred-achene weight in both lines. Foliar-applied SA caused a significant decrease in oil stearic acid and α- and γ-tocopherols in both lines under non-saline and saline conditions. Salt-induced harmful effects on achene yield and oil characteristics of sunflower could be alleviated by exogenous application of SA. High doses of SA caused a marked increase in sunflower achene oil content as well as some key fatty acids. Copyright © 2010 Society of Chemical Industry.

  4. Mechanical wounding induces a nitrosative stress by down-regulation of GSNO reductase and an increase in S-nitrosothiols in sunflower (Helianthus annuus) seedlings

    Science.gov (United States)

    Chaki, Mounira; Valderrama, Raquel; Fernández-Ocaña, Ana M.; Carreras, Alfonso; Gómez-Rodríguez, Maria. V.; Pedrajas, José R.; Begara-Morales, Juan C.; Sánchez-Calvo, Beatriz; Luque, Francisco; Leterrier, Marina; Corpas, Francisco J.; Barroso, Juan B.

    2011-01-01

    Nitric oxide (NO) and related molecules such as peroxynitrite, S-nitrosoglutathione (GSNO), and nitrotyrosine, among others, are involved in physiological processes as well in the mechanisms of response to stress conditions. In sunflower seedlings exposed to five different adverse environmental conditions (low temperature, mechanical wounding, high light intensity, continuous light, and continuous darkness), key components of the metabolism of reactive nitrogen species (RNS) and reactive oxygen species (ROS), including the enzyme activities L-arginine-dependent nitric oxide synthase (NOS), S-nitrosogluthathione reductase (GSNOR), nitrate reductase (NR), catalase, and superoxide dismutase, the content of lipid hydroperoxide, hydrogen peroxide, S-nitrosothiols (SNOs), the cellular level of NO, GSNO, and GSNOR, and protein tyrosine nitration [nitrotyrosine (NO2-Tyr)] were analysed. Among the stress conditions studied, mechanical wounding was the only one that caused a down-regulation of NOS and GSNOR activities, which in turn provoked an accumulation of SNOs. The analyses of the cellular content of NO, GSNO, GSNOR, and NO2-Tyr by confocal laser scanning microscopy confirmed these biochemical data. Therefore, it is proposed that mechanical wounding triggers the accumulation of SNOs, specifically GSNO, due to a down-regulation of GSNOR activity, while NO2-Tyr increases. Consequently a process of nitrosative stress is induced in sunflower seedlings and SNOs constitute a new wound signal in plants. PMID:21172815

  5. Genetic control of water use efficiency and leaf carbon isotope discrimination in sunflower (Helianthus annuus L.) subjected to two drought scenarios.

    Science.gov (United States)

    Adiredjo, Afifuddin Latif; Navaud, Olivier; Muños, Stephane; Langlade, Nicolas B; Lamaze, Thierry; Grieu, Philippe

    2014-01-01

    High water use efficiency (WUE) can be achieved by coordination of biomass accumulation and water consumption. WUE is physiologically and genetically linked to carbon isotope discrimination (CID) in leaves of plants. A population of 148 recombinant inbred lines (RILs) of sunflower derived from a cross between XRQ and PSC8 lines was studied to identify quantitative trait loci (QTL) controlling WUE and CID, and to compare QTL associated with these traits in different drought scenarios. We conducted greenhouse experiments in 2011 and 2012 by using 100 balances which provided a daily measurement of water transpired, and we determined WUE, CID, biomass and cumulative water transpired by plants. Wide phenotypic variability, significant genotypic effects, and significant negative correlations between WUE and CID were observed in both experiments. A total of nine QTL controlling WUE and eight controlling CID were identified across the two experiments. A QTL for phenotypic response controlling WUE and CID was also significantly identified. The QTL for WUE were specific to the drought scenarios, whereas the QTL for CID were independent of the drought scenarios and could be found in all the experiments. Our results showed that the stable genomic regions controlling CID were located on the linkage groups 06 and 13 (LG06 and LG13). Three QTL for CID were co-localized with the QTL for WUE, biomass and cumulative water transpired. We found that CID and WUE are highly correlated and have common genetic control. Interestingly, the genetic control of these traits showed an interaction with the environment (between the two drought scenarios and control conditions). Our results open a way for breeding higher WUE by using CID and marker-assisted approaches and therefore help to maintain the stability of sunflower crop production.

  6. Relocation of a rust resistance gene R 2 and its marker-assisted gene pyramiding in confection sunflower (Helianthus annuus L.).

    Science.gov (United States)

    Qi, L L; Ma, G J; Long, Y M; Hulke, B S; Gong, L; Markell, S G

    2015-03-01

    The rust resistance gene R 2 was reassigned to linkage group 14 of the sunflower genome. DNA markers linked to R 2 were identified and used for marker-assisted gene pyramiding in a confection type genetic background. Due to the frequent evolution of new pathogen races, sunflower rust is a recurring threat to sunflower production worldwide. The inbred line Morden Cross 29 (MC29) carries the rust resistance gene, R 2 , conferring resistance to numerous races of rust fungus in the US, Canada, and Australia, and can be used as a broad-spectrum resistance resource. Based on phenotypic assessments and SSR marker analyses on the 117 F2 individuals derived from a cross of HA 89 with MC29 (USDA), R 2 was mapped to linkage group (LG) 14 of the sunflower, and not to the previously reported location on LG9. The closest SSR marker HT567 was located at 4.3 cM distal to R 2 . Furthermore, 36 selected SNP markers from LG14 were used to saturate the R 2 region. Two SNP markers, NSA_002316 and SFW01272, flanked R 2 at a genetic distance of 2.8 and 1.8 cM, respectively. Of the three closely linked markers, SFW00211 amplified an allele specific for the presence of R 2 in a marker validation set of 46 breeding lines, and SFW01272 was also shown to be diagnostic for R 2 . These newly developed markers, together with the previously identified markers linked to the gene R 13a , were used to screen 524 F2 individuals from a cross of a confection R 2 line and HA-R6 carrying R 13a . Eleven homozygous double-resistant F2 plants with the gene combination of R 2 and R 13a were obtained. This double-resistant line will be extremely useful in confection sunflower, where few rust R genes are available, risking evolution of new virulence phenotypes and further disease epidemics.

  7. Influence of thiourea application on some physiological and molecular criteria of sunflower (Helianthus annuus L.) plants under conditions of heat stress.

    Science.gov (United States)

    Akladious, Samia Ageeb

    2014-05-01

    High temperature is a major factor limiting the growth of plant species during summer. Understanding the mechanisms of plant tolerance to high temperature would help in developing effective management practices and heat-tolerant cultivars through breeding or biotechnology. The present investigation was carried out to study the role of thiourea in enhancing the tolerance of sunflower plants to heat stress. Sunflower plants were subjected to temperature stress by exposing plants to 35 or 45 °C for 12 h. Two levels of thiourea (10 and 20 mM) were applied before sowing (seed treatment). The results indicated that the plants exposed to temperature stress exhibited a significant decline in growth parameters, chlorophylls, relative leaf water content, oil content, leaf nutrient status, and nitrate reductase activity. Treatment with thiourea, especially when applied at 10 mM, improved the above parameters and induced non-enzymatic and enzymatic antioxidants responsible for antioxidation. SDS-PAGE of protein revealed that high-temperature treatments alone or in combination with thiourea were associated with the disappearance of some bands or the appearance of unique ones. The result of RAPD analysis using five primers showed variable qualitative and quantitative changes. These findings confirm the effectiveness of applying thiourea on alleviating heat injuries in sunflower plants.

  8. Acyl carrier proteins from sunflower (Helianthus annuus L.) seeds and their influence on FatA and FatB acyl-ACP thioesterase activities.

    Science.gov (United States)

    Aznar-Moreno, Jose A; Venegas-Calerón, Mónica; Martínez-Force, Enrique; Garcés, Rafael; Salas, Joaquín J

    2016-08-01

    The kinetics of acyl-ACP thioesterases from sunflower importantly changed when endogenous ACPs were used. Sunflower FatB was much more specific towards saturated acyl-ACPs when assayed with them. Acyl carrier proteins (ACPs) are small (~9 kDa), soluble, acidic proteins involved in fatty acid synthesis in plants and bacteria. ACPs bind to fatty acids through a thioester bond, generating the acyl-ACP lipoproteins that are substrates for fatty acid synthase (FAS) complexes, and that are required for fatty acid chain elongation, acting as important intermediates in de novo fatty acid synthesis in plants. Plants, usually express several ACP isoforms with distinct functionalities. We report here the cloning of three ACPs from developing sunflower seeds: HaACP1, HaACP2, and HaACP3. These proteins were plastidial ACPs expressed strongly in seeds, and as such they are probably involved in the synthesis of sunflower oil. The recombinant sunflower ACPs were expressed in bacteria but they were lethal to the prokaryote host. Thus, they were finally produced using the GST gene fusion system, which allowed the apo-enzyme to be produced and later activated to the holo form. Radiolabelled acyl-ACPs from the newly cloned holo-ACP forms were also synthesized and used to characterize the activity of recombinant sunflower FatA and FatB thioesterases, important enzymes in plant fatty acids synthesis. The activity of these enzymes changed significantly when the endogenous ACPs were used. Thus, FatA importantly increased its activity levels, whereas FatB displayed a different specificity profile, with much high activity levels towards saturated acyl-CoA derivatives. All these data pointed to an important influence of the ACP moieties on the activity of enzymes involved in lipid synthesis.

  9. Sphingolipid base modifying enzymes in sunflower (Helianthus annuus): cloning and characterization of a C4-hydroxylase gene and a new paralogous Δ8-desaturase gene.

    Science.gov (United States)

    Moreno-Pérez, Antonio J; Martínez-Force, Enrique; Garcés, Rafael; Salas, Joaquín J

    2011-05-15

    Sphingolipids are components of plant cell membranes that participate in the regulation of important physiological processes. Unlike their animal counterparts, plant sphingolipids are characterized by high levels of base C4-hydroxylation. Moreover, desaturation at the Δ8 position predominates over the Δ4 desaturation typically found in animal sphingolipids. These modifications are due to the action of C4-hydroxylases and Δ8-long chain base desaturases, and they are important for complex sphingolipids finally becoming functional. The long chain bases of sunflower sphingolipids have high levels of hydroxylated and unsaturated moieties. Here, a C4-long chain base hydroxylase was functionally characterized in sunflower plant, an enzyme that could complement the sur2Δ mutation when heterologously expressed in this yeast mutant deficient in hydroxylation. This hydroxylase was ubiquitously expressed in sunflower, with the highest levels found in the developing cotyledons. In addition, we identified a new Δ8-long base chain desaturase gene that displays strong homology to a previously reported desaturase gene. This desaturase was also expressed in yeast and was able to change the long chain base composition of the transformed host. We studied the expression of this desaturase and compared it with that of the other isoform described in sunflower. The desaturase form studied in this paper displayed higher expression levels in developing seeds. Copyright © 2010 Elsevier GmbH. All rights reserved.

  10. The activity of antioxidant enzymes in response to salt stress in safflower (Carthamus tinctorius L.) and sunflower (Helianthus annuus L.) seedlings raised from seed treated with chitosan.

    Science.gov (United States)

    Jabeen, Nusrat; Ahmad, Rafiq

    2013-05-01

    Salt tolerance is a complex trait which involves the coordinated action of many genes that perform a variety of functions, such as ion sequestration, metabolic adjustment, osmotic adjustment and antioxidative defence. In this article, the growth and the generation and scavenging of reactive oxygen species (ROS) under normal (ECiw [Electrical conductivity of irrigation water] = 0.5 dS m(-1)) and salt stress conditions (ECiw = 3.4, 6.1, 8.6 and 10.8 dS m(-1) ) in relation to the priming of seeds of the two important oil yielding crops, i.e. safflower and sunflower, with different concentrations of chitosan [0% (control), 0.25%, 0.50%, 0.75%] is discussed. Induced salinity stress significantly decreased germination percentage, germination rate, length and weight of root and shoot, and protein content. Proline content, malondialdehyde content (MDA), catalase (CAT) and peroxidase (POX) activity increased at 10.8 dS m(-1). Under control conditions there were no significant differences in germination percentage among different concentrations of chitosan, whereas CAT and POX activity were increased by low concentrations of chitosan. With increasing salt stress, low concentrations of chitosan increased germination percentage but decreased MDA and proline contents and CAT and POX activity. Generation of ROS seems to be unavoidable under normal conditions and the activity of antioxidant enzymes in plants varies in terms of ROS generation under salt stress. However, the data indicate that plants subjected to salt stress-induced oxidative stress and the low concentrations of chitosan exhibited positive effects on salt stress alleviation through the reduction of enzyme activity in both crops. © 2012 Society of Chemical Industry.

  11. [Polymorphism among RFL-PPR homologs in sunflower (Helianthus annuus L.) lines with varying ability for the suppression of the cytoplasmic male sterility phenotype].

    Science.gov (United States)

    Anisimova, I N; Alpatieva, N V; Rozhkova, V T; Kuznetsova, E B; Pinaev, A G; Gavrilova, V A

    2014-07-01

    A complex comparative genetic approach was used for the investigation of the structural and functional diversity of genes for the restoration of sunflower pollen fertility. It includes (i) hybridological analysis; (ii) analysis of polymorphism among EST fragments.homologous to the known Rf genes that contain repeated motives of 35 amino acids (RFL-PPR); (iii) the development of molecular markers. Monogenic segregation in three interline cross combinations and the results of molecular marker analysis confirmed the allelic differences of parental lines in the Mendelian locus for CMS PET1 pollen fertility restoration. Introns were found in two RFL-PPR fragments. Two allelic variants of the QHL12D20 fragment were detected among the sixty lines of the sunflower genetic collection. An intron of QHL12D20 fragment was homologous to an intron of the AHBP-1B gene; the product of this gene-has a similarity with the transcription factor of the bZIP-family of Arabidopsis. A relationship between the QHL12D20 polymorphism and the functional state of the Rfl locus was revealed.

  12. High-throughput genotyping-by-sequencing facilitates molecular tagging of a novel rust resistance gene, R 15 , in sunflower (Helianthus annuus L.).

    Science.gov (United States)

    Ma, G J; Song, Q J; Markell, S G; Qi, L L

    2018-03-21

    A novel rust resistance gene, R 15 , derived from the cultivated sunflower HA-R8 was assigned to linkage group 8 of the sunflower genome using a genotyping-by-sequencing approach. SNP markers closely linked to R 15 were identified, facilitating marker-assisted selection of resistance genes. The rust virulence gene is co-evolving with the resistance gene in sunflower, leading to the emergence of new physiologic pathotypes. This presents a continuous threat to the sunflower crop necessitating the development of resistant sunflower hybrids providing a more efficient, durable, and environmentally friendly host plant resistance. The inbred line HA-R8 carries a gene conferring resistance to all known races of the rust pathogen in North America and can be used as a broad-spectrum resistance resource. Based on phenotypic assessments of 140 F 2 individuals derived from a cross of HA 89 with HA-R8, rust resistance in the population was found to be conferred by a single dominant gene (R 15 ) originating from HA-R8. Genotypic analysis with the currently available SSR markers failed to find any association between rust resistance and any markers. Therefore, we used genotyping-by-sequencing (GBS) analysis to achieve better genomic coverage. The GBS data showed that R 15 was located at the top end of linkage group (LG) 8. Saturation with 71 previously mapped SNP markers selected within this region further showed that it was located in a resistance gene cluster on LG8, and mapped to a 1.0-cM region between three co-segregating SNP makers SFW01920, SFW00128, and SFW05824 as well as the NSA_008457 SNP marker. These closely linked markers will facilitate marker-assisted selection and breeding in sunflower.

  13. Photosynthesis inhibition during gas exchange oscillations in ABA-treated Helianthus annuus relative role of stomatal patchiness and leaf carboxylation capacity

    Czech Academy of Sciences Publication Activity Database

    Šantrůček, Jiří; Hronková, Marie; Květoň, Jiří; Sage, R. F.

    2003-01-01

    Roč. 41, - (2003), s. 241-252 ISSN 0300-3604 R&D Projects: GA ČR GA206/00/0162; GA MŠk LN00A141 Institutional research plan: CEZ:AV0Z5051902 Keywords : plant physiolofy * photosynthesis inhibition Subject RIV: ED - Physiology Impact factor: 0.661, year: 2003

  14. Ceba de novillos en confinamiento con ensilaje de maíz suplementado con torta de girasol

    Directory of Open Access Journals (Sweden)

    Sánchez G. Hugo

    1989-06-01

    Full Text Available En la Hacienda "La Providencia", se evaluó la ceba en confinamiento en condiciones comerciales: se utilizó un arreglo factorial de 2 x 2: dos grupos de animales (livianos de 303 kg y pesados de 368 kg y dos niveles de suplementación proteica con torta de girasol (O y 1 kg/ animal/día, resultando cuatro tratamientos, cada uno con 20 animales. El ensayo duró 125 días y la dieta básica estuvo constituida por ensilaje de maíz, bagacillo de caña predigerido al 3 % de Na OH, melaza de caña, úrea, vitaminas y sal común al 8.5 % P a voluntad. Los animales se implantaron con Zeranol. Los consumos de materia seca/animal/grupo fueron de 7.9, 8.0, 9.4 y 9.1 kg/día., para los tratamientos 1 al 4 respectivamente. El tratamiento 1 fue el más favorable económicamente, seguido por 105 tratamientos 3, 2 y 4. Los tratamientos 2,3 y 4 generaron mayores gastos que ingresos; sin embargo, cuando se incluyó toda la operación, el valor de las ventas brutas fue mayor que los costos variables, presentándose en todos los tratamientos una diferencia positiva. Esto debido a que el valor de los novillos aumentó de un precio de compra a uno de venta durante el período que duró el experimento, por lo tanto, los retornos brutos fueron mayores que 105 costos variables, subsidiando la pérdida debida a que la alimentación estaba costando más, que el valor obtenido por los aumentos de peso conseguido por los animales.A trial with beef steers was conducted to evaluate a fattening feeding regime under commercial conditions. Two groups of animals were used (303 kg the light weight and 368 kg the heavy weight and two protein supplement levels (zero and one kg / animal/day; in a 2 x 2 factorial with tour treatments (TRT, each with 20 animals. The duration of the experiment was 125 days and the basal diet consisted of cornsilage, sugar caña bagassepith treated with 13 % Na OH, caña molasses, urea, vitaminas and comun salt with 8.5 % P offered at will. The animals

  15. Aplicación de un test colorimétrico al estudio del rendimiento y vida útil en fritura de alimentos precocinados y frescos de aceite de oliva, aceite de girasol y su mezcla

    Directory of Open Access Journals (Sweden)

    Trigueros, Gemma

    2003-03-01

    Full Text Available The frying-life of olive oil, sunflower oil and a their homogeneous blend used in 40 repeated and discontinuous frying of different food, mostly precooked and frozen foods, were comparatively determined by using the qualitative color test “Fritest” and color developed at 500 nm using this test (A500. These measurements were significantly correlated (p500 of 0.35 and to 25 % polar material and 10-15 % of oligomers. The shelf life (500500500Se compara la vida útil de aceite de oliva, aceite de girasol y una mezcla de ambos utilizados en 40 frituras repetidas de alimentos, la mayoría precocinados y congelados, mediante el test cualitativo colorimétrico “Fritest” y la determinación del color desarrollado por dicho test a 500 nm. (A500 correlaciona muy significativamente (p500 de 0,35 y con 25% de material polar y con 12-15% de oligómeros. La vida útil de los aceites (500500500< 0,4. El aceite de oliva presentó un rendimiento superior (3,1 kg de alimento/L de aceite al de girasol y mezcla de aceites (2,23 y 2,64 kg/L, respectivamente. Estos resultados señalan (i la validez del “Fritest” para la evaluación rápida de la vida útil de aceites de fritura y (ii el mayor rendimiento y vida útil del aceite de oliva respecto al de girasol o la mezcla de aceites de oliva y girasol en fritura de alimentos la mayoría precocinados y congelados.

  16. Qualidade de sementes de Helianthus annuus L. em função da adubação fosfatada e da localização na inflorescência Quality of Helianthus annuus L. seeds as a function of phosphate and location in the inflorescence

    Directory of Open Access Journals (Sweden)

    Humberto Pereira da Silva

    2011-07-01

    Full Text Available Nos últimos anos, a expansão da cultura do girassol promoveu uma busca por material genético mais competitivo, além de sementes com uma máxima qualidade física, fisiológica e sanitária. No campo, a época de colheita e a nutrição das plantas são de fundamental importância na expressão dessas qualidades. Com isso, objetivou-se, com este trabalho, avaliar a qualidade física e fisiológica das sementes de girassol submetidas a diferentes doses de fósforo e suas localizações dentro da inflorescência. O delineamento experimental foi em blocos casualizados em esquema fatorial (3x2, sendo o primeiro fator a localização da semente na inflorescência (periferia, meio e centro e, o segundo, doses de fósforo (zero e 70kg ha-1 de super-simples, sendo sua aplicação realizada durante a implantação da cultura. As sementes foram submetidas à determinação do teor de água, peso de mil sementes, peso das sementes por localização na inflorescência e a testes de germinação e vigor (primeira contagem e índice de velocidade de germinação. A adubação fosfatada proporciona aumento na qualidade física e fisiológica das sementes de girassol. A região da periferia junto com o meio contribui em maior parte para a obtenção de uma melhor qualidade física e fisiológica das sementes de girassol. A qualidade física é afetada pela localização das sementes na inflorescência, cujas mais pesadas se encontram na periferia, seguidas das do meio e tendo o centro com as sementes mais leves.In recent years, the expansion of sunflower promoted a search for genetic material more competitive, and for seeds with a maximum physical, physiological and health quality. In the field, harvesting time and plant nutrition are essential in the expression of these qualities. With this objective, this research aimed to evaluate the physical and physiological quality of sunflower seeds under different phosphorus levels and locations within the same inflorescence. The experimental design was randomized blocks in factorial (3x2, being the first factor, the location of the seed in the inflorescence (outside, middle and center and the second phosphorus levels (zero and to 70kg ha-1 super-simple. Its application was performed during the culture deployment . Seeds were subjected to the moisture content determination, thousand seed weight, seed weight per inflorescence location in germination and vigor (first count and index of germination rate. Phosphorus fertilization allowed an increase in physical and physiological quality of sunflower seeds. The region along the periphery with the environment contributes in most to obtain a better physical and physiological quality of sunflower seeds. The physical quality is affected by the location of seeds in inflorescences, which are heavier in the periphery, followed by middle and having the center with lighter seeds.

  17. Digestibilidade in vitro e degradabilidade in situ de diferentes variedades de grãos de girassol (Helianthus annuus L. - DOI: 10.4025/actascianimsci.v26i4.1737 In situ degradability and in vitro digestibility of different varieties of sunflower seeds (Helianthus annuus L. - DOI: 10.4025/actascianimsci.v26i4.1737

    Directory of Open Access Journals (Sweden)

    Weber Vilas Bôas Soares

    2004-04-01

    Full Text Available Foram avaliadas a digestibilidade in vitro da MS, PB, EE e FDN do grão de girassol inteiro ou quebrado das variedades C11, Embrapa 122 e M734 e a degradabilidade in situ da MS, PB e EB de grãos da variedade Catisol. A DIVMS da M734 foi inferior em 15,5% e 14,4% para as variedades C11 e Embrapa 122. Na DIVEE, a diferença foi de 22,5% e 19,1%. A superioridade da DIVPB na variedade C11 foi de 3,1% quando comparada com as variedades Embrapa 122 e M734. Os grãos quebrados foram superiores na solubilidade da fração a em 45,1% (MS, 70,7% (PB, 72,6% (EE e 84,9% (FDN e taxa de degradação da fração b foi superior para a MS, PB, EE e FDN. A fração b para o grão quebrado foi superior em 33,8% (MS, 36,4% (PB, 26,9% (EE e 42,9% (FDN. As degradabilidades efetivas da MS, PB, EE e FDN foram superiores para o grão quebrado em 60,0%, 73,9%, 80,0% e 76,2%. Quando utilizou-se para o cálculo a taxa passagem de 5%/h, na taxa de passagem de 8%/h, o comportamento foi semelhante.This work had the goal to evaluate the in vitro digestibility of dry matter (MS, crude protein (PB, ethereal extract (EE and neutral detergent fiber (NDF of the whole or broken grain of the following varieties C11, Embrapa 122 and M734 and in situ degradability of dry matter, crude protein and crude energy of sunflower seed, variety Catisol. The DIVMS of M734 was lower in 15,5 and 14,4%, when compared to the varieties C11 and Embrapa 122, respectively. In the DIVEE, the difference was 22,5% and 19,1%, respectively. The superiority of DIVPB in the variety C11 was 3,1% when compared to the varieties Embrapa 122 and M734. The fraction a of the broken grain obtained superior coefficient in 45,1% to MS, 70,7% to PB, 72,6% to EE and 84,9% to DFN when compared to the whole grain. The fraction b of the whole grain was bigger in 33,8% to MS, 36,4% to PB, 26,9% to EE. To FDN, the broken grain was superior in 42,9%. The fraction c was superior to MS, PB, EE and FDN of the broken grain related to the whole grain in 92,7; 94,7; 96,1 and 62,9%, respectively. The effective degradability of MS (DEMS, PB (DEPB, EE (DEEE and FDN (DEFDN to 5%/h, were higher to the whole grain in 60,0; 73,9; 80,0 and 76,2%, respectively. In the passage tax of 8%/h, the superiority of the broken grain was 60,6; 75,6; 81,0 e 78,7%, respectively.

  18. Efeito da mistura da planta de girassol (Helianthus annuus L., durante a ensilagem do capim-elefante (Pennisetum purpureum Schum. no valor nutritivo da silagem Effect of the mixture of the sunflower plant (Helianthus annuus L. during the ensiling with the elephantgrass (Pennisetum purpureum Shum. on nutritive value of silage

    Directory of Open Access Journals (Sweden)

    Adauton Vilela Rezende

    2002-09-01

    Full Text Available O girassol foi misturado ao capim-elefante (Pennisetum purpureum Schum na ensilagem. A colheita do capim-elefante foi realizada manualmente após 70 dias do corte de uniformização, à altura de 10 cm da superfície do solo. Para confecção da silagem, foram utilizados os híbridos de girassol M-742 e M-92007. As misturas capim-elefante e girassol foram feitas nas seguintes proporções de matéria verde: 100 e 0%, 75 e 25%; 50 e 50%; 25 e 75%; 0 e 100% de capim e girassol, respectivamente. As plantas foram picadas mecanicamente em partículas de 2,0 a 3,0 cm de tamanho, ensiladas por 30 dias, em silos de "PVC" de dez centímetros de diâmetro e quarenta centímetros de altura. Foram avaliadas as porcentagens de matéria seca (MS, proteína bruta (PB, extrato etéreo (EE, fibra em detergente neutro (FDN, digestibilidade in vitro da matéria seca (DIVMS e valores de pH das silagens. O delineamento experimental empregado foi o inteiramente casualizado, com quatro repetições. Concluiu-se que as silagens de capim-elefante com mistura da planta de girassol apresentaram maiores porcentagens de MS, PB, EE e valores de pH, aumentos na DIVMS e menor porcentagem de FDN na matéria seca com o aumento dos níveis de substituição.A mixture sunflower and elephant grass has been used for ensiling. Elephant grass was harvested manually 70 days after a plot leveling a height of 10cm from soil surface. For silage making, the sunflower hybrids M-742 and M-92007 were utilized. The mixtures of sunflower and elephantgrass were done at the following ratios of green matter 100 and 0%; 75 and 25%; 50 and 50%; 25% and 75%;0 and 100%, of grass and sunflower, respectively. Plants were chopped mechanically in particles of 2.0 to 3.0 cm in size, ensiled for 30 days in PVC silos 10 centimeters in diameter and 40 centimeter height. The evaluated variables were as follow: Percentages of dry matter (DM, crude protein (CP, ether extract (EE, neutral detergent fiber (NDF in vitro digestibility of dry matter (IVSDM and pH values of the silage. The experimental design utilized was the completely randomized with four replicates. It was concluded that the elephantgrass silages mixture with sunflower plant presented the highest percentages of DM, CP, EE and pH values, increases in the IV DDM and a lower percentage of NDF in the dry matter with increasing levels of replacement.

  19. Crescimento, desenvolvimento e retardamento da senescência foliar em girassol de vaso (Helianthus annuus L.: fontes e doses de nitrogênio Growth, development and delay of leaf senescence in pot-grown sunflower (Helianthus annuus L.: sources and rates of nitrogen

    Directory of Open Access Journals (Sweden)

    Joelma Dutra Fagundes

    2007-08-01

    Full Text Available O girassol é a quarta oleaginosa em produção de grãos no mundo e alguns genótipos são usados com finalidade ornamental para flor de corte e de vaso (girassol de vaso. O objetivo do trabalho foi avaliar o efeito de diferentes fontes e doses de nitrogênio sobre alguns parâmetros de crescimento, desenvolvimento e no retardamento da senescência das folhas basais em girassol de vaso. Um experimento foi conduzido em casa de vegetação, em Santa Maria, RS. Os tratamentos foram: uréia, nitrato de amônio e nitrato de cálcio nas doses de 0, 50, 100 e 150mg L-1 de N na solução de fertirrigação, com duas aplicações semanais. O experimento foi um bi-fatorial (fontes e doses de N no delineamento inteiramente casualizado, com seis repetições. Cada repetição foi um vaso no 15 (1,3L, 15cm de altura com uma planta por vaso. As variáveis analisadas foram: número final de folhas, altura final de plantas, porcentagem de folhas senescentes no ponto de venda, porcentagem de folhas senescentes no final de vida de vaso, área foliar total da planta, filocrono e a soma térmica acumulada da emergência ao botão visível e da emergência ao ponto de venda. A fonte de N tem influência sobre a área foliar do girassol de vaso, sendo a uréia recomendável para o maior crescimento das folhas. A dose de N em torno de 100mg L-1 aplicada duas vezes por semana via fertirrigação favorece características desejáveis para a comercialização, como precocidade e retardamento da senescência das folhas.Sunflower is the fourth oil grain crop grown worldwide and some genotypes are used with ornamental purpose as cut and pot-grown flower. The objective of this study was to evaluate the effect of different sources and rates of nitrogen on some growth and developmental parameters, and on the delay of leaf senescence in pot-grown sunflower. An experiment was carried out inside a greenhouse in Santa Maria, RS, Brazil. Treatments were: urea, ammonium nitrate and calcium nitrate at rates of 0, 50, 100 and 150mg L-1 of N in the fertigation solution, with two weekly applications. The experiment was a two-factorial (sources and rates of N in a completely randomized design with six replications. Each replication was a number 15 pot (1.5L, 15cm height with one plant/pot. The variables analyzed were: final leaf number, final plant height, percentage of senescent leaves at selling stage and at the end of vase life, total leaf area per plant, phyllochron, and the thermal time from emergency to visible bud and from emergency to selling stage. The N source influences leaf area of pot-grown sunflower, with urea being recommend for higher leaf growth. The rate of around 100mg L-1 of N applied twice a week through fertigation promoted desirable characteristics for commercialization such as earliness and delay of leaf senescence.

  20. Integration of sunflower (Helianthus annuus residues with a pre-plant herbicide enhances weed suppression in broad bean (Vicia faba Integração de resíduos de girassol (Helianthus annuus com herbicida pré-emergente na supressão de plantas daninhas na cultura da fava (Vicia faba

    Directory of Open Access Journals (Sweden)

    I.S Alsaadawi

    2011-12-01

    Full Text Available Field trial was conducted with the aim of utilizing allelopathic crop residues to reduce the use of synthetic herbicides in broad bean (Vicia faba fields. Sunflower residue at 600 and 1,400 g m-2 and Treflan (trifluralin at 50, 75 and 100% of recommended dose were incorporated into the soil alone or in combination with each other. Untreated plots were maintained as a control. Herbicide application in plots amended with sunflower residue had the least total weed count and biomass, which was even better than herbicide used alone. Integration of recommended dose of Treflan with sunflower residue at 1,400 g m-² produced maximum (987.5 g m-2 aboveground biomass of broad bean, which was 74 and 36% higher than control and recommended herbicide dose applied alone, respectively. Combination of herbicide and sunflower residue appeared to better enhance pod number and yield per unit area than herbicide alone. Application of 50% dose of Treflan in plots amended with sunflower residue resulted in similar yield advantage as was noticed with 100% herbicide dose. Chromatographic analysis of residue-infested field soil indicated the presence of several phytotoxic compounds of phenolic nature. Periodic data revealed that maximum suppression in weed density and dry weight synchronized with peak values of phytotoxins observed 4 weeks after incorporation of sunflower residues. Integration of sunflower residues with lower herbicide rates can produce effective weed suppression without compromising yield as a feasible and environmentally sound approach in broad bean fields.O experimento foi realizado com o objetivo de utilizar resíduos agrícolas com potencial alelopático para reduzir o uso de herbicidas sintéticos em fava (Vicia faba. Resíduos de girassol (600 e 1,400 g m-2 e Treflan (50, 75 e 100% da dose recomendada foram incorporados ao solo isoladamente ou em combinação uns com os outros. Parcelas não tratadas foram mantidas como controle. A aplicação de herbicidas nas parcelas com resíduo de girassol, foi melhor do que o herbicida usado sozinho. A integração da dose recomendada de Treflan com resíduo de girassol em 1,400 g m-2, para a produção de biomassa aérea da fava, foi 74 e 36% maior que o controle e a dose recomendada do herbicida aplicado isoladamente, respectivamente. Combinação de herbicida e resíduos de girassol são superiores no aumento do número de vagens e produtividade de fava, quando comparado ao herbicida isolado. Aplicação de 50% da dose Treflan em parcelas com resíduo de girassol resultou em maior rendimento de grãos, semelhantemente a dose% de herbicida. Análise cromatográfica do solo com o residuo de girassol indicou a presença de diversos compostos fitotóxicos de natureza fenólica. A supressão máxima da densidade e massa seca das plantas daninhas foram sincronizados com os valores de pico de fitotoxinas observados 4 semanas após a incorporação dos resíduos de girassol. A integração de resíduos de girassol com menores taxas de herbicida Treflan, pode suprimir plantas daninhas de forma mais eficaz, sem comprometer o rendimento da cultura da fava, como uma abordagem viável e ambientalmente racional.

  1. The importance of competition in the isolation and establishment of Helianthus paradoxus (Asteraceae)

    Science.gov (United States)

    Oscar W. Van Auken; Janis. K. Bush

    2007-01-01

    Helianthus paradoxus (the Pecos or puzzle sunflower) is a threatened, federally listed annual species that is found in a few locations in west Texas and New Mexico. Two greenhouse experiments were conducted to evaluate the ability of H. paradoxus to compete with its progenitors and a with potential ecosystem competitor, ...

  2. Variación de parámetros de calidad del grano y aceite de girasol almacenado a diferentes humedades relativas

    Directory of Open Access Journals (Sweden)

    Motta, A.

    1991-10-01

    Full Text Available Commercial samples of sunflower were exposed to different relative humidities (75%, 80%, 84%, 92% and 98% for two months. In addition to the kinetic rehydratation in standard and treated samples, the following parameters were measured: humidity, fat content, germinative power, acidity index, iodine number and fatty acids composition. Fatty acids composition, iodine number and fat content, did not change significantly. Only the acidity index and the germinative power were an index of the damage.

    Muestras comerciales de girasol fueron sometidas a distintas humedades relativas ambiente (75%, 80%, 84%, 92% y 98% durante dos meses. Además de la rehidratación cinética, en las muestras testigos y tratadas, se midieron los siguientes parámetros: humedad, riqueza grasa, poder germinativo, índice de acidez, índice de iodo y composición en ácidos grasos. La composición en ácidos grasos, el índice de iodo y la riqueza grasa no sufrieron variaciones significativas. Los parámetros más sensibles que pusieron en evidencia el deterioro fueron el índice de acidez y el poder germinativo.

  3. Identificación y caracterización funcional de genes candidatos asociados a la senescencia foliar en girasol basado en perfiles transcripcionales y metabólicos

    OpenAIRE

    Moschen, Sebastián

    2014-01-01

    El proceso de senescencia en plantas es un mecanismo complejo controlado por múltiples variables genéticas y ambientales que condicionan el rendimiento de los cultivos. En el caso del girasol, el segundo cultivo oleaginoso en importancia económica para nuestro país, se trata de un proceso con impacto económico que interviene en la brecha existente entre el rendimiento potencial y el rendimiento real observado, por la mayor o menor oportunidad de las plantas para mantener el sistema fotosintét...

  4. Eliminación de ácido clorogénico durante el procesado acuoso de las almendras de girasol

    Directory of Open Access Journals (Sweden)

    Domínguez, H.

    1993-10-01

    Full Text Available The effect of incorporating specific stages to remove phenolic compounds during aqueous processing of sunflower, to obtain oil of good quality and meal of light color was studied. The aqueous process removes 88 % of the chlorogenic acid initially present in the kernels; this value is overpassed with the two modifications proposed, being the diffusion of the deffated paste with hot water at short intervals the most efficient (98.6 %, although protein solubility is reduced in 9 %. If the diffusion step is performed from half kernels, the chlorogenic acid content is reduced in 93.7 %, without affecting protein solubility. Protein digestibility is enhanced after applying any of the two proposed diffusion steps.

    Se estudió el efecto de la incorporación de etapas específicas de eliminación de compuestos fenólicos durante el procesado acuoso de girasol para obtención de aceite de buena calidad y producción simultánea de harina de color claro. Durante el procesado acuoso se alcanza el 88 % de eliminación de ácido clorogénico, valor superado por los dos métodos alternativos propuestos, siendo la difusión con agua (a elevada temperatura durante períodos cortos de compuestos fenólicos de la pasta desgrasada la que proporciona mayor eficacia (98.6 %, aunque la solubilidad de la proteína se reduce un 9 %. Si se aplica una etapa de difusión a partir de almendras a la mitad, el contenido de ácido clorogénico se logra reducir en 93.7%, sin afectar a la solubilidad de la proteína. La digestibilidad resulta mejorada tras la aplicación de cualquiera de los dos procesos de difusión propuestos.

  5. Suplementaci??n de la dieta de ovejas lecheras con aceite de girasol y l??pidos marinos para modificar la composici??n de la grasa de la leche: efecto sobre el rendimiento productivo de los animales, la microbiota y las caracter??sticas de la fermentaci??n ruminal y el perfil de ??cidos grasos de la leche y la digesta

    OpenAIRE

    Guti??rrez Toral, Pablo

    2011-01-01

    214 p. Se han realizado cinco experimentos con ovejas, con el objetivo de investigar el efecto de la suplementaci??n con aceite de girasol y, o bien aceite de pescado, o bien microalgas marinas, sobre la composici??n de los ??cidos grasos de la leche y la digesta, la micriobiota, la fermantaci??n ruminal y el rendimiento productivo de los animales

  6. Possibilities of the management of Helianthus tuberosus species in Poodri PLA (Czech Republic)

    Science.gov (United States)

    Svehlakova, H.; Janikova, A.; Kupka, J.; Sotkova, N.; Rajdus, T.

    2017-10-01

    This article deals with the possibilities of population management of invasive and in Czech Republic no - native species Helianthus tuberosus. We have chosen study areas in Poodri PLA, it is located near the industrial city Ostrava (Moravian-Silesian region). Invasive Helianthus tuberosus forms monodominant vegetation, excludes the original and often rare plant species and reduces biodiversity. It is a risk for the further development of the landscape of Poodri PLA. There is no known effective way to dispose of invasive Helianthus tuberosus so far. We have applied the proposed management works on 15 monitoring areas and then evaluated their effectiveness. We have used chemical (herbicides) and mechanical (mowing, digging up) methods and their combinations. The most effective was the combination of 3 interventions: manual mowing - spraying – mowing by mechanization, just mowing itself rather promotes the spread of the population. We can say this is a pilot study from a long-term project dealing with the effectiveness of different ways of invasive plants management.

  7. PERENNIAL HELIANTHUS TAXA IN TÂRGU-MURES CITY AND ITS SURROUNDINGS

    Directory of Open Access Journals (Sweden)

    FILEP RITA

    2010-12-01

    Full Text Available Although in the neighbouring countries several perennial Helianthus taxa have been recorded in the last decade, in Romania only three have been identified so far. The literature and herbaria data of Târgu-Mures date back to the end of the XIXth century, and only refer to H. × multiflorus and H. tuberosus. The aim of this study was to identify the perennial Helianthus taxa in this region and to prepare their current distribution map. The survey was conducted in Târgu Mures city and the neighbouring villages: Livezeni, Sântana de Mures, Sâncraiu de Mures, Sângeorgiu de Mures, and Corunca. Four taxa were identified: H. pauciflorus Nutt., H. × laetiflorus Pers., H. tuberosus L. s.str., and Helianthus tuberosus L. s.l. The first two taxa are cultivated as ornamental plants, H. tuberosus s. str. is cultivated in a few farms, whereas H. tuberosus s. l. is an invasive species that spreads along the rivers.

  8. Determinación de hidroperóxidos totales en aceite de girasol ozonizado mediante el método de oxidación ferrosa en xilenol naranja

    Directory of Open Access Journals (Sweden)

    Díaz Gómez, Maritza

    2005-06-01

    Full Text Available Total hydroperoxides (HPT concentration using the ferrous oxidation in xylenol orange (OFX assay and peroxide value (IP using iodometric assay, were determined in sunflower oil samples ozonated at different ozone dosages. The effect of an increasing amount of ozonazed sunflower oil was evaluated by assembly assay, where a lineal relationship was obtained between oil amounts from 2 to 17 µg in the assay and absorbance units measured at 560 nm. The OFX reagent calibration and the extinction coefficient calculation were carried out for HPT measurement in ozonazed samples. The correlation established between IP and the concentration obtained by OFX assay showed a lineal relationship (r = 99.29; r2 = 98.59 %. These results confirm that this assay is appropriate for HPT measurement in ozonazed sunflower oil.Se analizaron muestras de aceite de girasol ozonizado a diferentes dosis de ozono aplicada y a cada una le fue determinada la concentración de hidroperóxidos totales (HPT empleando el método de oxidación ferrosa en xilenol naranja (OFX y el índice de peróxido (IP empleando el método yodométrico. Para el montaje de la técnica de OFX se evaluó el efecto de cantidades crecientes de aceite de girasol ozonizado, donde se obtuvo una relación lineal entre un contenido de aceite de 2 a 17 µg por ensayo y la absorbancia medida a 560 nm. Se realizó la calibración del reactivo de OFX y el cálculo del coeficiente de extinción para la determinación de HPT de las muestras ozonizadas. La correlación establecida entre la determinación de HPT por la técnica de OFX y el IP mostró una relación lineal (r= 99,29 %; r2 = 98,59 %. Estos resultados demuestran que este método es apropiado para la determinación de HPT en aceite de girasol ozonizado.

  9. Role of proline to induce salinity tolerance in Sunflower (helianthus annusl.)

    International Nuclear Information System (INIS)

    Iqbal, A.; Iftikhar, I.I.; Nawaz, H.; Nawaz, M.

    2014-01-01

    The potted experiment was conducted to determine the exogenous role of proline to induce salinity tolerance in sunflower (Helianthus annus L.). Salinity levels (0, 60 and 120 mmol) were created according to the saturation percentage of soil. Different levels (0, 30, 60 mmol) of proline were applied as a foliar spray on sunflower under saline and non saline conditions. Application of proline as a foliar spray ameliorated the toxic effects of salinity on growth, physiological and biochemical attributes of sunflower. Among different levels of proline, 60 mmol was found to be the most effective in ameliorating the toxic effects of salinity on sunflower. (author)

  10. Efecto de sustancias orgánicas solubles del suelo sobre la absorción de hierro en plántulas de girasol Effect of soluble soil organic substances on iron absorption by sunflower seedlings

    Directory of Open Access Journals (Sweden)

    Marcos Darío Bongiovanni

    2009-12-01

    Full Text Available La materia orgánica del suelo es uno de los recursos naturales que afecta la calidad del suelo. El uso y manejo del suelo pueden hacer disminuir su contenido afectando de este modo sus propiedades fisico-químicas y el crecimiento de las plantas. El objetivo de este trabajo fue evaluar la importancia del carbono orgánico soluble (COS y de ácidos fúlvicos (AF, ambos afectados por el laboreo, en la absorción de hierro por plantas de girasol. El COS estuvo ausente en el suelo con agricultura y el AF disminuyó en un 57%. Plántulas de girasol crecidas en solución nutritiva aumentaron su contenido de hierro en hojas 18,1 y 6,7 veces con el agregado de 30 mg L-¹ y 40 mg L-¹ de COS y AF, respectivamente. Mayores concentraciones de COS y AF en la solución nutritiva mejoraron la absorción de hierro y evitaron su precipitación en las raíces.Soil organic matter (SOM is one of the most important natural resources that affect soil quality. Soil uses and management may decrease SOM content affecting physical and chemical soil properties and consequently plant growth. The aim of this study was to evaluate the effect of soluble organic carbon (SOC and fulvic acids (FA, both affected by tillage, on iron uptake by sunflower seedlings. Soluble organic carbon disappeared in the soil under cultivation and FA was reduced 57%. Sunflower seedlings growing in hydroponic solution increased iron absorption and translocation. Thus, iron content in leaves increased 18.1 and 6.7 times with the addition of 30 mg L-¹ and 40 mg L-¹ of SOC and FA, respectively. Increasing SOC and FA concentration in nutrient solution improved iron uptake and also prevented iron precipitation in roots.

  11. Chemical Composition of the Essential Oils from the Roots of Erigeron acris L. and Erigeron annuus (L. Pers.

    Directory of Open Access Journals (Sweden)

    Jolanta Nazaruk

    2009-07-01

    Full Text Available The chemical compositions of essential oils from the roots of Erigeron acris and Erigeron annuus were studied. The essential oils were obtained by hydrodistillation in 1.0% and 0.05% yield, respectively, and analyzed by GC, GC-MS. Fifty four and forty seven constituents were identified. Predominant constituents of both oils were poly-acetylene esters: (Z,Z-matricaria ester (49.4% and 45.9%, respectively and (Z-lachnophyllum ester (37.2% and 27.5%, respectively, that were accompanied by their stereoisomers as well as appropriate lactones. Polyacetylenic compounds amounted to 92.1% of E. acris oil and 85.8% of E. annuus oil. Both oils contained the same monoterpene hydrocarbons, amounting to 4.2% and 5.8%, respectively, and traces of almost the same monoterpene oxygenated compounds. The dominant sesquiterpenes in E. acris were elemenes and tricyclic sesquiterpene hydrocarbons, while in E. annuus β-sesquiphellandrene and β-bisabolene dominated. After flash chromatography of essential oil from E. acris, fractions contained acetylene esters and acetylene lactones were obtained. The configuration about double bonds for these compounds has been elucidated on the basis of 1H- and 13C-NMR analysis.

  12. Selection on leaf ecophysiological traits in a hybrid Helianthus species and early generation hybrids in a desert dune habitat

    NARCIS (Netherlands)

    Ludwig, F.; Rosenthal, D.R.; Johnston, J.A.; Ryan, N.; Gross, B.L.; Lexer, C.; Dudley, S.A.; Rieseberg, L.H.; Donovan, L.A.

    2004-01-01

    Leaf ecophysiological traits related to carbon gain and resource use are expected to be under strong selection in desert annuals. We used comparative and phenotypic selection approaches to investigate the importance of leaf ecophysiological traits for Helianthus anomalus, a diploid annual sunflower

  13. Genetic diversity and population structure of the endangered whorled sunflower, Helianthus verticillatus, at two sites in Georgia

    Science.gov (United States)

    Helianthus verticillatus, the whorled sunflower, is an endangered species endemic to only a few locations in Tennessee, Alabama, and Georgia. This sunflower is an aggressive grower and attractive to both plant enthusiasts and pollinators with its multiple, small yellow flowers in late fall. There is...

  14. High genetic diversity and low population structure in Porter's sunflower (Helianthus porteri).

    Science.gov (United States)

    Gevaert, Scott D; Mandel, Jennifer R; Burke, John M; Donovan, Lisa A

    2013-01-01

    Granite outcrops in the southeastern United States are rare and isolated habitats that support edaphically controlled communities dominated by herbaceous plants. They harbor rare and endemic species that are expected to have low genetic variability and high population structure due to small population sizes and their disjunct habitat. We test this expectation for an annual outcrop endemic, Helianthus porteri (Porter's sunflower). Contrary to expectation, H. porteri has relatively high genetic diversity (H e = 0.681) and relatively low genetic structure among the native populations (F ST = 0.077) when compared to 5 other Helianthus species (N = 288; 18 expressed sequence tag-SSR markers). These findings suggest greater gene flow than expected. The potential for gene flow is supported by the analysis of transplant populations established with propagules from a common source in 1959. One population established close to a native population (1.5 km) at the edge of the natural range is genetically similar to and shares rare alleles with the adjacent native population and is distinct from the central source population. In contrast, a transplant population established north of the native range has remained similar to the source population. The relatively high genetic diversity and low population structure of this species, combined with the long-term success of transplanted populations, bode well for its persistence as long as the habitat persists.

  15. Talc based exopolysaccharides formulation enhancing growth and production of Hellianthus annuus under saline conditions.

    Science.gov (United States)

    Tewari, S; Arora, K

    2014-12-24

    Stress tolerating strain of Pseudomonas aeruginosa PF07 possessing plant growth promoting activity was screened for the production of exopolysaccharides (EPS). EPS production was monitored in the cell free culture supernatant (CFCS) and extracted EPS was further purified by thin layer chromatography. EPS producing cells were taken to design talc based formulation and its efficacy was checked on oilseed crop sunflower (Hellianthus annuus), under in vivo saline conditions (soil irrigated with 125 mM of saline water). Application of bioformulation significantly enhanced the yield and growth attributes of the plant in comparison to control (untreated seeds) under stress and non—stress conditions. Germination rate, plant length, dry weight and seed weight increased remarkably. The above findings suggest the application and benefits of utilizing EPS formulation in boosting early seedling emergence, enhancing plant growth parameters, increasing seed weight and mitigating stress in saline affected regions. Such bioformulation may enhance RAS/RT (Root Adhering Soil to Root Tissue ratio), texture of the soil, increase porosity, improve uptake of nutrients, and hence may be considered as commercially important formulation for renovation of stressed sites and enhancing plant growth.

  16. Development and dissection of diagnostic SNP markers for the downy mildew resistance genes Pl Arg and Pl 8 and maker-assisted gene pyramiding in sunflower (Helianthus annuus L.).

    Science.gov (United States)

    Qi, L L; Talukder, Z I; Hulke, B S; Foley, M E

    2017-06-01

    Diagnostic DNA markers are an invaluable resource in breeding programs for successful introgression and pyramiding of disease resistance genes. Resistance to downy mildew (DM) disease in sunflower is mediated by Pl genes which are known to be effective against the causal fungus, Plasmopara halstedii. Two DM resistance genes, Pl Arg and Pl 8 , are highly effective against P. halstedii races in the USA, and have been previously mapped to the sunflower linkage groups (LGs) 1 and 13, respectively, using simple sequence repeat (SSR) markers. In this study, we developed high-density single nucleotide polymorphism (SNP) maps encompassing the Pl arg and Pl 8 genes and identified diagnostic SNP markers closely linked to these genes. The specificity of the diagnostic markers was validated in a highly diverse panel of 548 sunflower lines. Dissection of a large marker cluster co-segregated with Pl Arg revealed that the closest SNP markers NSA_007595 and NSA_001835 delimited Pl Arg to an interval of 2.83 Mb on the LG1 physical map. The SNP markers SFW01497 and SFW06597 delimited Pl 8 to an interval of 2.85 Mb on the LG13 physical map. We also developed sunflower lines with homozygous, three gene pyramids carrying Pl Arg , Pl 8 , and the sunflower rust resistance gene R 12 using the linked SNP markers from a segregating F 2 population of RHA 340 (carrying Pl 8 )/RHA 464 (carrying Pl Arg and R 12 ). The high-throughput diagnostic SNP markers developed in this study will facilitate marker-assisted selection breeding, and the pyramided sunflower lines will provide durable resistance to downy mildew and rust diseases.

  17. Seasonal variability of the parameters of the Ball-Berry model of stomatal conductance in maize (Zea mays L.) and sunflower (Helianthus annuus L.) under well-watered and water-stressed conditions.

    Science.gov (United States)

    Miner, Grace L; Bauerle, William L

    2017-09-01

    The Ball-Berry (BB) model of stomatal conductance (g s ) is frequently coupled with a model of assimilation to estimate water and carbon exchanges in plant canopies. The empirical slope (m) and 'residual' g s (g 0 ) parameters of the BB model influence transpiration estimates, but the time-intensive nature of measurement limits species-specific data on seasonal and stress responses. We measured m and g 0 seasonally and under different water availability for maize and sunflower. The statistical method used to estimate parameters impacted values nominally when inter-plant variability was low, but had substantial impact with larger inter-plant variability. Values for maize (m = 4.53 ± 0.65; g 0  = 0.017 ± 0.016 mol m -2 s -1 ) were 40% higher than other published values. In maize, we found no seasonal changes in m or g 0 , supporting the use of constant seasonal values, but water stress reduced both parameters. In sunflower, inter-plant variability of m and g 0 was large (m = 8.84 ± 3.77; g 0  = 0.354 ± 0.226 mol m -2 s -1 ), presenting a challenge to clear interpretation of seasonal and water stress responses - m values were stable seasonally, even as g 0 values trended downward, and m values trended downward with water stress while g 0 values declined substantially. © 2017 John Wiley & Sons Ltd.

  18. Relative efficiency of mustard (Brassica juncea l.) and sunflower (Helianthus annuus l.) in utilizing soil phosphorous in presence of P, 2n and FYM under normal and saline soil conditions

    International Nuclear Information System (INIS)

    Dravid, M.S.; Goswami, N.N.

    1988-01-01

    Studies with 32 P labelled fertilizer on mustard and sunflower showed a marked reduction in drymatter accumulation, total P uptake, per cent Pdff and per cent P utilization at 10.6 dSm -1 level of salinity over normal one. Except drymatter accumulation, the extent of reduction in total P uptake, per cent Pdff and per cent P utilization was of higher magnitude in sunflower as compared to mustard. Application of P either alone or in conjunction with Zn/FYM gave significantly higher values of drymatter yield, total P uptake, per cent Pdff and per cent P utilization in both the crops. Data further, revealed that application of P in conjunction with FYM was found more beneficial as compared to zinc. It was also observed that the per cent P utilization of applied fertilizer in these crops decreased at higher (80 kg P 2 O 5 /ha) level of P. Amongst the varieties of mustard and sunflower, tested, PR-45 of mustard and EC-69874 of sunflower showed higher yield potential and utilization of native soil phosphorus more efficiently, while Pusa Bold of mustard and Surya of sunflower utilized fertilizer phosphorus more efficiently. (author). 24 refs., 2 tables

  19. LowAgrobacterium tumefaciensinoculum levels and a long co-culture period lead to reduced plant defense responses and increase transgenic shoot production of sunflower (Helianthus annuusL.).

    Science.gov (United States)

    Zhang, Zhifen; Finer, John J

    2016-01-01

    Agrobacterium -mediated plant transformation is typically conducted by inoculating plant tissues with an Agrobacterium suspension containing approximately 10 8 -10 9 bacteria mL -1 , followed by a 2-3-d co-culture period. Use of longer co-culture periods could potentially increase transformation efficiencies by allowing more time for Agrobacterium to interact with plant cells, but bacterial overgrowth is likely to occur, leading to severe tissue browning and reduced transformation and regeneration. Low bacterial inoculum levels were therefore evaluated as a means to reduce the negative outcomes associated with long co-culture. The use of low inoculum bacterial suspensions (approximately 6 × 10 2 bacteria mL -1 ) followed by long co-culture (15 d) led to the production of an average of three transformed sunflower shoots per explant while the use of high inoculum (approximately 6 × 10 8 bacteria mL -1 ) followed by short co-culture (3 d) led to no transformed shoots. Low inoculum and long co-culture acted synergistically, and both were required for the improvement of sunflower transformation. Gene expression analysis via qRT-PCR showed that genes related to plant defense response were generally expressed at lower levels in the explants treated with low inoculum than those treated with high inoculum during 15 d of co-culture, suggesting that low inoculum reduced the induction of plant defense responses. The use of low inoculum with long co-culture (LI/LC) led to large increases in sunflower transformation efficiency. This method has great potential for improving transformation efficiencies and expanding the types of target tissues amenable for transformation of different plant species.

  20. Pathogenic and Genetic Diversity among Iranian Isolates of Macrophomina phaseolina Diversidad Patogénica y Genética entre Aislamientos Iraníes de Macrophomina phaseolina

    Directory of Open Access Journals (Sweden)

    Siavosh Rayatpanah

    2012-03-01

    Full Text Available Charcoal rot, caused by Macrophomina phaseolina (Tassi Goid., is an economically important disease of oilseed plants in Northern Iran. Seventy isolates of M. phaseolina were obtained from different hosts, including soybean (Glycine max L., and sunflower (Helianthus annuus L. in the northern oilseed planting regions of Iran. RAPD-PCR amplification profiles, by using of six random OPA primers (kit A showed polymorphisms among the isolates. The primer OPA-13 (5'_ CAGCACCCAC_3' amplified the genomic DNA of all isolates of M.phaseolina producing 4-12 bands of sizes between 0.25 and 2.3 kb. Unweighted pair-group method with arithmetic mean (UPGMA analysis classified the isolates into the nine major groups with 64% similarity. Pathogenicity of isolates was evaluated at seedling stage of soybean, sunflower, and maize (Zea mays L. plants under in vitro conditions. None of the isolates were pathogenic on corn, while all of the isolates infected soybean and sunflower seedlings. Isolates were more virulent on soybean than sunflower. The disease index on sunflower and soybean varied between 19-24 and 27-30 respectively. These results indicated a significant pathogenic and genetic variability within the Iranian isolates of M. phaseolina. Cultivation with crop rotation was probably tended to induce less diversity of the pathogen isolates.Pudrición carbonosa, causada por Macrophomina phaseolina (Tassi Goid., es una enfermedad de importancia económica de las plantas de semillas oleaginosas en el norte de Irán. Setenta aislamientos de M. phaseolina se obtuvieron de diferentes hospederos, incluyendo soya (Glycine max L. y girasol (Helianthus annuus L. en las regiones de plantación de semillas oleaginosas del norte de Irán. Perfiles RAPD-PCR de amplificación, utilizando primers aleatorios de seis OPA (kit A mostraron polimorfismos entre los aislamientos. El primer OPA-13 (5'-CAGCACCCAC-3' amplificó el ADN genómico de todos los aislamientos de M. phaseolina

  1. Entrevista a la Dra. en Ciencias Exactas, área Química (UNLP) Estefanía Guiotto sobre su tesis doctoral: "Aplicación de subproductos de chía (Salvia hispanica L.) y girasol (Helianthus annuss L.) en alimentos"

    OpenAIRE

    Guiotto, Estefanía Nancy; Clavellino, Marcos Sebastián

    2014-01-01

    La Dra. en Ciencias Exactas de la UNLP Estefanía Guiotto, en el programa Radiofotos de FM 107.5 Radio Universidad, dialoga con el periodista Marcos Clavellino y explica el contenido de su tesis doctoral para que los oyentes puedan conocer su investigación.

  2. Economically Viable Components from Jerusalem Artichoke (Helianthus tuberosus L. in a Biorefinery Concept

    Directory of Open Access Journals (Sweden)

    Eva Johansson

    2015-04-01

    Full Text Available Biorefinery applications are receiving growing interest due to climatic and waste disposal issues and lack of petroleum resources. Jerusalem artichoke (Helianthus tuberosus L. is suitable for biorefinery applications due to high biomass production and limited cultivation requirements. This paper focuses on the potential of Jerusalem artichoke as a biorefinery crop and the most viable products in such a case. The carbohydrates in the tubers were found to have potential for production of platform chemicals, e.g., succinic acid. However, economic analysis showed that production of platform chemicals as a single product was too expensive to be competitive with petrochemically produced sugars. Therefore, production of several products from the same crop is a must. Additional products are protein based ones from tubers and leaves and biogas from residues, although both are of low value and amount. High bioactive activity was found in the young leaves of the crop, and the sesquiterpene lactones are of specific interest, as other compounds from this group have shown inhibitory effects on several human diseases. Thus, future focus should be on understanding the usefulness of small molecules, to develop methods for their extraction and purification and to further develop sustainable and viable methods for the production of platform chemicals.

  3. Transcriptome resources for the perennial sunflower Helianthus maximiliani obtained from ecologically divergent populations.

    Science.gov (United States)

    Kawakami, Takeshi; Darby, Brian J; Ungerer, Mark C

    2014-07-01

    Next-generation sequencing (NGS) technologies provide a rapid means to generate genomic resources for species exhibiting interesting ecological and evolutionary variation but for which such resources are scant or nonexistent. In the current report, we utilize 454 pyrosequencing to obtain transcriptome information for multiple individuals and tissue types from geographically disparate and ecologically differentiated populations of the perennial sunflower species Helianthus maximiliani. A total of 850 275 raw reads were obtained averaging 355 bp in length. Reads were assembled, postprocessing, into 16 681 unique contigs with an N50 of 898 bp and a total length of 13.6 Mb. A majority (67%) of these contigs were annotated based on comparison with the Arabidopsis thaliana genome (TAIR10). Contigs were identified that exhibit high similarity to genes associated with natural variation in flowering time and freezing tolerance in other plant species and will facilitate future studies aimed at elucidating the molecular basis of clinal life history variation and adaptive differentiation in H. maximiliani. Large numbers of gene-associated simple sequence repeats (SSRs) and single-nucleotide polymorphisms (SNPs) also were identified that can be deployed in mapping and population genomic analyses. © 2014 John Wiley & Sons Ltd.

  4. Vytrvalé slunečnice (Helianthus L.): historie pěstování a hodnocení sortimentů

    OpenAIRE

    Tejkalová, Kateřina

    2015-01-01

    This master's thesis deals with the evaluation of a range of perennial sun-flowers of the Helianthus family. 19 characteristics have been evaluated on 17 species of the plants. The measurement and assessment took place on two locations. In the year 2011 the evaluation took place in Lysice locality only, in the year 2014 it was carried out in localities Lysice and Lednice na Moravě. This thesis also includes comparison of culture of the Helianthus family in the past and present time. A range o...

  5. Introducción a la hidrogenación de aceite y su implementación en un proceso supercrítico: caso del aceite de girasol

    Directory of Open Access Journals (Sweden)

    Ajzenberg, Nancy

    2002-06-01

    Full Text Available With 25 millions tons per year, the hydrogenated oil production is on the top in the food market. In this review we deal with the sunflower seed oil hydrogenation with special attention to the economy of the product, the reaction kinetic and parameters studies (like reactor, isomers production, catalyst. Furthermore we point out the necessities to use a new process considering ecological, safety and economic requirements. Then, using new catalysts based on Pt (instead of Ni and a supercritical solvent, the trans isomers level can be reduced. Furthermore, the supercritical technology improves the process regarding reaction rate and solvent treatment.Con 25 millones de toneladas al año, la producción de aceite hidrogenado tiene su sitio en el mercado de la alimentación. Este artículo trata de la hidrogenación del aceite de girasol pasando por la economía del producto, la cinética de la reacción y el estudio de parámetros (como el reactor, la producción de isómeros, el catalizador y explícita las necesidades de usar un nuevo proceso para cumplir normas ecológicas, sanitarias y económicas. Así, utilizando nuevos catalizadores de platino (en vez de níquel y un solvente supercrítico, se baja la cantidad de isómeros trans producidos, que son nefastos para la salud. Además, la tecnología supercrítica mejora el proceso sobre todo del punto de vista de la reacción y del tratamiento del solvente.

  6. Evidence of correlated evolution and adaptive differentiation of stem and leaf functional traits in the herbaceous genus, Helianthus.

    Science.gov (United States)

    Pilote, Alex J; Donovan, Lisa A

    2016-12-01

    Patterns of plant stem traits are expected to align with a "fast-slow" plant economic spectrum across taxa. Although broad patterns support such tradeoffs in field studies, tests of hypothesized correlated trait evolution and adaptive differentiation are more robust when taxa relatedness and environment are taken into consideration. Here we test for correlated evolution of stem and leaf traits and their adaptive differentiation across environments in the herbaceous genus, Helianthus. Stem and leaf traits of 14 species of Helianthus (28 populations) were assessed in a common garden greenhouse study. Phylogenetically independent contrasts were used to test for evidence of correlated evolution of stem hydraulic and biomechanical properties, correlated evolution of stem and leaf traits, and adaptive differentiation associated with source habitat environments. Among stem traits, there was evidence for correlated evolution of some hydraulic and biomechanical properties, supporting an expected tradeoff between stem theoretical hydraulic efficiency and resistance to bending stress. Population differentiation for suites of stem and leaf traits was found to be consistent with a "fast-slow" resource-use axis for traits related to water transport and use. Associations of population traits with source habitat characteristics supported repeated evolution of a resource-acquisitive "drought-escape" strategy in arid environments. This study provides evidence of correlated evolution of stem and leaf traits consistent with the fast-slow spectrum of trait combinations related to water transport and use along the stem-to-leaf pathway. Correlations of traits with source habitat characteristics further indicate that the correlated evolution is associated, at least in part, with adaptive differentiation of Helianthus populations among native habitats differing in climate. © 2016 Botanical Society of America.

  7. Phyto-crystallization of silver and gold by Erigeron annuus (L. Pers flower extract and catalytic potential of synthesized and commercial nano silver immobilized on sodium alginate hydrogel

    Directory of Open Access Journals (Sweden)

    Palanivel Velmurugan

    2016-05-01

    Full Text Available A green, eco-friendly approach for the synthesis of silver and gold nanoparticles (AgNPs and AuNPs using Erigeron annuus (L. pers flower extract as both the reducing and capping agent is reported for the first time. Optimal nanoparticle production was achieved by adjusting various parameters including pH, extract concentration, metal ion concentration, and time. Initial verification of AgNP and AuNP production was done by visual observation and measuring surface plasmon spectra at 434 and 537 nm, respectively. The synthesized AgNPs and AuNPs were characterized by high resolution-transmission electron microscopy (HR-TEM, X-ray diffraction (XRD, energy dispersive spectrophotometry (EDS, Fourier transform infrared spectroscopy (FTIR and zeta potential. The catalytic potential of E. annuus flower extract, silver ions, synthesized AgNPs, commercial grade AgNPs, and a mixture of flower extract and AgNPs immobilized on sodium alginate hydrogel beads (Na/Al HB was analyzed. The ability of these immobilized materials to degrade methylene blue was investigated. Commercial grade AgNPs immobilized with Na/Al HB 1.5 g/20 mL were observed to have good catalytic activity followed by a mixture of synthesized AgNPs immobilized with Na/Al HB and E. annuus flower extract immobilized with Na/Al HB at 1.5 g/20 mL.

  8. Evolution of the leaf economics spectrum in herbs: Evidence from environmental divergences in leaf physiology across Helianthus (Asteraceae).

    Science.gov (United States)

    Mason, Chase M; Donovan, Lisa A

    2015-10-01

    The leaf economics spectrum (LES) describes a major axis of plant functional trait variation worldwide, defining suites of leaf traits aligned with resource-acquisitive to resource-conservative ecological strategies. The LES has been interpreted to arise from leaf-level trade-offs among ecophysiological traits common to all plants. However, it has been suggested that the defining leaf-level trade-offs of the LES may not hold within specific functional groups (e.g., herbs) nor within many groups of closely related species, which challenges the usefulness of the LES paradigm across evolutionary scales. Here, we examine the evolution of the LES across 28 species of the diverse herbaceous genus Helianthus (the sunflowers), which occupies a wide range of habitats and climate variation across North America. Using a phylogenetic comparative approach, we find repeated evolution of more resource-acquisitive LES strategies in cooler, drier, and more fertile environments. We also find macroevolutionary correlations among LES traits that recapitulate aspects of the global LES, but with one major difference: leaf mass per area is uncorrelated with leaf lifespan. This indicates that whole-plant processes likely drive variation in leaf lifespan across Helianthus, rather than leaf-level trade-offs. These results suggest that LES patterns do not reflect universal physiological trade-offs at small evolutionary scales. © 2015 The Author(s). Evolution © 2015 The Society for the Study of Evolution.

  9. Analysis of Phenolic Acids of Jerusalem Artichoke (Helianthus tuberosus L. Responding to Salt-Stress by Liquid Chromatography/Tandem Mass Spectrometry

    Directory of Open Access Journals (Sweden)

    Fujia Chen

    2014-01-01

    Full Text Available Plant phenolics can have applications in pharmaceutical and other industries. To identify and quantify the phenolic compounds in Helianthus tuberosus leaves, qualitative analysis was performed by a reversed phase high-performance liquid chromatography coupled with tandem mass spectrometry (HPLC-MS/MS and quantitative analysis by HPLC. Ten chlorogenic acids (CGAs were identified (3-o-caffeoylquinic acid, two isomers of caffeoylquinic acid, caffeic acid, p-coumaroyl-quinic acid, feruloylquinic acid, 3,4-dicaffeoyquinic acid, 3,5-dicaffeoylquinic acid, 1,5-dicaffeoylquinic acid, and 4,5-dicaffeoylquinic acid by comparing their retention times, UV-Vis absorption spectra, and MS/MS spectra with standards. In addition, four other phenolic compounds, including caffeoyl glucopyranose, isorhamnetin glucoside, kaempferol glucuronide, and kaempferol-3-o-glucoside, were tentatively identified in Helianthus tuberosus leaves for the first time. The 3-o-caffeoylquinic acid (7.752 mg/g DW, 4,5-dicaffeoylquinic acid (5.633 mg/g DW, and 3,5-dicaffeoylquinic acid (4.900 mg/g DW were the major phenolic compounds in leaves of Helianthus tuberosus cultivar NanYu in maturity. The variations in phenolic concentrations and proportions in Helianthus tuberosus leaves were influenced by genotype and plant growth stage. Cultivar NanYu had the highest concentration of phenolic compounds, in particular 3-o-caffeoylquinic acid and 4,5-dicaffeoylquinic acid compared with the other genotypes (wild accession and QingYu. Considering various growth stages, the concentration of total phenolics in cultivar NanYu was higher at flowering stage (5.270 mg/g DW than at budding and tuber swelling stages. Cultivar NanYu of Helianthus tuberosus is a potential source of natural phenolics that may play an important role in the development of pharmaceuticals.

  10. Enzymatic browning and after-cooking darkening of Jerusalem artichoke tubers (Helianthus tuberosus L.)

    DEFF Research Database (Denmark)

    Bach, Vibe; Bennedbæk-Jensen, Sidsel; Clausen, Morten Rahr

    2013-01-01

    enzymatic browning, but Rema and Draga had higher scores than Mari in after-cooking darkening. Jerusalem artichoke tubers had higher contents of total phenolics, phenolic acids and citric acid in the autumn and low contents in the spring, while it was the opposite for malic acid. None of the chemical......Jerusalem artichoke tubers (Helianthus tuberosus L.) undergo enzymatic browning when peeled or cut, and turn grey after boiling, due to after-cooking darkening reactions between iron and phenolic acids. In an attempt to reveal the components responsible for these discolouration reactions, sensory...... evaluation and instrumental colour measurements were related to contents of total phenolics, phenolic acids, organic acids and iron in three varieties of raw and boiled Jerusalem artichoke tubers harvested in the autumn and the spring. No differences were found between varieties in sensory evaluated...

  11. The effect of culinary preparation on carbohydrate composition, texture and sensory quality of Jerusalem artichoke tubers (Helianthus tuberosus L.)

    DEFF Research Database (Denmark)

    Bach, Vibe; Bennedbæk-Jensen, Sidsel; Kidmose, Ulla

    2013-01-01

    in three different varieties of Jerusalem artichoke tubers at two different harvest times. Texture attributes and sweetness were the best sensory attributes to discriminate between varieties, although differences in texture and taste were somewhat evened out during boiling and baking. Instrumentally......The Jerusalem artichoke (Helianthus tuberosus L.) tuber is a root vegetable with excellent gastronomic qualities, however the culinary properties are underexploited. Carbohydrate content, instrumental texture analysis and sensory profiling were used to study the effects of culinary preparation...... measured hardness and modulus declined in the order raw, boiled and baked. A positive correlation was determined between sensory crispness and instrumental hardness (Pearson r = 0.57, P = 0.013) of boiled tubers, but no other correlations were found between sensory attributes and instrumental texture...

  12. Extracellular matrix surface network is associated with non-morphogenic calli of Helianthus tuberosus cv. Albik produced from various explants

    Directory of Open Access Journals (Sweden)

    Maria Pilarska

    2014-03-01

    Full Text Available Helianthus tuberosus is economically important species. To improve characters of this energetic plant via genetic modification, production of callus tissue and plant regeneration are the first steps. A new, potentially energetic cultivar Albik was used in this study to test callus induction and regeneration. Callus was produced on leaves, petioles, apical meristems and stems from field-harvested plants but was totally non-morphogenic. Its induction started in the cortex and vascular bundles as confirmed by histological analysis. The surface of heterogeneous callus was partially covered with a membranous extracellular matrix surface network visible in scanning and transmission electron microscopies. The results clearly indicate that: (i the morphogenic capacity of callus in topinambur is genotype dependent, (ii cv. Albik of H. tuberosus proved recalcitrant in in vitro regeneration, and (iii extracellular matrix surface network is not a morphogenic marker in this cultivar.

  13. Evaluation of the influence of nitrogen fixing, phosphate solubilizing ...

    African Journals Online (AJOL)

    Three biofertilizers nitrobein, phosphorein, and potash, containing nitrogen fixing, phosphate solubilizing, and potash mobilizing microorganisms, respectively were studied in peanut (Arachis hypogea L.) and sunflower (Helianthus annuus L.). Amendment with each of these biofertilizers enhanced different growth ...

  14. Muffins con aceite de girasol alto estearico

    OpenAIRE

    González Procopio, Gimena

    2015-01-01

    Las enfermedades cardiovasculares constituyen una de las causas más importantes de discapacidad y muerte prematura en nuestro país y en todo el mundo, a su vez la modificación de los factores de riesgo puede reducir los episodios cardiovasculares y la muerte prematura tanto en las personas con enfermedad cardiovascular establecida como en aquellas con alto riesgo cardiovascular debido a uno o más factores de riesgo Objetivo: Identificar la variación en el perfil lipídico de una...

  15. Dicty_cDB: Contig-U08228-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ianthus annuus isolate Mexico-M... 42 0.011 FJ373728_1( FJ373728 |pid:none) Helia...23_1( FJ373723 |pid:none) Helianthus annuus cultivar Mandan ... 42 0.011 FJ373709_1( FJ373709 |pid:none) Hel

  16. Production and Characterization of Monoclonal Antibodies against NADPH-Cytochrome P-450 Reductases from Helianthus tuberosus1

    Science.gov (United States)

    Lesot, Agnès; Benveniste, Irène; Hasenfratz, Marie-Paule; Durst, Francis

    1992-01-01

    Monoclonal antibodies (mAbs) against a plant NADPH-cytochrome P-450 (Cyt P-450) reductase from Jerusalem artichoke (Helianthus tuberosus) tuber were prepared. These antibodies were produced by hybridoma resulting from the fusion of spleen cells from a rat immunized with a purified preparation of the reductase and mouse myeloma cells. The mAbs thus obtained were screened for their interaction with the reductases, first in western dots and then in blots, and for their ability to inhibit the NADPH-cytochrome c (Cyt c) reductase activity from Jerusalem artichoke microsomes. Among the 11 clones giving a positive response on western blots, only 6 were also able to inhibit microsomal NADPH-Cyt c reductase activity, and the microsomal Cyt P-450 monooxygenase activities dependent upon electrons transferred by the reductase. Thus, two families of mAbs were characterized: a family of mAbs that interact with epitopes of the reductase implicated in the reduction of Cyt P-450 by NADPH (binding sites for NADPH, flavin mononucleotide, flavin adenine dinucleotide, and Cyt P-450), and a structural family, whose members recognize epitopes outside the active site of the reductases. These mAbs specifically recognize the reductase, and all of them interact with all of the isoforms, indicating that important primary or secondary structural analogies exist between the isoforms, not only at the active site, but also at the level of epitopes not directly associated with catalytic activity. Images Figure 1 Figure 2 Figure 3 PMID:16653138

  17. Cultivar and Metal-Specific Effects of Endophytic Bacteria in Helianthus tuberosus Exposed to Cd and Zn

    Directory of Open Access Journals (Sweden)

    Blanca Montalbán

    2017-09-01

    Full Text Available Plant growth promoting endophytic bacteria (PGPB isolated from Brassica napus were inoculated in two cultivars of Helianthus tuberosus (VR and D19 growing on sand supplemented with 0.1 mM Cd or 1 mM Zn. Plant growth, concentrations of metals and thiobarbituric acid (TBA reactive compounds were determined. Colonization of roots of H. tuberosus D19 by Pseudomonas sp. 262 was evaluated using confocal laser scanning microscopy. Pseudomonas sp. 228, Serratia sp. 246 and Pseudomonas sp. 262 significantly enhanced growth of H. tuberosus D19 exposed to Cd or Zn. Pseudomonas sp. 228 significantly increased Cd concentrations in roots. Serratia sp. 246, and Pseudomonas sp. 256 and 228 resulted in significantly decreased contents of TBA reactive compounds in roots of Zn exposed D19 plants. Growth improvement and decrease of metal-induced stress were more pronounced in D19 than in VR. Pseudomonas sp. 262-green fluorescent protein (GFP colonized the root epidermis/exodermis and also inside root hairs, indicating that an endophytic interaction was established. H. tuberosus D19 inoculated with Pseudomonas sp. 228, Serratia sp. 246 and Pseudomonas sp. 262 holds promise for sustainable biomass production in combination with phytoremediation on Cd and Zn contaminated soils.

  18. Sequence-specific H NMR assignments and secondary structure in the sea anemone polypeptide Stichodactyla helianthus neurotoxin I

    International Nuclear Information System (INIS)

    Fogh, R.H.; Mabbutt, B.C.; Kem, W.R.; Norton, R.S.

    1989-01-01

    Sequence-specific assignments are reported for the 500-MHz H nuclear magnetic resonance (NMR) spectrum of the 48-residue polypeptide neurotoxin I from the sea anemone Stichodactyla helianthus (Sh I). Spin systems were first identified by using two-dimensional relayed or multiple quantum filtered correlation spectroscopy, double quantum spectroscopy, and spin lock experiments. Specific resonance assignments were then obtained from nuclear Overhauser enhancement (NOE) connectivities between protons from residues adjacent in the amino acid sequence. Of a total of 265 potentially observable resonances, 248 (i.e., 94%) were assigned, arising from 39 completely and 9 partially assigned amino acid spin systems. The secondary structure of Sh I was defined on the basis of the pattern of sequential NOE connectivities. NOEs between protons on separate strands of the polypeptide backbone, and backbone amide exchange rates. Sh I contains a four-stranded antiparallel β-sheet encompassing residues 1-5, 16-24, 30-33, and 40-46, with a β-bulge at residues 17 and 18 and a reverse turn, probably a type II β-turn, involving residues 27-30. No evidence of α-helical structure was found

  19. Utilización del cultivo plurianual de pataca (Helianthus tuberosus L.) para la producción de hidratos de carbono fermentables a partir de los tallos

    OpenAIRE

    Sanz Gallego, Marina

    2012-01-01

    La pataca (Helianthus tuberosus L.) es una especie de cultivo con un alto potencial en la producción de hidratos de carbono de reserva en forma de polifructanos, especialmente inulina, que se acumulan temporalmente en los tallos en forma de polisacáridos para translocarse posteriormente a los tubérculos, donde son almacenados. Aunque tradicionalmente el producto de interés del cultivo son los tubérculos, que acumulan gran cantidad de hidratos de carbono fermentables (HCF) cuando se recogen al...

  20. Effect of Chlorocholine Chloride (CCC on the Plants’ Height and Inulin Content in Jerusalem Artichoke (Helianthus tuberosus L.

    Directory of Open Access Journals (Sweden)

    Mikołaj Wawrzyniak

    2016-11-01

    Full Text Available Jerusalem artichoke (Helianthus tuberosus L. is herbaceous perennial plant rich in inulin and useful source of biomass. Due to its low agricultural requirements and high adaptability, it can provide very high biomass yields even on low quality sites. The plant is used in food industry, bio-fuel production, forage, pharmacy and nutrition. Its tubers accumulate approx. 10-20% of inulin in fresh weight. Currently, the use of the Helianthius tuberosus L. as a potential dietary strategy in patients affected by type 2 Diabetes is challenge. Moreover, deep understanding of the relationship between diet and composition of gut microbiota can bring the new insight in the treatment of inflammatory dependent diseases. The aim of this study was to examine an effect of plant growth retardant Chlorocholine Chloride (CCC on the plants’ height of H. tuberosus and inulin content in the tubers. We examined in the field a procedure for its shoots reduction. Material for the experiment were bought in a Polish commercial company and 528 tubers were planted in field in the middle of April 2014. Then, half of them were sprayed with 0.75% retardant of CCC . Furthermore, every week for 12 following weeks, the plants’ heights were measured. After the vegetation was over, 6 tubers for each treatment were dug out and chemically analyzed for inulin content using High Pressure Size Exclusion Chromatography. After first week of CCC use, 16% decrease of the heights plants was observed. Height of plants sprayed with CCC were significantly different comparing to Control. Weekly growth was significantly  slower in plants sprayed with CCC on first three weeks after applying retardant. Differences in plants height sustain to the end of measurements. Used retardant and its concentration did not affect the inulin content of the tubers.

  1. Nuclear magnetic resonance study of the solution properties of the polypeptide neurotoxin I from the sea anemone Stichodactyla helianthus

    International Nuclear Information System (INIS)

    Norton, R.S.; Cossins, A.I.; Kem, W.R.

    1989-01-01

    The solution properties of the polypeptide neurotoxin I from the sea anemone Stichodactyla helianthus (Sh I) have been investigated by high-resolution H nuclear magnetic resonance (NMR) spectroscopy at 300 MHz. The pH dependence of the spectra has been examined over the range 1.1-12.2 at 27 degree C. Individual pK a values have been obtained for the α-ammonium group of Ala-1 (8.6) and the side chains of Glu-8 (3.7), Tyr-36 (10.9), and Tyr-37 (10.8). For the remaining seven carboxyl groups in the molecule, four pK a values can be clearly identified. The five Lys residues titrate in the range 10.5-11, but individual pK a values could not be obtained because of peak overlap. Conformational changes associated with the protonation of carboxylates occur below pH 4, while in the alkaline pH range major unfolding occurs above pH 10. The molecule also unfolds at elevated temperatures. Exchange of the backbone amide protons has been monitored at various values of pH and temperature in the ranges pH 4-5 and 12-27 degree C. Comparison of these properties of Sh I in solution with those of the related polypeptides anthopleurin A and Anemonia sulcata toxins I and II indicates that Sh I is less stable thermally and that there are some significant differences in the ionic interactions that maintain the tertiary structure. The solvent accessibility of aromatic residues has been probed with photochemically induced dynamic nuclear polarization NMR at 360 MHz

  2. Elicitation of Jerusalem artichoke (Helianthus tuberosus L.) cell suspension culture for enhancement of inulin production and altered degree of polymerisation.

    Science.gov (United States)

    Ma, Chunquan; Zhou, Dong; Wang, Haitao; Han, Dongming; Wang, Yang; Yan, Xiufeng

    2017-01-01

    Plant cell suspension cultures have emerged as a potential source of secondary metabolites for food additives and pharmaceuticals. In this study inulin accumulation and its degree of polymerisation (DP) in the treated cells in the same medium were investigated after treatment with six types of elicitors. An in vitro cell suspension culture of Jerusalem artichoke (Helianthus tuberosus L.) was optimised by adding an extra nitrogen source. According to the growth kinetics, a maximum biomass of 5.48 g L -1 was obtained from the optimal cell suspension medium consisted of Murashige and Skoog basic medium (MS) + 1.0 mg L -1 α-naphthalene acetic acid (NAA) + 1.0 mg L -1 6-benzylaminopurine (6-BA) + 0.5 mg L -1 proline + 1.0 mg L -1 glutamine. Methyl jasmonate (MeJA, 250 µmol L -1 ) treatment for 15 days led to the highest levels of inulin (2955.27 ± 9.81 mg L -1 compared to control of 1217.46 ± 0.26 mg L -1 ). The elicited effect of five elicitors to the suspension cells of Jerusalem artichoke is as follows: AgNO 3 (Ag, 10 µmol L -1 ), salicylic acid (SA, 75 µmol L -1 ), chitosan (KJT, 40 mg L -1 ), Trichoderma viride (Tv, 90 mg L -1 ), yeast extract (YE, 0.25 mg L -1 ), and the corresponding content of inulin is increased by 2.05-, 1.93-, 1.76-, 1.44- and 1.18-fold compared to control, respectively. The obvious effect on the percentage of lower DP in inulin was observed in cells treated with 40 mg L -1 KJT, 0.25 mg L -1 YE and 10 µmol L -1 Ag. Among the six types of elicitors, the descending order of inulin content is MeJA > Ag > SA > KJT > Tv > YE. For the purpose inulin with lower DP and its application to prebiotic food, three elicitors, including KJT, YE and Ag, can be used for the elicitation. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

  3. Zinc Fertilization Effects on Seed Cadmium Accumulation in Oilseed and Grain Crops Grown on North Dakota Soils Efecto de la Fertilización con Zinc en la Acumulación de Cadmio en Semillas Oleaginosas y Cereales producidos en Suelos de Dakota del Norte

    Directory of Open Access Journals (Sweden)

    Gonzalo A Rojas-Cifuentes

    2012-03-01

    Dakota del Norte que representaban diferentes series de suelo durante 1994 y 1995. Experimento 1, nueve cultivos fueron evaluados con y sin la adición de 25 kg Zn ha-1. Entre los cultivos evaluados, la acumulación más alta de Cd en las semillas ocurrió en lino (Linum usitatissimum L. seguido por girasol (Helianthus annuus L., soya (Glycine max [L.] Merr., y trigo duro (Triticum turgidum L. var. durum. Experimento 2, dos cultivares de trigo duro y un cultivar de lino fueron evaluados bajo tres tratamientos de fertilización, 0, 5, y 25 kg Zn ha-1. En este estudio nuevamente la acumulación de Cd fue más alta en lino. De acuerdo con los resultados de ambos estudios, la adición de Zn no produjo una disminución constante del contenido Cd en las semillas, incluso cuando existían diferencias significativas el nivel de reducción fue bajo, lo cual probablemente no afectaría la comerciabilidad de cultivos como lino, girasol, soya, y trigo duro.

  4. Helianthus tuberosus L.

    African Journals Online (AJOL)

    Jane

    2011-08-17

    Aug 17, 2011 ... experiment was designed according to the “split plots on randomized complete block” experimental design with three ... yields per decare were 5149.78 kg in the control plots and 3327.27 kg in the plots of red skin of. Jerusalem ... 9037. Figure 1. Monthly temperature, humidity and rainfall of Konya region.

  5. Effect of polyethylene and organic mulches in different intervals of irrigation on morphological characteristics and grain yield of sunflower (Helianthus annus L.

    Directory of Open Access Journals (Sweden)

    R. Mahdipour Afra

    2016-05-01

    Full Text Available In order to investigate the effects of polyethylene and organic mulches in different Irrigation intervals on morphological characteristics and seed grain of sunflower (Helianthus annus L. hybrid Azrgol, an experiment was conducted in split-plot design based on randomized complete blocks with three replications at research farm of college of Aboureihan, University of Tehran during year of 2009. Main factor was three irrigation interval including of 7, 12 and 17 days and sub-factors were treatments without mulch as control and different types of mulch (polyethylene, cow manure including of 8.5 t.ha-1,17 t.ha-1, 25 t.ha-1, wheat stubble mulch in three levels of 2.5, 5.5 and 7.5 t.ha-1. Plant height, head diameter, seed number in each head, 1000-seed weight, seed yield, oil yield, harvest index were investigated. The results indicated that the effect of irrigation period and the effect of mulches for all measured traits were significant. Highest seed yield with average of 2.965 t.ha-1 was obtained from 7 days irrigation and also polyethylene mulch and stubble mulch level three in different irrigation periods, had the highest yield. The overall results showed that, using mulches by reducing irrigation water use can increases the quality and quantity seed yield. Regarding the results of the study and non-toxic effects of stubble mulches in agriculture, we suggest their usage.

  6. Fructan:fructan 1-fructosyltransferase and inulin hydrolase activities relating to inulin and soluble sugars in Jerusalem artichoke (Helianthus tuberosusLinn.) tubers during storage.

    Science.gov (United States)

    Maicaurkaew, Sukanya; Jogloy, Sanun; Hamaker, Bruce R; Ningsanond, Suwayd

    2017-03-01

    Influences of harvest time and storage conditions on activities of fructan:fructan1-fructosyltransferase (1-FFT) and inulin hydrolase (InH) in relation to inulin and soluble sugars of Jerusalem artichoke ( Helianthus tuberosus L.) tubers were investigated. Maturity affected 1-FFT-activity, inulin contents, and inulin profiles of the tubers harvested between 30 and 70 days after flowering (DAF). Decreases in 1-FFT activity, high molecular weight inulin, and inulin content were observed in late-harvested tubers. The tubers harvested at 50 DAF had the highest inulin content (734.9 ± 20.5 g kg -1 DW) with a high degree of polymerization (28% of DP >30). During storage of the tubers, increases in InH activity (reached its peak at 15 days of storage) and gradual decreases in 1-FFT activity took placed. These changes were associated with inulin depolymerization, causing decreases in inulin content and increases in soluble sugars. As well, decreasing storage temperatures would retain high inulin content and keep low soluble sugars; and freezing at -18 °C would best retard 1-FFT, InH, and inulin changes.

  7. Effect of feeding low-fiber fraction of air-classified sunflower (Helianthus annus L.) meal on laying hen productive performance and egg yolk cholesterol.

    Science.gov (United States)

    Laudadio, V; Ceci, E; Lastella, N M B; Tufarelli, V

    2014-11-01

    The present study was designed to determine the effect on laying performance and egg quality resulting from total substitution of soybean meal (SBM) with low-fiber sunflower meal (SFM; Helianthus annus L.) meal in diet of hens. ISA Brown layers, 28 wk of age, were randomly allocated to 2 dietary treatments and fed for 10 wk. The hens were kept in a free-range environment and fed 2 wheat middling-based diets consisting of a control diet, which contained SBM (153 g/kg of diet), and a test diet containing low-fiber SFM (160 g/kg of diet) as the main protein source. Each dietary treatment was replicated 4 times. Low-fiber SFM was obtained by a combination of sieving and air classification processes. Feed consumption was recorded daily and egg production was calculated on a hen-day basis; eggs from each group were collected weekly to evaluate egg components and quality. The total substitution of SBM with low-fiber SFM had no adverse effect on growth performance of laying hens. Egg production and none of egg quality traits examined were influenced by dietary treatment, except for yolk color (P sunflower meal may be a valid alternative in diets for laying hens to improve egg quality and to develop low-cholesterol eggs. ©2014 Poultry Science Association Inc.

  8. Agronomic characteristic of a dwarf germplasm sunflower line

    OpenAIRE

    Vassilevska-Ivanova Roumiana; Tcekova Zoja

    2005-01-01

    A new sunflower (Helianthus annuus L) dwarf line, HA-ARG-1, has been developed after interspecific hybridization between cultivated sunflower H. annuus and wild annual silver-leaf sunflower H. argophyllus. Plants were selected for reduced height and multiple branching characteristics. The agronomic, morphologic and oil content characteristics of the line were analyzed. Isolation of similar dwarfed lines illustrates the importance of using the wild sunflower germplasms in the development of sp...

  9. Monitoring the physicochemical features of sunflower oil and French fries during repeated microwave frying and deep-fat frying; Seguimiento de las características fisicoquímicas de aceite de girasol y patatas durante frituras repetidas mediante microondas y freidora

    Energy Technology Data Exchange (ETDEWEB)

    Aydınkaptan, E.; Barutçu Mazı, I.

    2017-07-01

    This study investigates the effects of repeated microwave frying at different power levels (360W, 600W, 900W) and deep-fat frying on sunflower oil and French fries. The intermittent batch frying cycle was repeated 15 times a day during five consecutive days. The fatty acid profile and physicochemical properties including free fatty acid (FFA), extinction coefficient (K270), total polar compound (TPC), color, viscosity, refractive index of the sunflower oil were determined each day. At the end of the frying period, the highest values of viscosity (76.29cp) and refractive index (1.4738) were detected in microwave frying at 900W power level. TPC level exceeded 25% after the third day of microwave frying at all power levels. The FFA values during microwave frying increased progressively from 0.157% to 0.320- 0.379% on the fifth day. The loss of polyunsaturated fatty acids was 37-53% more in the case of microwave frying. The oil quality during microwave frying did not have a significant impact on the oil absorption and total color change of the French fries. Microwave frying, even at higher levels, provided lower oil (8.60-12.32%wb) and moisture contents (35.47-41.24%) compared to deep frying. Microwave frying caused longer processing time and significantly higher levels of degradation of the sunflower oil at all power levels compared to deep frying. However, microwave frying has the advantage of reducing oil absorption. The oil content of French fries was lowered by 20-33% (wb) at the highest power level. [Spanish] Se estudia los efectos de frituras repetidas mediante microondas a diferentes niveles de potencia (360W, 600W, 900W) y frituras en freidora sobre la estabilidad del aceite de girasol y la calidad de las patatas fritas. El ciclo de fritura intermitente se repitió 15 veces al día durante cinco días consecutivos. Se determinó el perfil de ácidos grasos y las propiedades fisicoquímicas incluyendo ácidos grasos libre (FFA), coeficiente de extinción (K270

  10. Study of qualitative and quantitative yield and some agronomic characteristics of sunflower (Helianthus annus L. in response of seed inoculation with PGPR in various levels of nitrogen fertilizer

    Directory of Open Access Journals (Sweden)

    H. Nazarly

    2016-05-01

    Full Text Available In order to study the qualitative and quantitative yield and some agronomic characteristics of sunflower (Helianthus annus L. in response to seed inoculation with PGPR under various levels of nitrogen fertilizer, a factorial experiment was conducted based on a randomized complete block design with three replications in field experimental University of Mohaghegh Ardabili during growing season of 2009-2010. Factors were nitrogen fertilizer in three levels (0, 80 and 160 kg N ha-1 as urea and seed inoculation with plant growth promoting rhizobacteria in four levels containing, without inoculation (as control, seed inoculation with Azotobacter chroococcum strain 5, Azospirillum lipoferum strain OF, Psedomunas strain 186. Results indicated that nitrogen levels and seed inoculation with Plant Growth Promoting Rhizobacteria (PGPR had significant effects on all of characteristics studied (except grain 1000 weight and stem diameter. Grain yield, plant height, head diameter, seed number per head, , yield and oil percentage, yield and protein percentage increased with increasing of nitrogen fertilizer and application of seed inoculation with PGPR. Response of grain yield wasn't the same for various levels of nitrogen fertilizer and seed inoculation with PGPR. The highest grain yield belonged to application of 160 kg N ha-1 and seed inoculation with Azotobacter. Means comparison showed that treatment compounds N160 × without inoculation with PGPR and N80 × seed inoculation with PGPR Azotobacter had similar grain yields. Thus, it can be suggested that in order to increasing of grain yield seed should be inoculated with Azotobacter bacteria × 80 kg N/ha in conditions of Ardabil region.

  11. Imobilização da inulinase de Kluyveromyces marxianus para a hidrólise de extratos de Helianthus tuberosus L.

    Directory of Open Access Journals (Sweden)

    Gaspari Jefferson Willians de

    1999-01-01

    Full Text Available Este trabalho estudou a imobilização da inulinase de Kluyveromyces marxianus em diferentes suportes, com a finalidade de promover a bioconversão da inulina de Helianthus tuberosus. A inulina de H. tuberosus foi extraída dos tubérculos, desproteinizada e concentrada a 25% de açúcares redutores totais (ART. A inulinase de K. marxianus foi concentrada em evaporador rotativo e imobilizada em quitina (com e sem glutaraldeído, alginato sódico (concentrações de 2 e 4%, pectina, membrana de diálise e sílica de porosidade controlada (SPC. Em quitina obteve-se taxas de imobilização de 73Unidades/g com glutaraldeído e 48 U/g sem glutaraldeído, mas a hidrólise foi baixa em ambos os tratamentos, o equivalente a 2,4% por hora. Em gel de alginato sódico, nas concentrações de 2 e 4%, converteram-se, respectivamente, 12% e 26%, em 1h. A imobilização em pectina foi impossibilitada devido à presença de pectinase no extrato enzimático. A contenção da enzima com o substrato em membrana de diálise proporcionou uma recuperação de 50% do ART em 6h. A SPC apresentou taxa de imobilização de 43 U/g sílica, proporcionando a hidrólise de 43% em 1h, entretanto sua atividade foi se exaurindo rapidamente durante o processo devido à inativação natural da enzima e a conformação dos poros da SPC.

  12. Irrigation of Castor Bean (Ricinus communis L. and Sunflower (Helianthus annus L. Plant Species with Municipal Wastewater Effluent: Impacts on Soil Properties and Seed Yield

    Directory of Open Access Journals (Sweden)

    Vasileios A. Tzanakakis

    2011-11-01

    Full Text Available The effects of plant species (castor bean (Ricinus communis L. versus sunflower (Helianthus annus L. and irrigation regime (freshwater versus secondary treated municipal wastewater on soil properties and on seed and biodiesel yield were studied in a three year pot trial. Plant species were irrigated at rates according to their water requirements with either freshwater or wastewater effluent. Pots irrigated with freshwater received commercial fertilizer, containing N, P, and K, applied at the beginning of each irrigation period. The results obtained in this study showed that irrigation with effluent did not result in significant changes in soil pH, soil organic matter (SOM, total kjeldahl nitrogen (TKN, and dehydrogenase activity, whereas soil available P was found to increase in the upper soil layer. Soil salinity varied slightly throughout the experiment in effluent irrigated pots but no change was detected at the end of the experiment compared to the initial value, suggesting sufficient salt leaching. Pots irrigated with effluent had higher soil salinity, P, and dehydrogenase activity but lower SOM and TKN than freshwater irrigated pots. Sunflower showed greater SOM and TKN values than castor bean suggesting differences between plant species in the microorganisms carrying out C and N mineralization in the soil. Plant species irrigated with freshwater achieved higher seed yield compared to those irrigated with effluent probably reflecting the lower level of soil salinity in freshwater irrigated pots. Castor bean achieved greater seed yield than sunflower. Biodiesel production followed the pattern of seed yield. The findings of this study suggest that wastewater effluent can constitute an important source of irrigation water and nutrients for bioenergy crop cultivations with minor adverse impacts on soil properties and seed yield. Plant species play an important role with regard to the changes in soil properties and to the related factors of

  13. Variation for seed phytosterols in sunflower germplasm

    Science.gov (United States)

    Sunflower (Helianthus annuus L.) seeds and oils are rich sources of phytosterols, which are important compounds for human nutrition. There is limited information on variability for seed phytosterols in sunflower germplasm. The objective of the present research was to evaluate kernel phytosterol cont...

  14. Mutagenic effectiveness and efficiency in varieties of sunflower ...

    African Journals Online (AJOL)

    The effect of single treatment with gamma-rays, sodium azide and combination treatments of gammarays and sodium azide on seed germination, seedling survival, pollen fertility and seed set in sunflower (Helianthus annuus L.) M2 generation was studied in the varieties of USH-430 and SHSF-333. There was gradual ...

  15. Synergistic effect of Glomus fasciculatum and Trichoderma ...

    African Journals Online (AJOL)

    The effect of two soil amendments of tannery sludge (10% and 20%) on growth and metal uptake of Helianthus annuus L. was studied under three treatments of rhizosphere and mycorrhizal fungi. Trichoderma pseudokoningii Rifai was used as rhizosphere fungal inoculum (F) and Glomus fasciculatum (Thax.) Gerd.

  16. The Effects of Dehulling on Physicochemical Properties of Seed Oil ...

    African Journals Online (AJOL)

    Sunflower (Helianthus annuus L.) is an important cash crop for production of edible oil in Tanzania. The annual production of sunflower seeds ranges between 75,000 to. 100,000 tons from 2001 to 2005 with Singida and Rukwa region being the leading producers. The production has been dramatically increasing to more ...

  17. Temporal dynamics of light and nitrogen vertical distributions in canopies of sunflower, kenaf and cynara

    NARCIS (Netherlands)

    Archontoulis, S.V.; Vos, J.; Yin, X.; Bastiaans, L.; Danalatos, N.G.; Struik, P.C.

    2011-01-01

    To enhance eco-physiological and modelling studies, we quantified vertical distributions of light and nitrogen in canopies of three Mediterranean bio-energy crops: sunflower (Helianthus annuus), kenaf (Hibiscus cannabinus) and cynara (Cynara cardunculus). Field crops were grown with and without

  18. Journal of Applied Sciences and Environmental Management - Vol ...

    African Journals Online (AJOL)

    Simulated Acid Rain-induced Alterations in Flowering, Leaf Abscission and Pollen Germination in Sunflower (Helianthus annuus L.) EMAIL FREE FULL TEXT ... Evaluation of Concentrations and Human Health Risk of Cu, Zn, Fe in Two Periwinkles Species from Three Local Government Areas, Bayelsa State, Nigeria.

  19. Measured soil water evaporation as a function of the square root of time and reference ET

    Science.gov (United States)

    Sunflower (Helianthus annuus L.) is a drought-adapted crop with a short growing season that reduces irrigation requirements and makes it ideal for regions with limited irrigation water supplies. Our objectives were a) to evaluate the yield potential of sunflower under deficit irrigation and b) det...

  20. Effets de vieillissement accéléré sur la germination et l ...

    African Journals Online (AJOL)

    103-118. [19]Grabe, D.F. (1970). Tetrazolium test hand book. For agricultural seed contribution N° 29: Hand book on seed testing. Proceedings of the Association of official Seed ... Physiol Plant 1996;97: 104-10. [23]Corbineau F., Gay-Mathiey M., Vinel D., Côme D.,. 2002. Decrease in sunflower (Helianthus annuus) seed.

  1. Download this PDF file

    African Journals Online (AJOL)

    user

    2011-03-21

    Mar 21, 2011 ... Two field experiments were established at Research Farm, Bahauddin Zakariya University, (BZU). Multan, Pakistan, during the spring season of 2009 to study the interactive effect of sunflower. (Helianthus annuus L.) hybrids in terms of growth, fraction of intercepted radiation (Fi), intercepted.

  2. Assessment of the effect of salinity on the early growth stage of the ...

    African Journals Online (AJOL)

    SERVER

    2008-03-18

    Mar 18, 2008 ... Salinity is one of the main limiting factors for agricultural production. This is especially true in arid and semi-arid regions of the world like Turkey. The objective of this study was to determine if the effect of salt concentration on the physiological and physiological features of the sunflower (Helianthus annuus.

  3. Estimation of genetic parameters for yield components and seed ...

    African Journals Online (AJOL)

    Helianthus annuus L.) breeding lines were studied using line x tester analysis. Eight lines and six testers along with their 48 F1 single cross combinations and two checks were planted in simple lattice design with two replications. The results of ...

  4. Effect of intercropping sunflower with soybean at different interrow ...

    African Journals Online (AJOL)

    Sunflower (Helianthus annuus L.) and soybean (Glycine max) were relatively new crops of economic significance in Uganda before 1990s compared to traditional cash crops such as cotton, tea and coffee. By 2000 many smallholder farmers in the Mid-Northern Agro-ecological Zone of Uganda started planting sunflower ...

  5. Registration of two confection sunflower germplasm Lines, HA-R10 and HA-R11, Resistant to sunflower rust

    Science.gov (United States)

    Two confection sunflower (Helianthus annuus L.) germplasm lines, HA-R10 (Reg. No.xxx, PI670043) and HA-R11 (Reg. No.xxx, PI670044) were developed by the USDA-ARS Sunflower and Plant Biology Research Unit in collaboration with the North Dakota Agricultural Experiment Station and released December, 20...

  6. Registration of two double rust resistant germplasms, HA-R12 and HA-R13 for confection sunflower

    Science.gov (United States)

    The confection sunflower (Helianthus annuus L.) germplasms HA-R12 (Reg. No. ______, PI 673104) and HA-R13 (Reg. No. ______, PI 673105) were developed by the USDA-ARS, Sunflower and Plant Biology Research Unit in collaboration with the North Dakota Agricultural Experiment Station, and released in Jul...

  7. Mutagenic effectiveness and efficiency in varieties of sunflower ...

    African Journals Online (AJOL)

    GREGORY

    2010-09-27

    Sep 27, 2010 ... The effect of single treatment with gamma-rays, sodium azide and combination treatments of gamma- rays and sodium azide on seed germination, seedling survival, pollen fertility and seed set in sunflower. (Helianthus annuus L.) M2 generation was studied in the varieties of USH-430 and SHSF-333.

  8. Utilization of sunflower crop wild relatives for cultivated sunflower improvement

    Science.gov (United States)

    Sunflower (Helianthus annuus L.) is one of the few crops native to the U.S. The current USDA-ARS-NPGS crop wild relatives sunflower collection is the largest extant collection in the world, containing 2,519 accessions comprised of 53 species; 39 perennial and 14 annual. To fully utilize gene bank co...

  9. Genotype dependent callus induction and shoot regeneration in ...

    African Journals Online (AJOL)

    SERVER

    2007-07-04

    Jul 4, 2007 ... This study aims to observe the effect of genotype, hormone and culture conditions on sunflower. (Helianthus annuus L.) callus induction and indirect plant regeneration. Calli were obtained from hypocotyl and cotyledon explants of five different sunflower genotypes; Trakya 80, Trakya 129, Trakya.

  10. The effects of NaCl priming on salt tolerance in sunflower ...

    African Journals Online (AJOL)

    This experiment was conducted to evaluate the effects of NaCl priming with KNO3 on the germination traits and seedling growth of four Helianthus annuus L. cultivars under salinity conditions. Seeds of four spring sunflower (Armawireski, Airfloure, Alestar and Ismailli) were primed with KNO3 (-1.0 M Pa) for 24 h in ...

  11. Effect of intercropping sunflower with soybean at different inter- row ...

    African Journals Online (AJOL)

    ACSS

    Sunflower (Helianthus annuus L.) and soybean (Glycine max) were relatively new crops of economic significance in Uganda before 1990s compared to traditional cash crops such as cotton, tea and coffee. By 2000 many smallholder farmers in the Mid-Northern Agro-ecological Zone of Uganda started planting sunflower ...

  12. Simulated Acid Rain-induced Alterations in Flowering, Leaf ...

    African Journals Online (AJOL)

    distilled water-7.0 (control), 5.7, 4.5 and 3.0] on leaf abscission, flowering and pollen germination in sunflower (Helianthus annuus L.) cv. 'Morden' as test system under field conditions in sandy loam soil with sufficient organic matter, pale yellow in ...

  13. Response of sunflower hybrids to management practices under ...

    African Journals Online (AJOL)

    Two field experiments were established at Research Farm, Bahauddin Zakariya University, (BZU) Multan, Pakistan, during the spring season of 2009 to study the interactive effect of sunflower (Helianthus annuus L.) hybrids in terms of growth, fraction of intercepted radiation (Fi), intercepted photo-synthetically active ...

  14. Tillage effects on soil. Physical properties and sunflower ...

    African Journals Online (AJOL)

    Soil physical properties and sunflower (Helianthus annuus) yield under convectional tillage (CT) and zero-tillage (Z,TJ. was monitored for 3 consecutive years in Ilorin, Southern Guinea Savannah zone of Nigeria (SGSZN). While bulk density of CT increased slightly over the years, significant decrease of 12 and 8% were ...

  15. Registration of an oilseed sunflower germplasm line HA-BSR1 highly tolerant to Sclerotinia basal stalk rot

    Science.gov (United States)

    Basal stalk rot (BSR) caused by Sclerotinia sclerotiorum (Lib.) de Bary is a devastating disease that causes a significant damage to worldwide sunflower (Helianthus annuus L.) production by reducing seed yield and quality. The objective of this research was to develop highly BSR tolerant sunflower g...

  16. A crop model-based approach for sunflower yields

    NARCIS (Netherlands)

    Belo Leite, Dal J.G.; Nunes Vieira da Silva, J.V.; Barbosa Justino, F.; Ittersum, van M.K.

    2014-01-01

    Pushed by the Brazilian biodiesel policy, sunflower (Helianthus annuus L.) production is becoming increasingly regarded as an option to boost farmers' income, particularly under semi-arid conditions. Biodiesel related opportunities increase the demand for decision-making information at different

  17. Cross reaction between P-61 sunflower seedlings oleosomal protein ...

    African Journals Online (AJOL)

    A true triacylglycerol lipase was detected in germinating sunflower (Helianthus annuus L.) seedlings associated to oleosomes. This enzyme that has not yet been identified was partially purified as shown by sodium dodecyl sulphate polyacrylamide gel electrophoresis (SDS PAGE) (10%); two protein bands, P-61 and P-66 ...

  18. Sunflower disease and insect pests in Pakistan: A review | Mukhtar ...

    African Journals Online (AJOL)

    Sun flower (Helianthus annuus L.) is one of the important oil seed crops and potentially fit in agricultural system and oil production sector of Pakistan. Various diseases, insects and nematodes attack damage the sunflower crop, results a wide range of loss in production and yield. Sunflower is susceptible to diseases of ...

  19. Mesophyll conductance to CO2 transport estimated by two independent methods: effect of variable CO2 concentration and abscisic acid

    Czech Academy of Sciences Publication Activity Database

    Vrábl, D.; Vašková, M.; Hronková, Marie; Flexas, J.; Šantrůček, Jiří

    2009-01-01

    Roč. 60, č. 8 (2009), s. 2315-2323 ISSN 0022-0957 R&D Projects: GA AV ČR(CZ) IAA601410505 Institutional research plan: CEZ:AV0Z50510513 Keywords : Carbon dioxide * mesophyll conductance * Helianthus annuus Subject RIV: ED - Physiology Impact factor: 4.271, year: 2009

  20. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    The distribution of microsatellites in exons, and their association with gene ontology (GO) terms is explored to elucidate patterns of microsatellite evolution in the common sunflower, Helianthus annuus. The relative position, motif, size and level of impurity were estimated for each microsatellite in the unigene database ...

  1. Genotype dependent callus induction and shoot regeneration in ...

    African Journals Online (AJOL)

    This study aims to observe the effect of genotype, hormone and culture conditions on sunflower (Helianthus annuus L.) callus induction and indirect plant regeneration. Calli were obtained from hypocotyl and cotyledon explants of five different sunflower genotypes; Trakya 80, Trakya 129, Trakya 259, Trakya 2098 and ...

  2. The effect of plant density with different row spacing on quality of the ...

    African Journals Online (AJOL)

    However, the superiority in the quality of the fatty acid composition was observed in the crops grown at lower density. Therefore, the row spacing of 0.8 m seems to be a good compromise between achene production and good acid composition of oil. Key words: Helianthus annuus L, plant distribution, plant density, achene ...

  3. MADS-box genes controlling inflorescence morphogenesis in sunflower

    NARCIS (Netherlands)

    Shulga, O.A.; Shchennikova, A.V.; Angenent, G.C.; Skryabin, K.G.

    2008-01-01

    MADS-box genes play an important role in plant ontogeny, particularly, in the regulation of floral organ induction and development. Eight full-length cDNAs of HAM genes (Helianthus annuus MADS) have been isolated from sunflower. They encode MADS-box transcription factors expressed in inflorescence

  4. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics. ASA EBRAHIMI. Articles written in Journal of Genetics. Volume 97 Issue 1 March 2018 pp 189-203 RESEARCH ARTICLE. Identification of SSR and retrotransposon-based molecular markers linked to morphological characters in oily sunflower ( Helianthus annuus L.) under natural and ...

  5. Plant growth promotion properties of bacterial strains isolated from the rhizosphere of the Jerusalem artichoke (Helianthus tuberosus L.) adapted to saline-alkaline soils and their effect on wheat growth.

    Science.gov (United States)

    Liu, Xiaolin; Li, Xiangyue; Li, Yan; Li, Runzhi; Xie, Zhihong

    2017-03-01

    The Jerusalem artichoke (JA; Helianthus tuberosus), known to be tolerant to saline-alkaline soil conditions, has been cultivated for many years in the Yellow River delta, Shandong Province coastal zone, in China. The aim of our study was to isolate nitrogen-fixing bacteria colonizing the rhizosphere of JA and to characterize other plant growth promotion properties. The ultimate goal was to identify isolates that could be used as inoculants benefiting an economic crop, in particular for improving wheat growth production in the Yellow River delta. Bacterial strains were isolated from the rhizosphere soil of JA on the basis of growth on nitrogen-free Ashby medium. Identification and phylogenetic analysis was performed after nucleotide sequencing of 16S rRNA gene. Plant-growth-promoting traits, such as nitrogen fixation activity, phosphate solubilization activity, indole-3-acetic acid production, were determined using conventional methods. Eleven strains were isolated and 6 of them were further examined for their level of salt tolerance and their effect on plant growth promotion. Inoculation of Enterobacter sp. strain N10 on JA and wheat led to significant increases in both root and shoot dry mass and shoot height. Enterobacter sp. strain N10 appeared to be the best plant-growth-promoting rhizobacteria to increase wheat productivity in future field applications.

  6. Pest risk analysis for Conogethes punctiferalis (Yellow peach moth or castor capsule borer)

    OpenAIRE

    Food and Environment Research Agency

    2012-01-01

    This is a highly polyphagous pest, the larvae boring into fruit, seeds and stems of plants in many different families. Economic hosts grown in the UK include Allium cepa (onion), Malus (apple), Prunus (plum, cherry), Pyrus (pear), Vitis vinifera (grape vine), and Zea mays (maize). Other recorded hosts include Castanea (chestnut), Citrus, Curcuma longa (tumeric), Durio zibethinus (durian), Elettaria cardamomum (cardamom), Helianthus annuus (sunflower), Punica granatum (po...

  7. Accumulation of Cd in Indian mustard and sunflower for phytoremediation

    International Nuclear Information System (INIS)

    Okada, Satoshi; Fukutani, Satoshi; Takahashi, Tomoyuki; Fukui, Masami

    2004-01-01

    Phytoremediation is a new method that uses plants to remove contaminants from soil without affecting soil fertility. It can therefore be used for contaminated agricultural land. Indian mustard (Brassica juncea) and sunflower (Helianthus annuus L.) are used in phytoremediation to remove Cadmium (Cd), which they can accumulate in large quantities. It is important to know when plants have accumulated significant Cd, so that we can decide when the plants should be harvested and synthetic chelates applied. Brassica juncea seeds and Helianthus annuus L. seeds were planted in a field in Kyoto University Research Reactor Institute (KUR). Brassica juncea and Helianthus annuus L. were collected at time intervals ranging from 1 to 6 months and 2 to 7 weeks, respectively, after seedling emergence and the concentration of Cd in the plants was analyzed. These results indicated that Brassica juncea should be harvested before beginning flowering and Helianthus annuus L. should be harvested after it becomes old enough. The solubility of Cd in soil is enhanced when the soil is heated or dried, and black vinyl mulch was therefore used to absorb the heat from sunlight. The difference in the Cd uptake of Brassica juncea between mulching cultivation and non-mulching cultivation was investigated in a field, and this indicated that there is no probability that mulching enhances Cd uptake in plants. The solubility of Cd in soil decreases over time. Repeated pot experiments were done. We planted Brassica juncea in pots, and investigated the uptake of Cd and the solid phase fractions in which Cd was present in each pot experiment. These did not change considerably over time, indicating that age has a negligible effect on Cd uptake in plants. (author)

  8. Production and morphological components of sunflower on soil fertilized with cassava wastewater

    OpenAIRE

    Dantas, Mara Suyane Marques; Rolim, Mario Monteiro; Duarte, Anamaria de Sousa; Lima, Luiz Evandro de; Silva, Manassés Mesquita da

    2017-01-01

    ABSTRACT Agroindustrial residues, such as cassava wastewater, have been used as soil fertilizers, reducing environmental pollution and recovering nutrients. The objective of this work was to evaluate production and morphological components and oil yield of sunflower (Helianthus annuus), hybrid Helio-250, fertilized with cassava wastewater. The experiment was conducted at the Experimental Station of the Instituto Agronomico de Pernambuco, Vitória de Santo Antão, State of Pernambuco, Brazil. A ...

  9. Effects of Exogenous Spermine on Seed Germination and Early Growth of Sunflower Seeds Under Salinity Stress

    OpenAIRE

    MUTLU, Fatma; BOZCUK, Suna

    2014-01-01

    The effects of various concentrations (0.01, 1, 2mM) of spermine (Spm) on germination and some early growth parameters of sunflower ( Helianthus annuus L. cv. Santafe) seeds were investigated in media containing different concentrations of NaCl (50, 100, 200mM). Regardless of its concentrations, application of Spm under non-saline conditions remained ineffective on germination percentage as well as on the early growth parameters studied (length of radicle, fresh and dry weights). The sal...

  10. 1544- IJBCS-Article-Benedicte Deffan

    African Journals Online (AJOL)

    hp

    Le présent travail vise à évaluer les caractéristiques physico-chimiques de noix et de l'huile d'amande des premiers ... C'est un produit stable, stockable et facilement transportable. La production mondiale d'huile de coprah est d'environ 3 millions de tonnes par an. Cette huile ...... tournesol (Helianthus annuus L.) sous.

  11. Aphid (Hemiptera: Aphididae) species determined in Çanakkale Province with a new record for the aphid fauna of Turkey

    OpenAIRE

    KÖK, Şahin; KASAP, İsmail; ÖZDEMİR, Işıl

    2016-01-01

    As a result of a study conducted to determine aphid species on herbaceous plants, shrubs and trees in cultivated and uncultivated areas from 2013 to 2015 in Çanakkale Province, Turkey, 39 species and one subspecies in 24 genera of Aphididae family were determined. Of these species, Aphis sedi Kaltenbach, 1843 collected from Lampranthus sp. (Aizoaceae) was new record for the aphid fauna of Turkey. Also, Helianthus annuus L. (Asteraceae) and Pimpinella saxifraga L. (Apiaceae) were determined as...

  12. Early changes of the pH of the apoplast are different in leaves, stem and roots of Vicia faba L. under declining water availability

    Czech Academy of Sciences Publication Activity Database

    Karuppanapandian, T.; Geilfus, C.M.; Muehling, K.H.; Novák, Ondřej; Gloser, V.

    2017-01-01

    Roč. 255, FEB (2017), s. 51-58 ISSN 0168-9452 Institutional support: RVO:61389030 Keywords : xylem sap constituents * abscisic-acid * stomatal conductance * leaf apoplast * helianthus-annuus * plant-responses * intact plants * nacl stress * drying soil * guard-cells * Drought stress * Abscisic acid * Soil drying * Xylem sap * Osmolality * Water relations * Leaf water potential Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 3.437, year: 2016

  13. Enhanced Cadmium (Cd Phytoextraction from Contaminated Soil using Cd-Resistant Bacterium

    Directory of Open Access Journals (Sweden)

    Kunchaya Setkit

    2014-01-01

    Full Text Available A cadmium (Cd-resistant bacterium, Micrococcus sp. MU1, is able to produce indole-3-acetic acid and promotes root elongation and plant growth. The potential of this bacterium on enhancement of Cd uptake and bioaccumulation of Cd in Helianthus annuus L. planted in Cd-contaminated soil was evaluated in greenhouse condition. The results showed that Micrococcus sp. MU1promoted the growth of H. annuus L. by increasing the root length, stem height, dry biomass, root to shoot ratio and also significantly increased Cd accumulation in the root and above-ground tissues of H. annuus L. compared to uninoculated control. Re-inoculation with Micrococcus sp. MU1in contaminated soil helped in promoting plant growth and Cd phytoextraction throughout the cultivation period. In addition, phytoextraction coefficient and translocation factor (TF of H. annuus L. inoculated with Micrococcus sp. MU1were higher than that of uninoculated control and TF continuously increased with time. Our results suggested that Micrococcus sp. MU1 has an ability to enhance plant growth and Cd uptake in H. annuus L. Synergistic interaction between Micrococcus sp. MU1 and H. annuus L. could be further applied for Cd phytoextraction in polluted areas.

  14. Réponse de deux variétés de tournesol (Helianthus sp. à la fertilisation à base de fiente de poule sur un Hapli-Humic Ferralsol du Yongka Western Highlands Research Garden Park (YWHRGP Nkwen-Bamenda, Cameroun, Afrique centrale

    Directory of Open Access Journals (Sweden)

    Yerima, BPK.

    2014-01-01

    Full Text Available Response of Two Sunflower (Helianthus sp. Varieties to Poultry Manure Fertilization on a Hapli-Humic Ferralsol at the Yongka Western Highlands Research Garden-Park (YWHRGP Nkwen-Bamenda, Cameroon, Central Africa. An experiment on a Hapli-Humic Ferralsol was conducted at the YWHRGP, Nkwen-Bamenda, to evaluate the response of two sunflower varieties (Helianthus sp. to five levels of poultry manure (0; 1.2; 2.8; 4.2 and 5.6 Tons/ha. Italian White and African Giant varieties were used. The experiment was laid out in a randomized complete block design with three and six replications for African Giant and Italian White varieties, respectively. Poultry manure was analyzed and growth, development and yield parameters were collected. The acid soil (pH≤5.5 showed nutrient deficiencies. The poultry manure (pH=7.8 is rich in essential nutrients and had a significant effect on sunflower growth parameters. The 4.2 Tons/ha manure level maximised growth and yield parameters of the African Giant variety. For the Italian White variety, 5.6 Tons/ha manure level gave a head weight yield (0.74 Tons/ha lower than that of the African Giant (1.33 Tons/ha. Significant differences were also observed between the two varieties. However, the African Giant variety appears to be more adapted for seed production, while the Italian White variety appears to be best indicated for use as an ornamental plant or to produce cut flowers.

  15. Composición de semillas de girasol cultivadas en Argentina

    Directory of Open Access Journals (Sweden)

    Santalla, E.

    1993-06-01

    Full Text Available Constituents seed oil content, physic structure, oil seed quality and wax content are evaluated. The relations of these characters and its agroclimatic interactions facilitate the introduction of this cultivar into food and/or industrial market improving its utility and profit. Correlations coefficients on the analyzed characters are presented. Causality hypothesis on the newer tendency behaviour of this cultivar are planned. The hull content influence on oil content and like principal wax container is detached.

    Se evaluaron contenidos de aceite de los constituyentes de la semilla, estructura física, calidad del aceite de semilla y contenido de ceras. El conocimiento del comportamiento de estos caracteres, las relaciones entre ellos y su interacción con el medio agroclimático, facilita la introducción de este cultivo en el mercado alimenticio y/o industrial optimizando su rendimiento y aprovechamiento. Se presentan los valores de las correlaciones obtenidas entre los caracteres analizados. Se plantean hipótesis de causalidad sobre las nuevas tendencias de comportamiento de este cultivo. Se destaca la influencia del contenido de cascara tanto sobre el rendimiento del contenido de aceite como sobre la cantidad de ceras de la semilla, de las cuales se considera principal portadora.

  16. Ethanol production from Jerusalem artichoke ( Helianthus tuberosus ...

    African Journals Online (AJOL)

    Among the strains tested, TISTR 548 gave the highest ethanol concentration at 30 to 35°C, as compared to the others. Therefore, this strain was chosen for ethanol production from Jerusalem artichoke juice after acid hydrolysis. The influence of some fermentation factors such as sugar concentration, pH of the fermentation ...

  17. Different histories of two highly variable LTR retrotransposons in sunflower species.

    Science.gov (United States)

    Mascagni, Flavia; Cavallini, Andrea; Giordani, Tommaso; Natali, Lucia

    2017-11-15

    In the Helianthus genus, very large intra- and interspecific variability related to two specific retrotransposons of Helianthus annuus (Helicopia and SURE) exists. When comparing these two sequences to sunflower sequence databases recently produced by our lab, the Helicopia family was shown to belong to the Maximus/SIRE lineage of the Sirevirus genus of the Copia superfamily, whereas the SURE element (whose superfamily was not even previously identified) was classified as a Gypsy element of the Ogre/Tat lineage of the Metavirus genus. Bioinformatic analysis of the two retrotransposon families revealed their genomic abundance and relative proliferation timing. The genomic abundance of these families differed significantly among 12 Helianthus species. The ratio between the abundance of long terminal repeats and their reverse transcriptases suggested that the SURE family has relatively more solo long terminal repeats than does Helicopia. Pairwise comparisons of Illumina reads encoding the reverse transcriptase domain indicated that SURE amplification may have occurred more recently than that of Helicopia. Finally, the analysis of population structure based on the SURE and Helicopia polymorphisms of 32 Helianthus species evidenced two subpopulations, which roughly corresponded to species of the Helianthus and Divaricati/Ciliares sections. However, a number of species showed an admixed structure, confirming the importance of interspecific hybridisation in the evolution of this genus. In general, these two retrotransposon families differentially contributed to interspecific variability, emphasising the need to refer to specific families when studying genome evolution. Copyright © 2017 Elsevier B.V. All rights reserved.

  18. Relación entre el cultivo antecesor y la disponibilidad de nitrógeno para el trigo en la rotación Relationship between the preceding crop and nitrogen availability for wheat in the rotation

    Directory of Open Access Journals (Sweden)

    Guillermo Alberto Studdert

    2006-07-01

    Full Text Available El efecto de las características de los residuos de los antecesores sobre la disponibilidad de N para el trigo (Triticum aestivum L. puede enmascarar los cambios en la capacidad del suelo para proveerlo debidas al manejo y debería ser tenido en cuenta para el diagnóstico de la fertilidad nitrogenada. Los objetivos de este trabajo fueron evaluar: i la evolución en el tiempo de los rendimientos en grano (RR y de la acumulación de materia seca (MSR y de N (NR en la biomasa aérea relativos al máximo rendimiento o acumulación, respectivamente, de cada experimento y año, del trigo sobre distintos antecesores, y ii la relación entre la variación de RR, MSR y NR y la del contenido de materia orgánica del suelo. En dos ensayos de rotaciones de larga duración en Balcarce se analizó la variación de los RR, MSR y NR a lo largo de los años de agricultura con labranza convencional sobre papa (Solanum tuberosum L., soja (Glycine max L. Merr., trigo, girasol (Helianthus annuus L. y maíz (Zea mays L.. Las tres variables mostraron una reducción con los años de agricultura hasta niveles diferentes según cuál hubiera sido el antecesor. Las características de los residuos y/o la forma en que éstos fueron manejados hicieron que los RR, MSR y NR sobre soja, papa y trigo, fueran los más elevados y sobre maíz, los más bajos. Tal variación en las tres variables no se asoció, en general, con los cambios en la materia orgánica del suelo debidos al manejo. El efecto de corto plazo de los residuos y su manejo sobre el ciclo inmovilización-mineralización de N determinó la disponibilidad de N para el trigo, independientemente de cómo la rotación afectó la capacidad del suelo para proveerlo.The effect of preceding crop residue characteristics on N availability for wheat (Triticum aestivum L. may mask the changes in soil capability to provide N due to management. Preceding crop effects should be taken into account to diagnose N fertility. The

  19. Ileal digestibility of sunfl ower meal, pea, rapeseed cake, and lupine in pigs

    DEFF Research Database (Denmark)

    Nørgaard, Jan Værum; Fernández, José Adalberto; Jørgensen, Henry

    2012-01-01

    .05) for soybean meal and pea compared to sunfl ower meal, rapeseed cake, and lupine. The SID of Lys and His were lowest (P soybean meal and pea to be a high-digestible protein source relative to sunfl ower......The standardized ileal digestibility (SID) of CP and AA was evaluated in soybean (Glycine max) meal, sunfl ower (Helianthus annuus) meal, rapeseed cake, and fi eld pea (Pisum sativum) using 10 pigs and in lupine (Lupinus angustifolius) using 7 pigs. Pigs were fi tted with either a T...

  20. Efeito de datas de semeadura no comportamento de dois genótipos de girassol. II. Aspectos nutricionais

    OpenAIRE

    Campbell, A. T.; Athayde, MLF

    1988-01-01

    Este experimento foi realizado em Jaboticabal, SP, como objetivo de se avaliar o comportamento de dois genótipos de girassol (Helianthus annuus L.) no tocante à composição mineral e teor de óleo. Utilizou-se o híbrido Contissol 812 e a cuttivar IAC-Anhandy com 80cm entre linhas e cinco plantas por metro linear, em blocos casualizados, com quatro repetições, em cinco datas de semeadura: 20.1; 20.2; 5.3; 20.3 e 5.4. O atraso das datas de semeadura exerceu efeito depressivo e significativo sobre...

  1. Dicty_cDB: VSE294 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 CD450796 |CD450796.1 USDA-FP_102775 Adult Alate Brown Citrus Aphid Toxoptera ci...tricida cDNA clone WHWTC-38_C01 5', mRNA sequence. 44 3e-08 3 CB909744 |CB909744.1 USDA-FP_101487 Adult Alate Brown Citrus Aphid...50513.1 USDA-FP_102476 Adult Alate Brown Citrus Aphid Toxoptera citricida cDNA cl...1 Helianthus annuus cDNA clone QHB10I15, mRNA sequence. 50 6e-08 3 CD451515 |CD451515.1 USDA-FP_103756 Adult Alate Brown Citrus Aphid

  2. Introducción al estudio de la alteración de la semilla de girasol durante su almacenamiento

    Directory of Open Access Journals (Sweden)

    Otero Mateos, I.

    1995-04-01

    Full Text Available A comparative study has been performed to examine the alterations occurring in sunflower seeds during their storage in an air atmosphere and in a nitrogen current. Two kinds of seeds with different moisture contents were used to examine the influence of this parameter: seeds from the Ukraine with about 5% humidity, and Spanish seeds (from the Central region, with about 12% humidity. The Ukrainian seeds stored in an air atmosphere were kept at 20°C in a room with about 50% humidity, while those stored in a nitrogen current were kept in the laboratory. The seeds with a high moisture content were stored in the laboratory irrespective of the storage atmosphere used. Samples of seeds were taken periodically, and their moisture content was analyzed as was the acidity, p-anisidine, k270 and k232 values and % polar compounds of their crude oil.

    Se ha estudiado comparativamente la evolución de la alteración entre almacenamiento con atmósfera de aire y con corriente de nitrógeno, empleando semilla de dos tipos, para estudiar igualmente la influencia de su humedad: semilla ucraniana, con humedad en torno al 5%, y semilla española (zona centro, con humedad superior al 12%. En el caso de semilla ucraniana, el almacenamiento se ha realizado en cámara del 50% de humedad y 20ºC para el caso del aire y en laboratorio para el almacenamiento con corriente de nitrógeno. La semilla de alta humedad ha sido conservada en el laboratorio, tanto para ambiente de aire como para la corriente de nitrógeno. A las muestras de semilla, tomadas periódicamente, se les realizaron análisis de humedad, mientras que al aceite crudo extraído de ellas se les realizaron análisis de grado de acidez, índice de p-anisidina, k270, k232 y contenido en compuestos polares.

  3. Plantas, semillas y aceites de girasol con un contenido alto de oleico y alto de esteárico

    OpenAIRE

    Martínez-Force, Enrique; Garcés Mancheño, Rafael; Muñoz Ruz, Juan; Fernández-Martínez, José María

    2007-01-01

    Traducción de Patente Europea E00936860 (fecha de solicitud, 05/06/2000).-- Prioridades: EP19991217992043844, US199906049909326501 y US20000204200060180455.-- Titular: Consejo Superior de Investigaciones Científicas (CSIC).

  4. Nuevas citas de Asteraceae para la provincia de Catamarca (Argentina New records of Asteraceae for the province of Catamarca (Argentina

    Directory of Open Access Journals (Sweden)

    Susana E. Freire

    2011-06-01

    Full Text Available Se mencionan los siguientes nuevos registros de Asteráceas para la provincia de Catamarca, Argentina: Baccharis acaulis, B. boliviensis var. latifolia, B. flexuosa, B. glutinosa var. angustissima, B. stenophylla (Tribu Astereae, Eupatorium patens var. tomentosum (Tribu Eupatorieae, Cosmos bipinnatus, C. peucedanifolius var. peucedanifolius, Helianthus annuus (Tribu Heliantheae, Gamochaeta erythractis, G. longipedicellata, Gnaphalium lacteum, Tessaria integrifolia var. integrifolia (Tribu Inuleae, Chuquiraga ruscifolia (Tribu Mutisieae, Senecio crepidifolius, S. subulatus var. subulatus, Xenophyllum incisum var. incisum (Tribu Senecioneae. Se citan además el hábitat de los taxones y las provincias fitogeográficas que integran. Se propone una nueva combinación, Baccharis glutinosa Pers. var. angustissima (DC. Giuliano.The following Asteraceae are mentioned for the province of Catamarca: Baccharis acaulis, B. boliviensis var. latifolia, B. flexuosa, B. glutinosa var. angustissima, B. stenophylla (Tribe Astereae, Eupatorium patens var. tomentosum (Tribe Eupatorieae, Cosmos bipinnatus, C. peucedanifolius var. peucedanifolius, Helianthus annuus (Tribe Heliantheae, Gamochaeta erythractis, G. longipedicellata, Gnaphalium lacteum, Tessaria integrifolia var. integrifolia (Tribe Inuleae, Chuquiraga ruscifolia (Tribe Mutisieae, Senecio crepidifolius, S. subulatus var. subulatus, Xenophyllum incisum var. incisum (Tribe Senecioneae. The habitat and phytogeographic provinces of the taxa are mentioned. The following new combination is proposed: Baccharis glutinosa Pers. var. angustissima (DC. Giuliano.

  5. In vitro degradability and total gas production of biodiesel chain byproducts used as a replacement for cane sugar feed

    Directory of Open Access Journals (Sweden)

    Milenna Nunes Moreira

    2014-09-01

    Full Text Available This study aimed to determine the in vitro degradability of dry matter and the total gas production of oil seed press cake from biodiesel production (Gossypium hirsutum L., Helianthus annuus L., Ricinus communis, Moringa oleífera L. and Pinhão manso curcas L. at four different levels of replacement (0, 30, 50, and 70% for cane sugar (Saccharum officinarum RB. in ruminant feed. Inocula were prepared using the ruminal fluid of three Holstein cows, and data were collected after 48 hours of incubation. The byproducts of Moringa had the highest degradability, and castor presented the lowest values at all evaluated levels of replacement. Castor bean byproduct showed the highest total gas production, cotton showed the lowest production, and the byproduct of Moringa at the 70% level showed the best ruminal fermentation results. These results demonstrate that the use of oil seed press cake from biodiesel production (Helianthus annuus L. and Ricinus communis can replace cane sugar in ruminant feed.

  6. Genome skimming reveals the origin of the Jerusalem Artichoke tuber crop species: neither from Jerusalem nor an artichoke.

    Science.gov (United States)

    Bock, Dan G; Kane, Nolan C; Ebert, Daniel P; Rieseberg, Loren H

    2014-02-01

    The perennial sunflower Helianthus tuberosus, known as Jerusalem Artichoke or Sunchoke, was cultivated in eastern North America before European contact. As such, it represents one of the few taxa that can support an independent origin of domestication in this region. Its tubers were adopted as a source of food and forage when the species was transferred to the Old World in the early 1600s, and are still used today. Despite the cultural and economic importance of this tuber crop species, its origin is debated. Competing hypotheses implicate the occurrence of polyploidization with or without hybridization, and list the annual sunflower H. annuus and five distantly related perennial sunflower species as potential parents. Here, we test these scenarios by skimming the genomes of diverse populations of Jerusalem Artichoke and its putative progenitors. We identify relationships among Helianthus taxa using complete plastomes (151 551 bp), partial mitochondrial genomes (196 853 bp) and 35S (8196 bp) and 5S (514 bp) ribosomal DNA. Our results refute the possibility that Jerusalem Artichoke is of H. annuus ancestry. We provide the first genetic evidence that this species originated recursively from perennial sunflowers of central-eastern North America via hybridization between tetraploid Hairy Sunflower and diploid Sawtooth Sunflower. © 2013 The Authors. New Phytologist © 2013 New Phytologist Trust.

  7. Seleção de espécies de adubos verdes visando à fitorremediação de diclosulam Selection of green manure species aiming at diclosulam phytoremediation

    Directory of Open Access Journals (Sweden)

    P.A Monquero

    2013-03-01

    Full Text Available Espécies de adubos verdes tolerantes ao herbicida diclosulam podem ser utilizadas em rotação de culturas para diminuir o efeito fitotóxico subsequente desse herbicida em plantas sensíveis, como o girassol ou milho. Este estudo teve como objetivo avaliar a tolerância de adubos verdes ao diclosulam e a capacidade dessas plantas em diminuir o efeito fitotóxico do herbicida no bioindicador Helianthus annuus. Foram avaliadas, em casa de vegetação, três doses do herbicida diclosulam (0, 0,035 e 0,070 kg i.a. ha-1 em pré-emergência dos adubos verdes Dolichos lablab, Cajanus cajan, Canavalia ensiformis, Crotalaria juncea, C. breviflora, C. spectabilis, Mucuna deeringiana, M. cinerea, M. aterrima, Lupinus albus, Helianthus annuus, Pennisetum glaucum, Avena strigosa, Raphanus sativus e Calopogonium muconoides. Entre estas espécies, C. cajan, C. ensiformis, M. cinerea e M. aterrima foram selecionadas como as mais tolerantes, sendo avaliadas no campo com o herbicida diclosulam nas doses de 0, 0,035 e 0,070 kg i.a. ha¹, em esquema fatorial 4 x 3 e quatro repetições. A parte aérea dessas plantas foi coletada após 60 dias da emergência, sendo semeado H. annuus como bioindicador do herbicida diclosulam. Os resultados evidenciaram C. cajan como a espécie mais promissora em diminuir o efeito fitotóxico do diclosulam em culturas agrícolas sensíveis.The tolerance of green manure species to diclosulam can be used in crop rotation schemes aiming to reduce the subsequent phytotoxic effect of this herbicide on sensitive plants, such as sunflower or corn plants. This study evaluated the tolerance of green manure to diclosulan and the capacity of these plants in reducing the phytotoxic effect of this herbicide on Helianthus annuus (sunflower. Three rates of diclosulam (0; 0.035, and 0.070 kg a.i. ha-1 were evaluated under greenhouse conditions in pre-emergence of the following green manures: Dolichos lablab, Cajanus cajan, Canavalis ensiformis

  8. Evaluation of phytotherapy alternatives for controlling Rhipicephalus (Boophilus microplus in vitro

    Directory of Open Access Journals (Sweden)

    José Pablo Villarreal Villarreal

    Full Text Available Abstract The objective of this study was to identify the main chemical components of the essential oil of Cuminum cyminum L. (cumin and of the fixed oils of Bertholletia excelsa (Brazil nut and of Helianthus annuus (sunflower seed. As well as testing the three oils and three different commercial synthetic acaricides against engorged females of Rhipicephalus (Boophilus microplus in order to explore their acaricidal efficacy. Six different concentrations of the oils (200, 100, 50, 25, 12.5 and 6.25 mg/mL and the active principles were evaluated with the Adult Immersion Test (AIT. The two main chemicals components of C. cyminum L. were the cuminaldehyde and the γ-terpinene. In both B. excelsa and H. annuus were the linoleic and oleic acid. C. cyminum L. showed high acaricidal activity (100% over the engorged females and on their reproductive characteristat from the concentration of 100 mg/mL. B. excelsa and H. annuus had low acaricidal activity (39.39% and 58.75% in the concentration of 200 mg/mL respectively. The amidine and the pyrethroid (35.12% and 1.50% respectively. It can be concluded that the oil of C. cyminum L. may be a phytoterapic alternative for the cattle's tick control.

  9. Patterns of microsatellite evolution inferred from the Helianthus ...

    Indian Academy of Sciences (India)

    Asteraceae) transcriptome. Sreepriya Pramod, Andy D. Perkins and Mark E. Welch. J. Genet. 93, 431–442. Figure 1. Relative frequencies of microsatellite lengths in terms of base pairs (bp) within the three different domains of transcripts with ...

  10. Patterns of microsatellite evolution inferred from the Helianthus ...

    Indian Academy of Sciences (India)

    GOs associated with response to various environmental stimuli including water deprivation and salt stress were significantly enriched with microsatellites. This may suggest that these GOs are more labile in plant genomes, or that selection has favoured the maintenance of microsatellites in these genes over others.

  11. Evaluation of potential deer browsing impact on sunflower (Helianthus annus)

    Czech Academy of Sciences Publication Activity Database

    Kamler, Jiří; Homolka, Miloslav; Cerkal, R.; Heroldová, Marta; Krojerová-Prokešová, Jarmila; Barančeková, Miroslava; Dvořák, J.; Vejražka, K.

    2009-01-01

    Roč. 55, č. 6 (2009), s. 583-588 ISSN 1612-4642 R&D Projects: GA MZe(CZ) QF4192; GA MŠk LC06073 Institutional research plan: CEZ:AV0Z60930519 Keywords : Game damages * Wild herbivores * Oil crop * Yield loss Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection Impact factor: 1.136, year: 2009

  12. Patterns of microsatellite evolution inferred from the Helianthus ...

    Indian Academy of Sciences (India)

    2014-08-21

    Aug 21, 2014 ... were defined as repetitive sequences with motif sizes rang- ing from 1 to 6 bp. Also, only repeated ..... GO:0009719 response to endogenous stimulus. P. 0.000162. 276/2308 (12.0%). 813/8919 (9.1 ..... Economic Development, the College of Arts and Sciences, and the. Department of Biological Sciences at ...

  13. Long Terminal Repeat Retrotransposon Content in Eight Diploid Sunflower Species Inferred from Next-Generation Sequence Data

    Science.gov (United States)

    Tetreault, Hannah M.; Ungerer, Mark C.

    2016-01-01

    The most abundant transposable elements (TEs) in plant genomes are Class I long terminal repeat (LTR) retrotransposons represented by superfamilies gypsy and copia. Amplification of these superfamilies directly impacts genome structure and contributes to differential patterns of genome size evolution among plant lineages. Utilizing short-read Illumina data and sequence information from a panel of Helianthus annuus (sunflower) full-length gypsy and copia elements, we explore the contribution of these sequences to genome size variation among eight diploid Helianthus species and an outgroup taxon, Phoebanthus tenuifolius. We also explore transcriptional dynamics of these elements in both leaf and bud tissue via RT-PCR. We demonstrate that most LTR retrotransposon sublineages (i.e., families) display patterns of similar genomic abundance across species. A small number of LTR retrotransposon sublineages exhibit lineage-specific amplification, particularly in the genomes of species with larger estimated nuclear DNA content. RT-PCR assays reveal that some LTR retrotransposon sublineages are transcriptionally active across all species and tissue types, whereas others display species-specific and tissue-specific expression. The species with the largest estimated genome size, H. agrestis, has experienced amplification of LTR retrotransposon sublineages, some of which have proliferated independently in other lineages in the Helianthus phylogeny. PMID:27233667

  14. Genetic variability of concentration of microelements in wild sunflower species and hybrids

    Directory of Open Access Journals (Sweden)

    Kastori Rudolf R.

    2010-01-01

    Full Text Available The aim of this work was to investigate genetic specificity of sunflower nutrition with microelements. Therefore, concentrations of essential (Zn, B, Mn, Cu, Fe and Ni and non-essential (Cr, Al, Cd, As, Pb and Ba micronutrients were analyzed. Five sunflower hybrids the most grown in Serbia and different populations of wild sunflower species originating from North America: Helianthus neglectus Heiser (3, Helianthus agrophyllus T&G (3, Helianthus petiolaris Nutt. (2, Helianthus annuus L. (4 were included in the experiment. Populations of wild sunflower species and hybrids differed significantly with respect to the concentration of analyzed elements. Manganese concentration was significantly higher in hybrids than in wild species. In all genotypes Fe, B and Mn had the highest concentration. Coefficient of variation of microelement concentration depended on genotype and particular element. In wild populations, for essential microelements, it was between 3.7 and 59.5, whereas in hybrids it varied from 10.0 to 48.8. Coefficient of variation of concentration of non-essential microelements in wild populations varied from 7.7 to 73.8, and in hybrids from 15.1 to 48.8. Average coefficient of variation in both wild species and hybrids was the lowest for Mn and Pb. It was the highest for Cr, Ni, and Zn in hybrids and for Cd, Ni, and Cr in wild species. The results suggest that genetic specificity with respect to uptake of microelements in wild species and hybrids is highly expressed. Broad genetic variability of concentrations of microelements in wild species and hybrids indicate that their reactions to deficiency and/or excess of those elements probably are not the same either. This finding may be used in breeding process aimed specifically at improvement of tolerance and capacity to accumulate microelements in sunflower. Phytoremediation technology designed to reduce the amount of microelements in the soil could thus be advanced by utilization of such

  15. Response of plants to high concentrations of uranium stress and the screening of remediation plants

    International Nuclear Information System (INIS)

    Tang Yongjin; Luo Xuegang; Zeng Feng; Jiang Shijie

    2013-01-01

    Studies of the resistance and accumulation ability of different plant species to uranium (U) has important influence on the bioremediation of U contaminated soil. The resistance and enrichment ability of high concentrations of U (500 mg · kg -1 soil) in fourteen plant species were investigated and evaluated in this study in order to screen remediation plants for governance soil U contamination. The results showed that: (1) high concentrations of U stress had different effects on the emergence and survival of the different plants. The seed emergence of Hibiscus esculentus was reduced by 2/3, but the seed emergence of Gynura cusimbua (D. Don) S. Moore, Chenopodium album L. and Phaseolus vulgaris var. humilis Alef were not reduced. Under the contaminated soil, all the sesamum indicum died within a month after the emergence and the survival number of Amaranth and Iresine herbstii 'Aureo-reticulata' reduced by about 80%. But the survival number of Alternanthera philoxeroides (Mart.) Griseb., Chenopodium album L. and Phaseolus vulgaris var. humilis Alef were not influenced. (2) The biomass of the plants would be reduced by 8-99% in the uranium-contaminated soil. The anti-stress ability of Phaseolus vulgaris var. humilis Alef was the strongest in the fourteen plants, and Cucurbita pepo L., Sorghumbicolor (L.) Moench, Ipomoea aquatica Forsk, Helianthus annuus, Chenopodium album L. and Alternanthera philoxeroides (Mart.) Griseb. showed some the anti-stress ability. (3) Significant differences were found in the capacity of plants to absorb uranium between under high-uranium contaminated soil and under the non-uranium contaminated soil were. The plants with higher uranium content in thenon-contaminated soil were Gomphrena globosa, and Cucurbita pepo L., which were 2.249 mg · kg -1 DW and 1.620 mg · kg -1 DW, respectively. But the plants with higher uranium content in the high uranium contaminated soil were Cichorium intybus L., Amaranth and Ipomoea aquatica Forsk

  16. Characterization of uptake and translocation of radioactive herbicides in a parasitic-host system

    International Nuclear Information System (INIS)

    Diaz S, Jorge; Lopez G, Francisca; Garcia T, Luis

    1999-01-01

    Uptake and translocation of [14C]-propyzamide applied to the sunflower seed by coating or soaking, of [14C]-imazapyr and [14C]-glyphosate both applied at post emergence, were studied in sunflower (Helianthus annuus L.) parasitising or not by nodding broom rape (Orobanche cumana Wallr.). Sunflower seed absorbed 9.8 and 3.4% of [14C]-propyzamide applied by coating or soaking, respectively, and less than 1% was translocated to the nodding broom rape. In sunflower plants infested and not infested with nodding broom rape, nearly 90% of [14C]-imazapyr was absorbed and 26% was translocated to the parasitic weed. Uptake of [14C]-glyphosate was similar (50%) for infested or not infested sunflower plants and only the 6% was translocated to the nodding broom rape

  17. Effect of crop residue harvest on long-term crop yield, soil erosion, and carbon balance: tradeoffs for a sustainable bioenergy feedstock

    Energy Technology Data Exchange (ETDEWEB)

    Gregg, Jay S.; Izaurralde, Roberto C.

    2010-08-26

    Agricultural residues are a potential feedstock for bioenergy production, if residue harvest can be done sustainably. The relationship between crop residue harvest, soil erosion, crop yield and carbon balance was modeled with the Erosion Productivity Impact Calculator/ Environment Policy Integrated Climate (EPIC) using a factorial design. Four crop rotations (winter wheat [Triticum aestivum (L.)] – sunflower [Helianthus annuus]; spring wheat [Triticum aestivum (L.)] – canola [Brassica napus]; corn [Zea mays L.] – soybean [Glycine max (L.) Merr.]; and cotton [Gossypium hirsutum] – peanut [Arachis hypogaea]) were simulated at four US locations each, under different topographies (0-10% slope), and management practices [crop residue removal rates (0-75%), conservation practices (no till, contour cropping, strip cropping, terracing)].

  18. Na+ accumulation in root symplast of sunflower plants exposed to moderate salinity is transpiration-dependent.

    Science.gov (United States)

    Quintero, José Manuel; Fournier, José María; Benlloch, Manuel; Rodríguez-Navarro, Alonso

    2008-08-25

    Twenty-day-old sunflower plants (Helianthus annuus L. cv Sun-Gro 380) grown hydroponically under controlled conditions were used to study the effect of transpiration on Na(+) compartmentalization in roots. The plants were exposed to low Na(+) concentrations (25 mM NaCl) and different environmental humidity conditions over a short time period (8.5 h). Under these conditions, Na(+) was accumulated primarily in the root, but only the Na(+) accumulated in the root symplast was dependent on transpiration, while the Na(+) accumulated in both the shoot and the root apoplast exhibited a low transpiration dependence. Moreover, Na(+) content in the root apoplast was reached quickly (0.25 h) and increased little with time. These results suggest that, in sunflower plants under moderate salinity conditions, Na(+) uptake in the root symplast is mediated by a transport system whose activity is enhanced by transpiration.

  19. Phytochemical screening, total phenolic content and phytotoxic activity of corn (Zea mays) extracts against some indicator species.

    Science.gov (United States)

    Ahmed, Hiwa M

    2018-03-01

    Allelopathic effects of corn (Zea mays) extracts was studied, against seed germination and seedling growth of Phalaris minor, Helianthus annuus, Triticumaestivum, Sorghum halepense, Z. mays. Bioassay results showed that aqueous extracts of corn root and shoot, markedly affected seed germination, and other parameters compared with related controls. Preliminary phytochemical screening revealed the presence of various phytochemicals such as tannins, phlobatannins, flavonoids, terpenoids and alkaloids in both roots and shoot aqueous extracts. However, saponins were only present in the shoot aqueous extract, while in shoot ethanol extracts, only terpenoids and alkaloids were detected. Additionally, total polyphenolic (TPC) content in aqueous extracts of corn root and shoot, plus ethanol extracts of corn shoot were determined using an Ultraviolet-visible spectroscopy. Results revealed TPC content of the corn shoot aqueous extract showed the highest yield, compared to other extracts. These findings suggest that phytochemicals present in Z. mays extracts may contribute to allelopathy effect.

  20. Hydroquinone; A novel bioactive compound from plant-derived smoke can cue seed germination of lettuce

    Science.gov (United States)

    Kamran, Muhammad; Khan, Abdul L.; Ali, Liaqat; Hussain, Javid; Waqas, Muhammad; Al-Harrasi, Ahmed; Imran, Qari M.; Kim, Yoon-Ha; Kang, Sang-Mo; Yun, Byung-Wook; Lee, In-Jung

    2017-05-01

    Plant-derived smoke has been known to play an important role in distribution and growth of vegetation. Using a proficiently designed furnace, we extracted smoke from the leaves of four plant viz. Helianthus annuus, Aloe vera, Ginkgo biloba, and Cymbopogon jwarancusa. Smoke dilutions obtained from these plants were obtained in different concentrations to identify potential lettuce growth promoting smoke solution. Results revealed that smoke obtained from Ginkgo biloba significantly enhanced the lettuce seed germination. This solution was then partitioned into ethyl acetate, dichloromethane, n-hexane, chloroform and ether fractions. Ethyl acetate fraction was found to be potent to enhance seed germination. This fraction was subjected to column chromatography and spectroscopic techniques to obtain compound 1. This compound was identified as hydroquinone using 1D and 2D NMR techniques. At low concentrations (5, 10 and 20 ppm), compound 1 enhanced the lettuce seed germination; however, higher concentrations inhibited its growth as compared to control.

  1. Sunflower-based Feedstocks in Nonfood Applications: Perspectives from Olefin Metathesis

    Directory of Open Access Journals (Sweden)

    Bassie B. Marvey

    2008-08-01

    Full Text Available Sunflower (Helianthus annuus L. oil remains under-utilised albeit one of the major seed oils produced world-wide. Moreover, the high oleic sunflower varieties make the oil attractive for applications requiring high temperature processes and those targeting the C=C double bond functionality. Herein an overview of the recent developments in olefin metathesis of sunflower-based feedstocks is presented. The improved performance of olefin metathesis catalysts leading to high turnover numbers, high selectivity and catalyst recyclability, opens new opportunities for tailoring sunflower-based feedstocks into products required for possible new niche market applications. Promising results in biofuel, biopolymers, fragrances and fine chemicals applications have been reported.

  2. Sunflower inbred lines screening for tolerance to white rot on stalk

    Directory of Open Access Journals (Sweden)

    Dedić Boško

    2011-01-01

    Full Text Available Seventy sunflower (Helianthus annuus L inbred lines were screened for tolerance to white rot on stalk. Plants were inoculated at the budding stage with 4-day old Sclerotinia mycelium grown on PDA medium. Mycelium was placed on the leaf top and covered with tin foil, and the leaf was put into transparent nylon bag in order to maintain high humidity. Spot length on leaf was measured and plant tolerance was determined at the full flowering stage. Obtained results were analyzed by analysis of variance. Tested lines showed significant variability in response to disease. Eleven lines had lesion length less than 50% compared to susceptible control, so they could be considered tolerant and potentially interesting for breeding program.

  3. Shore Vegetation of Lakes Oahe and Sakakawea, Mainstream Missouri River Reservoirs.

    Science.gov (United States)

    1978-04-01

    Rumex crispus Lactuca serriola Chenopodium album Poyou ramosissimum Helianthus annuus * Populus deltoides Sai spp.a Polygonum lapathifolium Potentilla...4.2 2.8 Hordeum jubatum 6.9 9.2 10 1.9 7.5 10 Kochia scoparia 1.5 4.4 7.7 0.1 7.6 10 Rumex crispus 30 17 4.6 0.8 22 12 Lactuca serriola 1.7 2.9 6.4 2.5...I 9 𔃻 *~ I Ia * I S I **. , i - I’ / X ~ **~A. - I**. ’S S I ** .. .~ S S.I - !~ ~ .~S. 4 ’ 2 Mi I b 2W42 U~W4 K .30 were drowned. Rumex crispus

  4. UTILIZAÇÃO DE ÁGUA RESIDUÁRIA E DE ADUBAÇÃO ORGÂNICA NO CULTIVO DO GIRASSOL

    Directory of Open Access Journals (Sweden)

    RENÊ MEDEIROS DE SOUZA

    2010-01-01

    Full Text Available The aim of this research was to examine the response of utilization of wastewater and organic manure on the growth of sunflower (Helianthus annuus L. cv. Embrapa BRS Oásis. The study was carried out from April to July 2009 in a greenhouse. Sunflower plants were irrigated with wastewater and tap water combined with doses of humus (w/w of 0.5, 1.0, 1.5 and 2.0% and two controls (wastewater + mineral NPK and tap water + NPK with three replications. Humus application did not show significant effect on any variable analyzed except duration of post-harvest where all treatments presented duration more than the established by the market, while the wastewater was efficient in all assessments, promoting substantial increases in the growth of sunflower.

  5. Effects of shading on dry matter partitioning and yield of field-grown sunflower

    International Nuclear Information System (INIS)

    Villalobos, F.J.; Soriano, A.; Fereres, E.

    1992-01-01

    Crop simulation models require quantitative descriptions of the effects of irradiance on dry matter partition and yield. The objective of this work was to quantify the effects of reduced radiation intensity during different phenological stages on the growth, dry matter partitioning and grain numbers of sunflower (Helianthus annuus, L.). A field experiment was carried out in 1990 with 50 per cent shading treatments. The earliest treatment began at crop emergence while the latest ended at first anthesis. Shading had little effect on plant leaf area growth but reduced biomass and yield. The dry matter: radiation quotient and specific leaf area increased with shading. Grain number per head was decreased by shading, with the greatest effect occurring when shading was applied prior to anthesis. All shading treatments increased dry matter partitioning to stems, decreased assimilate partitioning to the heads and had no effect on the partitioning to leaves. (author)

  6. AGROBACTERIUM-MEDIATED TRANSFORMATION OF COMPOSITAE PLANTS. I. CONSTRUCTION OF TRANSGENIC PLANTS AND «HAIRY» ROOTS WITH NEW PROPERTIES

    Directory of Open Access Journals (Sweden)

    N. A.Matvieieva

    2013-02-01

    Full Text Available The review explores some of the recent advances and the author's own researchs concerning biotechnological approaches for Agrobacterium tumefaciens- and A. rhizogenes-mediated transformation of Compositae family plants. This paper reviews the results of genetic transformation of Compositae plants, including edible (Cichorium intybus, Lactuca sativa, oil (Helianthus annuus, decorative (Gerbera hybrida, medical (Bidens pilosa, Artemisia annua, Artemisia vulgaris, Calendula officinalis, Withania somnifera etc. plant species. Some Compositae genetic engineering areas are considered including creation of plants, resistant to pests, diseases and herbicides, to the effect of abiotic stress factors as well as plants with altered phenotype. The article also presents the data on the development of biotechnology for Compositae plants Cynara cardunculus, Arnica montana, Cichorium intybus, Artemisia annua "hairy" roots construction.

  7. Organic Matter and Barium Absorption by Plant Species Grown in an Area Polluted with Scrap Metal Residue

    Directory of Open Access Journals (Sweden)

    Cleide Aparecida Abreu

    2012-01-01

    Full Text Available The effect of organic matter addition on Ba availability to Helianthus annuus L., Raphanus sativus L., and Ricinus communis L. grown on a Neossolo Litólico Chernossólico fragmentário (pH 7.5, contaminated with scrap residue was evaluated. Four rates (0, 20, 40, and 80 Mg ha−1, organic carbon basis of peat or sugar cane filter, with three replicates, were tested. Plant species were grown until the flowering stage. No effect of organic matter addition to soil on dry matter yield of oilseed radish shoots was observed, but there was an increase in sunflower and castor oil plant shoots when sugar cane filter cake was used. The average Ba transferred from roots to shoots was more than 89% for oilseed radish, 71% for castor oil plants, and 59% for sunflowers. Organic matter treatments were not efficient in reducing Ba availability due to soil liming.

  8. Development of an ultra-dense genetic map of the sunflower genome based on single-feature polymorphisms.

    Directory of Open Access Journals (Sweden)

    John E Bowers

    Full Text Available The development of ultra-dense genetic maps has the potential to facilitate detailed comparative genomic analyses and whole genome sequence assemblies. Here we describe the use of a custom Affymetrix GeneChip containing nearly 2.4 million features (25 bp sequences targeting 86,023 unigenes from sunflower (Helianthus annuus L. and related species to test for single-feature polymorphisms (SFPs in a recombinant inbred line (RIL mapping population derived from a cross between confectionery and oilseed sunflower lines (RHA280×RHA801. We then employed an existing genetic map derived from this same population to rigorously filter out low quality data and place 67,486 features corresponding to 22,481 unigenes on the sunflower genetic map. The resulting map contains a substantial fraction of all sunflower genes and will thus facilitate a number of downstream applications, including genome assembly and the identification of candidate genes underlying QTL or traits of interest.

  9. Comparative Cytogenetic Study on the Toxicity of Magnetite and Zinc Ferrite Nanoparticles in Sunflower Root Cells

    Science.gov (United States)

    Foca-nici, Ecaterina; Capraru, Gabriela; Creanga, Dorina

    2010-12-01

    In this experimental study the authors present their results regarding the cellular division rate and the percentage of chromosomal aberrations in the root meristematic cells of Helianthus annuus cultivated in the presence of different volume fractions of magnetic nanoparticle suspensions, ranging between 20 and 100 microl/l. The aqueous magnetic colloids were prepared from chemically co-precipitated ferrites coated in sodium oleate. Tissue samples from the root meristeme of 2-3 day old germinated seeds were taken to prepare microscope slides following Squash method combined with Fuelgen techniques. Microscope investigation (cytogenetic tests) has resulted in the evaluation of mitotic index and chromosomal aberration index that appeared diminished and respectively increased following the addition of magnetic nanoparticles in the culture medium of the young seedlings. Zinc ferrite toxic influence appeared to be higher than that of magnetite, according to both cytogenetic parameters.

  10. Eastern North America as an independent center of plant domestication

    Science.gov (United States)

    Smith, Bruce D.

    2006-01-01

    The status of eastern North America as an independent center of plant domestication has recently been called into question by a number of genetic and archaeological studies, which suggest that the region may not have witnessed the independent domestication of local crop plants, but rather may have been on the receiving end of domesticated crop plants introduced from Mexico. Here, I provide a synthesis of the currently available archaeological and genetic evidence from both eastern North America and Mexico regarding the spatial and temporal context of initial domestication of the four plant species identified as potential eastern North American domesticates: marshelder (Iva annua), chenopod (Chenopodium berlandieri), squash (Cucurbita pepo), and sunflower (Helianthus annuus). Genetic and archaeological evidence provides strong support for the independent domestication of all four of these plant species in the eastern United States and reconfirms the region as one of the world’s independent centers of domestication. PMID:16894156

  11. Plant gnotobiology: Epiphytic microbes and sustainable agriculture.

    Science.gov (United States)

    Kutschera, Ulrich; Khanna, Rajnish

    2016-12-01

    In 1963, a monograph by Thomas D. Luckey entitled Germfree Life and Gnotobiology was published, with a focus on animals treated with microbes and reference to the work of Louis Pasteur (1822-1895). Here, we review the history and current status of plant gnotobiology, which can be traced back to the experiments of Jean-Baptiste Boussingault (1801-1887) published in 1838. Since the outer surfaces of typical land plants are much larger than their internal areas, embryophytes "wear their guts on the outside." We describe the principles of gnotobiological analyses, with reference to epiphytic metylobacteria, and sunflower (Helianthus annuus) as well as Arabidopsis as model dicots. Finally, a Californian field experiment aiming to improve crop yield in strawberries (Fragaria ananassa) is described to document the practical value of this novel research agenda.

  12. Research fields, challenges and opportunities in European oilseed crops breeding

    Directory of Open Access Journals (Sweden)

    Vincourt Patrick

    2014-11-01

    Full Text Available Due to the geographical specialization in oilseed world production, Europe has a major role to play in winter oilseed rape and sunflower breeding. Mainly based on the most recen t results, this review aims to identify the main research and breeding targets for these two crops, as seen through publications, with an attempt to suggest what are opportunities and challenges in these research fields. Growing a healthy and yielding crop remains the key driver for agronomic production. However sustainability and environmental profiles of the cultivar are now entering the field of play: The sustainability concern invested the field of resistance to diseases. Nitrogen use efficiency became an important target for Brassica napus, and crop resilience toward drought stresses is the way chosen in Helianthus annuus breeding for yield improvement. Significant advances are underway for quality traits, but the uncertainty on nutritional and industrial demand may explain why the product diversification remains low.

  13. Maize, Sunflower and Barley Sensitivity to the Residual Activity of Clomazone in Soil

    Directory of Open Access Journals (Sweden)

    Jelena Gajić Umiljendić

    2012-01-01

    Full Text Available Sensitivity of maize, sunflower and barley to clomazone residues in loamy soil wasassessed in the study using bioassay. Clomazone was applied at a series of concentrationsfrom 0.12 to 12 mg a.i./kg of soil. After 14 days, morphological (shoot height, fresh and dryweight and physiological (content of carotenoids, chlorophyll a and chlorophyll b parameterswere measured. The results showed that morphological parameters are not valid indicatorsof clomazone sensitivity. Based on the results showing inhibition of the physiologicalparameters, I50 values were calculated and used to estimate the difference in sensitivitybetween the species tested. Sunflower was the most sensitive species, while the differencein sensitivity between maize and barley was not significant.Nomenclature: clomazone (2-(2-chlorbenzyl-4,4-dimethyl-1,2-oxazolidin-3-one, maize(Zea mays L., sunflower (Helianthus annuus L., barley (Hordeum vulgare L.

  14. Variación de parámetros de calidad del grano y aceite de girasol almacenado a diferentes humedades relativas

    OpenAIRE

    Motta, A.; Eguiazu, G. M.

    1991-01-01

    Commercial samples of sunflower were exposed to different relative humidities (75%, 80%, 84%, 92% and 98%) for two months. In addition to the kinetic rehydratation in standard and treated samples, the following parameters were measured: humidity, fat content, germinative power, acidity index, iodine number and fatty acids composition. Fatty acids composition, iodine number and fat content, did not change significantly. Only the acidity index and the germinative power were an index of the...

  15. Estudio reológico y microestructural de emulsiones concentradas de aceite de girasol en agua estabilizadas con proteínas agroalimentarias

    Directory of Open Access Journals (Sweden)

    Guerrero, A.

    2008-03-01

    Full Text Available Droplet Size Distribution (DSD and linear viscoelastic properties of concentrated o/w emulsions stabilized by different proteins (crayfish, gluten and soybean have been studied. A typical behaviour of highly concentrated emulsions with a high degree of flocculation has been found. An increase in energy input for the emulsification process or in emulsifier concentration leads to an increase in both viscoelastic moduli (G’, G’’ as well as to a decrease in droplet size. Thus, an enhancement of the entanglement network produced by association of protein molecules that are surrounding oil droplets or are present in the continuous phase takes place, leading to a significant improvement of emulsion stability.Se ha realizado un estudio de la distribución del tamaño de gotas y de las propiedades viscoelásticas lineales de emulsiones concentradas de aceite en agua, estabilizadas con diferentes proteínas (cangrejo, gluten y soja. Los sistemas estudiados siempre presentan un comportamiento típico de emulsiones altamente concentradas con un alto grado de floculación. Se ha observado que un incremento de la velocidad de agitación empleada durante la preparación o de la concentración de emulsionante dan lugar a un aumento de los módulos viscoelásticos (G’ y G’’ y a una disminución del tamaño de gotas. Por tanto se produce un reforzamiento del entramado formado por asociación de las gotas de fase dispersa y como consecuencia, un aumento en la estabilidad de las emulsiones.

  16. Gira-sol fotovoltaic : Seguidor solar automàtic per a la captació de l'energia del sol

    OpenAIRE

    García Fortanet, Javier

    2016-01-01

    L'energia solar fotovoltaica podria convertir-se en un dels recursos energètics emergents més importants al món. Però, el seu cost de producció és un dels principals inconvenients que encara fan difícil la seva viabilitat com una font d'energia competitiva amb altres sistemes de producció energètica convencionals. Les estratègies de desenvolupament d'aquesta tecnologia es concentren principalment en l'abaratiment de les cel·les fotovoltaiques i l'augment del rendiment de les instal·lacions de...

  17. Expressed Sequence Tags from the oomycete Plasmopara halstedii, an obligate parasite of the sunflower

    Directory of Open Access Journals (Sweden)

    Mouzeyar Said

    2007-12-01

    Full Text Available Abstract Background Sunflower downy mildew is a major disease caused by the obligatory biotrophic oomycete Plasmopara halstedii. Little is known about the molecular mechanisms underlying its pathogenicity. In this study we used a genomics approach to gain a first insight into the transcriptome of P. halstedii. Results To identify genes from the obligatory biotrophic oomycete Plasmopara halstedii that are expressed during infection in sunflower (Helianthus annuus L. we employed the suppression subtraction hybridization (SSH method from sunflower seedlings infected by P. halstedii. Using this method and random sequencing of clones, a total of 602 expressed sequence tags (ESTs corresponding to 230 unique sequence sets were identified. To determine the origin of the unisequences, PCR primers were designed to amplify these gene fragments from genomic DNA isolated either from P. halstedii sporangia or from Helianthus annuus. Only 145 nonredundant ESTs which correspond to a total of 373 ESTs (67.7% proved to be derived from P. halstedii genes and that are expressed during infection in sunflower. A set of 87 nonredundant sequences were identified as showing matches to sequences deposited in public databases. Nevertheless, about 7% of the ESTs seem to be unique to P. halstedii without any homolog in any public database. Conclusion A summary of the assignment of nonredundant ESTs to functional categories as well as their relative abundance is listed and discussed. Annotation of the ESTs revealed a number of genes that could function in virulence. We provide a first glimpse into the gene content of P. halstedii. These resources should accelerate research on this important pathogen.

  18. Sensory quality and appropriateness of raw and boiled Jerusalem artichoke tubers (Helianthus tuberosus L.)

    DEFF Research Database (Denmark)

    Bach, Vibe; Kidmose, Ulla; Thybo, Anette

    2013-01-01

    , green nut flavour, sweetness and colour intensity, whereas the appropriateness of boiled tubers was related to celeriac aroma, sweet aroma, sweetness and colour intensity. In both preparations the variety Dwarf stood out from the others by being the least appropriate tuber. CONCLUSION: A few sensory......BACKGROUND: The aim of the present study was to investigate the sensory attributes, dry matter and sugar content of five varieties of Jerusalem artichoke tubers and their relation to the appropriateness of the tubers for raw and boiled preparation. RESULTS: Sensory evaluation of raw and boiled...... Jerusalem artichoke tubers was performed by a trained sensory panel and a semi-trained consumer panel of 49 participants, who also evaluated the appropriateness of the tubers for raw and boiled preparation. The appropriateness of raw Jerusalem artichoke tubers was related to Jerusalem artichoke flavour...

  19. Preparation of Inulin Powder from Jerusalem Artichoke (Helianthus tuberosus L.) Tuber.

    Science.gov (United States)

    Srinameb, Bang-orn; Nuchadomrong, Suporn; Jogloy, Sanun; Patanothai, Aran; Srijaranai, Supalax

    2015-06-01

    The complete procedure for the production of inulin powder from Jerusalem artichoke tubers (JAT) was investigated. The procedure consists of isolation of inulin from JAT, elimination of color from the inulin extract and solidification. Washed tubers were first sliced, dried in a 60 °C oven for 10 h and then milled and sieved into a powder. Inulin was isolated from the JAT powder by hot water extraction using an accelerated solvent extractor (ASE). The effects of temperature and time for the extraction were investigated. The highest extraction efficiency was obtained at the extraction temperature of 80 °C for 20 min. The color of the extract was eliminated using ion exchange process with diethylaminoethyl cellulose as the sorbent. The inulin powder was subsequently obtained by freeze drying. Inulin content and inulin profiles were monitored to evaluate the efficiencies of the complete procedure. The inulin content was indirectly determined by spectrophotometry from free and total fructose measurements using potassium iodide. The inulin profile was monitored using high performance anion exchange chromatography equipped with integrated pulse amperometric detection (HPAEC-PAD). The proposed method provided the inulin production yield of 92.5%. The present procedure is fast, simple and effective for production of inulin powder from JAT. In addition, infrared spectra and some physico-chemical properties of the obtained inulin powder were determined and compared with the standard inulin.

  20. Modeling Phytoremediation of Cadmium Contaminated Soil with Sunflower (Helianthus annus) Under Salinity Stress

    International Nuclear Information System (INIS)

    Motesharezadeh, B.; Navabzadeh, M.; Liyaghat, A. M.

    2016-01-01

    This study was carried out as a factorial experiment with 5 levels of cadmium (Cd) (o, 25, 50, 75, and 100 mg/kg), 5 levels of salinity (Control, 4, 5, 6, and 7 dS/m), and two soil textures (sandy loam and clay loam). The results showed that the amount of Cd in root and shoot of sunflower increased as soil salinity and Cd concentration increased. The best concentrations for Cd phytoremediation were 75 mg/kg in sandy loam and 100 mg/kg in clay loam. Mass-Hoffman model in simulating transpiration Cd stress as well as Homaee model in simulating salt stress indicated the best results in light soils. By multiplying the salinity stress model by Cd stress model, the simultaneous model for each soil was calculated. These models in light soil (r2=0.68) and heavy soil (r2=0.81) were compatible with measured values. In the heavy soil, absorbed Cd by plant along with increased salinity reflected low changes, but changes in Cd absorbed by plants in the heavy soil were more uniform than in the light soil. In conclusion, for estimating the Cd uptake, the model had a better performance in the heavy soil (under salt stress).

  1. Tuber and Inulin production of Jerusalem artichoke (Helianthus tuberosus, L.) under Salinity Stress

    Science.gov (United States)

    The major problem with biofuel crops is that they compete with prime agricultural land, water, and are food staples. Jerusalem artichoke is a crop originated in the US that produces inulin-rich tubers, is adaptable to marginal lands and can tolerate saline water. Inulin is a complex sugar (a fructan...

  2. Potential of Jerusalem artichoke (Helianthus tuberosus L.) as a biorefinery crop

    DEFF Research Database (Denmark)

    Gunnarsson, Ingólfur Bragi; Svensson, S.-E.; Johansson, E.

    2014-01-01

    The utilization of Jerusalem artichoke in a biorefinery context was not investigated so far. Therefore the aim of this study was to evaluate the potential of this plant as feedstock for production of bioethanol, protein and inulin. We investigated the biomass productivity and chemical composition...... biomass productivity was 88% higher in September than in December. Fresh tuber biomass productivity showed large variations between harvests, where the maximum average productivity in December was 3.4 times higher than in September. Inulin content in dry tubers was between 76 and 85% making the plant...... an excellent crop, for e.g. inulin extraction, production of high fructose syrup or fermentations. Less mature plants were shown to have degree of polymerization (DP) up to 14, which makes biomass useful as dietary fibre, while the inulin DP in tubers harvested later became as low as 6, showing lower potential...

  3. Influence of planting date and temperature on inulin content in Jerusalem Artichoke (Helianthus tuberosus L.)

    Science.gov (United States)

    Lower temperatures during the dry season in tropical regions might affect inulin content and inulin yield of Jerusalem artichoke. The objective of this study was to determine the effect of planting dates during low temperature on inulin yield and content of Jerusalem artichoke. Two pot experiments...

  4. Unconventional amino acid sequence of the sun anemone (Stoichactis helianthus) polypeptide neurotoxin

    International Nuclear Information System (INIS)

    Kem, W.; Dunn, B.; Parten, B.; Pennington, M.; Price, D.

    1986-01-01

    A 5000 dalton polypeptide neurotoxin (Sh-NI) purified by G50 Sephadex, P-cellulose, and SP-Sephadex chromatography was homogeneous by isoelectric focusing. Sh-NI was highly toxic to crayfish (LD 50 0.6 μg/kg) but without effect upon mice at 15,000 μg/kg (i.p. injection). The reduced, 3 H-carboxymethylated toxin and its fragments were subjected to automatic Edman degradation and the resulting PTH-amino acids were identified by HPLC, back hydrolysis, and scintillation counting. Peptides resulting from proteolytic (clostripain, staphylococcal protease) and chemical (tryptophan) cleavage were sequenced. The sequence is: AACKCDDEGPDIRTAPLTGTVDLGSCNAGWEKCASYYTIIADCCRKKK. This sequence differs considerably from the homologous Anemonia and Anthopleura toxins; many of the identical residues (6 half-cystines, G9, P10, R13, G19, G29, W30) are probably critical for folding rather than receptor recognition. However, the Sh-NI sequence closely resembles Radioanthus macrodactylus neurotoxin III and r. paumotensis II. The authors propose that Sh-NI and related Radioanthus toxins act upon a different site on the sodium channel

  5. [Study on the quantitative and qualitative composition of moulds colonizing sunflower seeds (Helianthus annus L.)].

    Science.gov (United States)

    Janda, Katarzyna; Wolska, Jolanta; Debia, Kamila

    2015-01-01

    The aim of study was to estimate the qualitative and quantitative composition of moulds colonizing sunflower seeds on RBCA, YpSs, DG18 media at 25, 37, and 45°C. Twenty samples of sunflower seeds (not roasted and not salted) were used for the analysis. The highest number of moulds were xerophilic species isolated on DG18 at 25°C (33), followed by mesophilic species (29) on RBCA medium at 25°C, and mesophilic (22) and thermophilic species (10) on YpSs medium at 37, and 45°C, respectively. Eurotium herbariorum was isolated from all samples. A total of 287 strains belonging to 52 mould species were isolated from sunflower seeds. The study revealed new species not previously isolated from sunflower seeds mycobiota.

  6. Collection of wild Helianthus anomalus and deserticola sunflower from the desert southwest USA

    Science.gov (United States)

    Genetic resources are the biological basis of global food security. Collection and preservation of wild relatives of important crop species such as sunflower provide the basic foundation to improve and sustain the crop. Acquisition through exploration is the initial step in the germplasm conservatio...

  7. Utilisation of sulphur by sunflower (Helianthus annus. L) grown on alfisol

    International Nuclear Information System (INIS)

    Sreemannarayana, B.; Raju, A.S.; Sathe, Arun; Joseph, B.

    1993-01-01

    Studies were conducted at Agricultural Research Institute, Rajendernagar on a sulphur deficient red sandy loam soil under irrigated conditions. The sunflower genotypes, viz Morden, APPSH-11 and EC 68414 responded to sulphur from different sources such as gypsum, ammonium sulphate and single superphosphate. Genotype EC 68414 and ammonium sulphate proved superior for yield and uptake. There was increase in yield with the increase in sulphur levels upto 60 kg S per hectare. The sulphur utilisation was highest from ammonium sulphate, followed by gypsum and single superphosphate and it decreased with the increase in sulphur levels. 'A' values increased with increase in levels of sulphur application and also with advancement in age of the crop. (author). 13 refs., 2 tabs

  8. Sensory quality and appropriateness of raw and boiled Jerusalem artichoke tubers (Helianthus tuberosus L.).

    Science.gov (United States)

    Bach, Vibe; Kidmose, Ulla; Thybo, Anette K; Edelenbos, Merete

    2013-03-30

    The aim of the present study was to investigate the sensory attributes, dry matter and sugar content of five varieties of Jerusalem artichoke tubers and their relation to the appropriateness of the tubers for raw and boiled preparation. Sensory evaluation of raw and boiled Jerusalem artichoke tubers was performed by a trained sensory panel and a semi-trained consumer panel of 49 participants, who also evaluated the appropriateness of the tubers for raw and boiled preparation. The appropriateness of raw Jerusalem artichoke tubers was related to Jerusalem artichoke flavour, green nut flavour, sweetness and colour intensity, whereas the appropriateness of boiled tubers was related to celeriac aroma, sweet aroma, sweetness and colour intensity. In both preparations the variety Dwarf stood out from the others by being the least appropriate tuber. A few sensory attributes can be used as predictors of the appropriateness of Jerusalem artichoke tubers for raw and boiled consumption. Knowledge on the quality of raw and boiled Jerusalem artichoke tubers can be used to inform consumers on the right choice of raw material and thereby increase the consumption of the vegetable. © 2012 Society of Chemical Industry.

  9. BIOSORPTION OF MN (II IONS FROM AQUEOUS SOLUTION BY JERUSALEM ARTICHOKE (HELIANTHUS TUBEROSUS L. STALKS

    Directory of Open Access Journals (Sweden)

    Tsvetko PROKOPOV

    2017-09-01

    Full Text Available The purpose of this paper is to tested Jerusalem artichoke stalks as a cheap biosorbent for its ability to remove Mn (II ions from aqueous solution. Batch experiments were carried out to evaluate the effects of pH, biosorbent particle size, dosage, initial metal concentration and contact time. The maximum removal efficiency of about 97.0 % was reached at pH 8.0 by using of biosorbent particle size 530-850  m, adsorbent dosage 30 g/L, initial metal concentration 10 mg/L, temperature 20 oC, agitation speed 120 rpm and contact time 90 min. Pseudo-first order and pseudo-second order models were applied to describe the obtained kinetic data. The pseudo-second order model provided the best fit for experimental data with coefficient of determination R2 > 0.99. Freundlich and Langmuir isotherm models were used to describe metal adsorption. Equilibrium data agreed well with Langmuir isotherm with R2 = 0.993.

  10. Plantas cultivadas e invasoras como habitat para predadores do gênero Orius(Wolff (Heteroptera: anthocoridae Crops and weeds as host plants Orius species (Heteroptera: anthocoridae

    Directory of Open Access Journals (Sweden)

    Luís Cláudio Paterno Silveira

    2003-01-01

    Full Text Available O objetivo deste trabalho foi registrar as espécies de Orius associadas a plantas cultivadas e invasoras presentes em uma localidade de Minas Gerais e três de São Paulo, nos anos de 1999 e 2000. As coletas foram realizadas através de batidas das plantas no interior de sacos plásticos para desalojar os insetos. Posteriormente, as espécies foram separadas em laboratório. O predador Orius insidiosus (Say foi coletado nas culturas de milho (Zea mays L., milheto (Pennisetum glaucum (L. R.Br., sorgo (Sorghum spp., feijão (Phaseolus vulgaris L., girassol (Helianthus annuus L., alfafa (Medicago sativa L., soja [Glycine max (L. Merr.], crisântemo (Chrysanthemum spp., tango (Solidago canadensis L. e cartamus (Carthamus tinctorius L. e nas plantas invasoras picão-preto (Bidens pilosa L., caruru (Amaranthus sp., losna-branca (Parthenium hysterophorus L. e apaga-fogo (Alternanthera ficoidea L.. Orius thyestes Herring foi encontrado nas plantas invasoras picão-preto, caruru e apaga-fogo. Orius perpunctatus (Reuter e Orius sp. foram coletados principalmente nas plantas invasoras picão-preto, caruru e apaga-fogo e no milho. Constatou-se que muitas dessas plantas são reservatórios naturais para esses predadores, em termos de habitat, abrigo, presas e pólen.The aim of this research was to record the Orius species present on some crops and weeds in areas located in the southeast region in Brazil, during 1999 and 2000. The insect collections were made through the tapping method to dislodge the insects from the plant into a plastic bag. The identifications of the specimens was done in the laboratory. Orius insidiosus (Say was collected on the following crops: corn (Zea mays L., pearl millet (Pennisetum glaucum (L. R.Br., sorghum (Sorghum spp., bean (Phaseolus vulgaris L., sunflower (Helianthus annuus L., alfalfa (Medicago sativa L., soybean (Glycine max (L. Merr., chrysanthemum (Chrysanthemum spp., tango (Solidago canadensis L. and carthamus

  11. NUTRITIONAL DISORDERS BY DEFICIENCY IN SUNFLOWER var. CATISSOL-01 DESORDENS NUTRICIONAIS POR DEFICIÊNCIA EM GIRASSOL var. CATISSOL-01

    Directory of Open Access Journals (Sweden)

    Renato de Mello Prado

    2007-09-01

    Full Text Available

    This study was carried out in aerated nutritive solution to evaluate the effect of macronutrients, boron, and zinc omission on plant growth, dry matter production, visual symptoms and nutritional status of sunflower. The experiment was arranged in a completely randomized design with two replications and nine treatments corresponding to the complete solution (macro and micronutrients and individual omission of N, P, K, Ca, S, Mg, B and Zn. We measured plant height, number of leaves, stem diameter, leaf area and dry matter, and leaf content of macro and micronutrients. The individual omissions of N, P, K, and Ca were the most limiting to plant dry matter production, and resulted in morphological alterations represented by characteristical visual symptoms of the nutritional deficiency of each element.

    KEY-WORDS: Helianthus annuus; deficiency; nutritional disorder; nutrients; visual symptom.

    Objetivando-se avaliar o efeito da omissão de macronutrientes, de boro e de zinco no crescimento, na produção de matéria seca, nos sintomas visuais e no estado nutricional de plantas de girassol. Conduziu-se um experimento em solução nutritiva aerada. O delineamento experimental foi inteiramente casualizado, com nove tratamentos, que corresponderam à solução completa (macro e micronutrientes e à omissão individual de N, P, K, Ca, S, Mg, B e Zn, em duas repetições. Avaliou-se a altura das plantas, o número de folhas, o diâmetro do caule, a área foliar e a matéria seca, além do teor foliar de macro e micronutrientes. As omissões individuais de N, P, K e Ca foram as mais limitantes para o crescimento vegetativo do girassol, avaliado sobre a produção de matéria seca das plantas. Isso resultou em alterações morfológicas que se traduziram em sintomas visuais característicos da defici

  12. Avaliação de cultivares de girassol em savana de Roraima Avaliation of sunflower cultivars in savanna ecosystem of Roraima

    Directory of Open Access Journals (Sweden)

    Oscar José Smiderle

    2005-09-01

    Full Text Available A cultura do girassol (Helianthus annuus L. pode ser conduzida em diversas épocas do ano, destacando-se desta forma, entre as culturas viáveis de serem exploradas nas savanas (lavrados de Roraima. Entretanto, as cultivares podem apresentar diferenças de adaptação e desenvolvimento dependendo da área de cultivo. Assim, desenvolveu-se este estudo comparativo em área experimental da Embrapa Roraima em 2000, visando avaliar o desempenho de seis cultivares (Agrobel 910; Agrobel 920; Cargill 11; Embrapa 122; Morgan 742; e Rumbosol 91 semeadas em duas épocas (seca, com irrigação suplementar; e chuvosa em Boa Vista, Roraima. Utilizaram-se parcelas subdivididas num delineamento de blocos ao acaso com quatro repetições, sendo as duas épocas de semeadura em 20 de janeiro e 19 de julho. As subparcelas constaram de quatro fileiras de 6 m, distanciadas de 0,90 m, sendo 0,30 m o espaçamento entre plantas. As cultivares Cargill 11, Rumbosol 91 e Agrobel 910 foram as mais produtivas para cultivo nas condições climáticas das savanas de Roraima, e a semeadura em janeiro é mais indicada, comparada a de julho.Sunflower (Helianthus annuus L. can be cultivated at different times of the year. Hence, this oilseed crop stands out among the viable crops to be explored in the savanna area of Roraima. However, cultivars can perform differently depending on the region they are grown. Accounting on this, a study was carried out to evaluate the effect of sowing time for this crop in Boa Vista, Roraima, utilizing six cultivars (Agrobel 910; Agrobel 920; Cargill 11; Embrapa 122; Morgan 742; and Rumbosol 91 in a split-plot scheme, in a randomized complete blocks design, with two plots (sowing time: January 20, with supplementation of water, and July 19. The sub-plots consisted of four rows, measuring 6 m each, distanciated 0.90 m; the distance between plants inside the row was 0,30 m. The cultivars cargill 11, rumbosol 91 and agrobel 910 were the most productive

  13. Phytoremediation modelling - phytoextraction of 137Cs, 133Ba, and 90Sr from liquid media and artificially contaminated soil

    International Nuclear Information System (INIS)

    Smrcek, S.; Masnerova, G.

    2002-01-01

    The phytoremediation model based on experiments with plants cultivated in vitro in media supplemented with radionuclide salts was investigated. The plant species Brassica napus, Sinapis alba, Helianthus annuus, Zea mays and Pisum sativum were cultivated on the Murashige-Skoog basal salt mixture enriched with salts of 137 Cs, 133 Ba, and 90 Sr in aseptic conditions. The time-dependent radioactivity decrease in the medium was determined using LSC, and the phytoextraction curves were plotted. Radioactivity in the plant roots and shoots was measured and the efficiency of phytoextraction and the distribution between the roots and shoots as a measure of radionuclide transport in the plant tissues were calculated for each of the plants used. Cultivation experiments were also performed on artificially contaminated soil. Seeds of the plants were placed into contaminated soil and cultivated for 2 months in conditions similar to those of the in vitro experiments. The extracted radioactivity and distribution between roots and shoots were determined. The in vitro experiments simulated extraction of the radionuclide salt from solution analogously to real extraction from the soil solution, while the processes occurring in the rhizosphere were eliminated. The phytoextraction efficiency in terms of the percentage of the starting radioactivity ranged from 12 to 31 % for 90 Sr, 8 to 24% for 137 Cs, and 12 to 17 % for 133 Ba in a cultivation cycle. The root/shoot radioactivity ratios demonstrate that the plant species used may be suitable for real phytoremediation. The experiments in which the plants were cultivated from seeds in artificial contaminated substrate showed that the ability of roots to extract radionuclide salts from their environment remains unchanged. The relative efficiency values were lower than for the extraction from solutions (3 to 11.5 % for 90 Sr, 1.5 to 4 % for 137 Cs, and 1 to 6.2 %, for 133 Ba), but in this process, the equilibrium between the soil particles

  14. Análise da variabilidade de isoenzimas em acessos e cultivares de girassol Isozyme variability analysis in plant introductions and cultivars of sunflower

    Directory of Open Access Journals (Sweden)

    Rogério Fernandes de Souza

    2001-05-01

    Full Text Available O número de genótipos de girassol (Helianthus annuus L. disponíveis aos agricultores é pequeno e pouco se conhece sobre os genótipos provenientes de outros países que possam ser utilizados no melhoramento genético desta cultura. O objetivo deste trabalho foi analisar a variabilidade genética de 31 acessos e de cinco cultivares nos sistemas isoenzimáticos fosfoglicomutase (PGM, 6fosfogliconato desidrogenase (PGD, fosfoglicoisomerase (PGI e esterase (EST. Utilizou-se a técnica de eletroforese em gel de amido/penetrose para o fracionamento das isoenzimas da PGM, PGI e PGD e focalização isoelétrica para EST. Foram detectados um total de seis locos e 14 alelos para estes quatro sistemas. Observou-se variantes alélicas para os locos Pgi2, Pgm1, Pgd2, cada um com dois alelos, e para Est1, que apresentou seis alelos. Os testes de adequação aos modelos de equilíbrio de Hardy-Weinberg e de Wright evidenciaram que em dez acessos houve um desvio significativo de endocruzamento.The amount of available genotypes of sunflower (Helianthus annuus L. to the agriculturists is minimum and the knowledge concerning genotypes from other countries, which could be used in this crop plant breeding is scarcely known. This work had the purpose of assessing the genetic variability of 31 accessions and of five cultivars to the isoenzymatic systems phosphoglucomutase (PGM, phosphogluconate dehydrogenase (PDG, glucose-6-phosphate isomerase (PGI and carboxylesterase (EST. The starch or penetrose gel electrophoresis technique was applied aiming the fractionation of the PGM, PGI and PGD isoenzymes, and the EST isoelectric focusing. Six loci and 14 alleles to these four systems were detected. Allelic variation were observed on the Pgi2, Pgm1, Pgd2 loci, two alleles each, and to Est1, which displayed six alleles. The goodness of fit tests for the Hardy-Weinberg and Wright equilibrium models indicated that ten accession showed a significant excess of selfing.

  15. Kajian Beberapa Tumbuhan Obat Yang Digunakan Dalam Pengobatan Malaria Secara Tradisional

    Directory of Open Access Journals (Sweden)

    Ira Indriaty Paskalita Bule Sopi

    2017-02-01

    Full Text Available AbstractMalaria is one of community health problems that can cause death especially to high risk group. Malaria treatment using some antimalarial drugs have been resistance so that there is using medicinal plants into traditional antimalarial treatment that have been tested scientific. There are lots of people that use traditional treatment for healing the diseases. This case shows there’s still strong of community tradition about looking for treatment. One of the diseases whose treatment using traditional and modern medicine is malaria. Malaria is one of acute or chronic often be caused by plasmodium parasites. This review aimed is to describe medicinal plants that used on traditional antimalarial treatment. Review of the literature with search and date collection from various references about medicinal plants which used in traditional antimalarial treatment. Method has been done by reviewing literature with search and the data has been collection then described to be an information that shows about kind of medicinal plants and result testing about them. There are some plants that is those are lime tree (Harmsiopanax aculeatus Harms, red fruit (Pandanus conoideus Lam., bark of jack fruit (Artocarpus champedem, fruit betel (Piper betle (L. R. Br., bark of mundu (Garcinia dulcis Kurz, benalu of mango (Dendrophthoe pentandra, mangosteen (Garcinia mangostana Linn., fruit of Morinda citrifolia L, and sunflower (Helianthus annuus L.. From the result that has been accepted shows active compound content that contained in some kind of medicinal plants which have been tested in traditional antimalarial treatment. Keywords: Plant, medicinal, traditional, malariaAbstrakMalaria merupakan salah satu masalah kesehatan masyarakat yang dapat menyebabkan kematian terutama pada kelompok berisiko tinggi. Pengobatan malaria dengan penggunaan beberapa obat anti malaria sudah mengalami resistensi sehingga perlu adanya pemanfaatan tumbuhan obat dalam pengobatan

  16. C3 versus C4 cavitation resistance and embolism repair under different levels of soil moisture availability

    Science.gov (United States)

    Comparison of maize and sunflower (Helianthus) under deficit irrigation indicates that maize has more conservative water use with lower maximum hydraulic conductance than Helianthus. We observe that maize under deficit irrigation dramatically reduces transpiration while Helianthus maintains high wat...

  17. The Population Genomics of Sunflowers and Genomic Determinants of Protein Evolution Revealed by RNAseq

    Directory of Open Access Journals (Sweden)

    Loren H. Rieseberg

    2012-10-01

    Full Text Available Few studies have investigated the causes of evolutionary rate variation among plant nuclear genes, especially in recently diverged species still capable of hybridizing in the wild. The recent advent of Next Generation Sequencing (NGS permits investigation of genome wide rates of protein evolution and the role of selection in generating and maintaining divergence. Here, we use individual whole-transcriptome sequencing (RNAseq to refine our understanding of the population genomics of wild species of sunflowers (Helianthus spp. and the factors that affect rates of protein evolution. We aligned 35 GB of transcriptome sequencing data and identified 433,257 polymorphic sites (SNPs in a reference transcriptome comprising 16,312 genes. Using SNP markers, we identified strong population clustering largely corresponding to the three species analyzed here (Helianthus annuus, H. petiolaris, H. debilis, with one distinct early generation hybrid. Then, we calculated the proportions of adaptive substitution fixed by selection (alpha and identified gene ontology categories with elevated values of alpha. The “response to biotic stimulus” category had the highest mean alpha across the three interspecific comparisons, implying that natural selection imposed by other organisms plays an important role in driving protein evolution in wild sunflowers. Finally, we examined the relationship between protein evolution (dN/dS ratio and several genomic factors predicted to co-vary with protein evolution (gene expression level, divergence and specificity, genetic divergence [FST], and nucleotide diversity pi. We find that variation in rates of protein divergence was correlated with gene expression level and specificity, consistent with results from a broad range of taxa and timescales. This would in turn imply that these factors govern protein evolution both at a microevolutionary and macroevolutionary timescale. Our results contribute to a general understanding of the

  18. Sunflower: A potential fructan-bearing crop?

    Directory of Open Access Journals (Sweden)

    Giselle eMartinez-Noel

    2015-10-01

    Full Text Available Grain filling in sunflower (Helianthus annuus L. mainly depends on actual photosynthesis, being the contribution of stored reserves in stems (sucrose, hexoses and starch rather low. Drought periods during grain filling often reduce yield. Increasing the capacity of stem to store reserves could help to increase grain filling and yield stability in dry years. Fructans improve water uptake in soils at low water potential, and allow the storage of large amount of assimilates per unit tissue volume that can be readily remobilized to grains. Sunflower is a close relative to Jerusalem artichoke (Helianthus tuberosus L., which accumulates large amounts of fructan (inulin in tubers and true stems. The reason why sunflower does not accumulate fructans is obscure. Through a bioinformatics analysis of a sunflower transcriptome database, we found sequences that are homologous to dicotyledon and monocotyledon fructan synthesis genes. A HPLC analysis of stem sugar composition revealed the presence of low amounts of 1-kestose, while a drastic enhancement of endogenous sucrose levels by capitulum removal did not promote 1-kestose accumulation. This suggests that the regulation of fructan synthesis in this species may differ from the currently best known model, mainly derived from research on Poaceae, where sucrose acts as both a signaling molecule and substrate, in the induction of fructan synthesis. Thus, sunflower might potentially constitute a fructan-bearing species, which could result in an improvement of its performance as a grain crop. However, a large effort is needed to elucidate how this up to now unsuspected potential could be effectively

  19. Selección de abonos verdes para los suelos de Turmequé (Boyacá

    Directory of Open Access Journals (Sweden)

    Viteri Silvio

    2008-08-01

    Full Text Available

    El objetivo de este estudio fue identificar asociaciones de abonos verdes con el mejor potencial como fuente de materia orgánica para los suelos del municipio de Turmequé (Boyacá. Los experimentos se desarrollaron en tres fincas, ubicadas a 2.300, 2.650 y 2.860 msnm. De cada finca se tomó una muestra representativa de suelo, que se envió al laboratorio para análisis de fertilidad. Los tratamientos incluyeron 10 asociaciones triples y 3 cuádruples. Las asociaciones se conformaron con la leguminosa vicia atropurpúrea (Vicia sativa L. en combinación con avena caldas (Avena sativa L., girasol (híbrido Hi Doris (Helianthus annus L., higuerilla (Ricinus communis L., nabo forrajero (Raphanus sativus L. o quinua (Chenopodium quinua. El porcentaje de semilla leguminosa respecto a las otras especies en las asociaciones triples fue 40:30:30 y en las cuádruples 40:20:20:20. El porcentaje de semilla de cada especie se calculó con base en la cantidad recomendada para siembra en monocultivo. Se utilizó el diseño de bloques completos al azar, con 13 tratamientos y 3 repeticiones. Las variables determinadas fueron producción de materia verde por especie, por asociación y por las plantas arvenses y materia seca por asociación. Además, se observó la tolerancia de las especies al ataque de plagas y enfermedades. Los resultados indicaron que entre las especies estudiadas las más promisorias son el nabo forrajero, la avena y la vicia, conformando la asociación vicia × avena × nabo forrajero.

  20. Physicochemical studies on sunflower oil blended with cold pressed tiger nut oil during the deep frying process; Estudios fisicoquimicos sobre mezclas de aceite de girasol con aceite de chufa prensado en frio durante el proceso de fritura

    Energy Technology Data Exchange (ETDEWEB)

    Al Rehah, F. M.; Anany, A. M.

    2012-07-01

    Sunflower oils were blended with different levels of cold pressed tiger nut oil. Blended oils were obtained by mixing tiger nut oil with sunflower oil at the volume ratios of 0:100, 10: 90, 20: 80, 30: 70, 40: 60, 50:50 and 100: 0. The effects of deep frying on physico-chemical parameters (Free Fatty Acid (FFA), Peroxide Value (PV), thiobarbituric acid value (TBA), iodine value, Total Polar Compounds (TPC), color and viscosity) were evaluated over 30 hours of the frying process. The total phenolic content of native oils was determined. GLC analysis was performed to illustrate the fatty acid composition of sunflower oil, tiger nut oil and binary mixtures of them as well as their oxidation rates. The pure and blended oils were heated at 180 degree centigrade {+-} 5 degree centigrade, then frozen French fried potatoes were fried every 30 min. Oil samples were taken every 5 h and the entire continuous frying period was 30 h. The results showed that fresh sunflower oil had significantly the highest value of COX (7.25); while tiger nut oil had significantly the lowest (2.24). Mixing sunflower oil with different levels of tiger nut oil led to an increase in its stability against oxidation. The phenolic content of cold pressed tiger nut oil was about 3.3 times as high as that of sunflower oil. The analytical data showed that the lowest deterioration during the frying process occurred in tiger nut oil and the highest in sunflower. The changes in the physico-chemical parameters were controlled and significantly (P < 0.05) decreased when tiger nut /sunflower oil (W/W) proportions were varied between 20/80 to 50/50. The obtained results indicate that mixing sunflower oil with cold pressed tiger nut oil increased the stability and hence improved the quality of sunflower oil during the frying process. (Author) 68 refs.

  1. The sunflower downy mildew pathogen Plasmopara halstedii.

    Science.gov (United States)

    Gascuel, Quentin; Martinez, Yves; Boniface, Marie-Claude; Vear, Felicity; Pichon, Magalie; Godiard, Laurence

    2015-02-01

    Downy mildew of sunflower is caused by Plasmopara halstedii (Farlow) Berlese & de Toni. Plasmopara halstedii is an obligate biotrophic oomycete pathogen that attacks annual Helianthus species and cultivated sunflower, Helianthus annuus. Depending on the sunflower developmental stage at which infection occurs, the characteristic symptoms range from young seedling death, plant dwarfing, leaf bleaching and sporulation to the production of infertile flowers. Downy mildew attacks can have a great economic impact on sunflower crops, and several Pl resistance genes are present in cultivars to protect them against the disease. Nevertheless, some of these resistances have been overcome by the occurrence of novel isolates of the pathogen showing increased virulence. A better characterization of P. halstedii infection and dissemination mechanisms, and the identification of the molecular basis of the interaction with sunflower, is a prerequisite to efficiently fight this pathogen. This review summarizes what is currently known about P. halstedii, provides new insights into its infection cycle on resistant and susceptible sunflower lines using scanning electron and light microscopy imaging, and sheds light on the pathogenicity factors of P. halstedii obtained from recent molecular data. Kingdom Stramenopila; Phylum Oomycota; Class Oomycetes; Order Peronosporales; Family Peronosporaceae; Genus Plasmopara; Species Plasmopara halstedii. Sunflower seedling damping off, dwarfing of the plant, bleaching of leaves, starting from veins, and visible white sporulation, initially on the lower side of cotyledons and leaves. Plasmopara halstedii infection may severely impact sunflower seed yield. In spring, germination of overwintered sexual oospores leads to sunflower root infection. Intercellular hyphae are responsible for systemic plant colonization and the induction of disease symptoms. Under humid and fresh conditions, dissemination structures are produced by the pathogen on all

  2. SNP discovery and development of a high-density genotyping array for sunflower.

    Directory of Open Access Journals (Sweden)

    Eleni Bachlava

    Full Text Available Recent advances in next-generation DNA sequencing technologies have made possible the development of high-throughput SNP genotyping platforms that allow for the simultaneous interrogation of thousands of single-nucleotide polymorphisms (SNPs. Such resources have the potential to facilitate the rapid development of high-density genetic maps, and to enable genome-wide association studies as well as molecular breeding approaches in a variety of taxa. Herein, we describe the development of a SNP genotyping resource for use in sunflower (Helianthus annuus L.. This work involved the development of a reference transcriptome assembly for sunflower, the discovery of thousands of high quality SNPs based on the generation and analysis of ca. 6 Gb of transcriptome re-sequencing data derived from multiple genotypes, the selection of 10,640 SNPs for inclusion in the genotyping array, and the use of the resulting array to screen a diverse panel of sunflower accessions as well as related wild species. The results of this work revealed a high frequency of polymorphic SNPs and relatively high level of cross-species transferability. Indeed, greater than 95% of successful SNP assays revealed polymorphism, and more than 90% of these assays could be successfully transferred to related wild species. Analysis of the polymorphism data revealed patterns of genetic differentiation that were largely congruent with the evolutionary history of sunflower, though the large number of markers allowed for finer resolution than has previously been possible.

  3. Lateral CO2 diffusion inside dicotyledonous leaves can be substantial: quantification in different light intensities.

    Science.gov (United States)

    Morison, James I L; Lawson, Tracy; Cornic, Gabriel

    2007-11-01

    Substantial lateral CO(2) diffusion rates into leaf areas where stomata were blocked by grease patches were quantified by gas exchange and chlorophyll a fluorescence imaging in different species across the full range of photosynthetic photon flux densities (PPFD). The lateral CO(2) flux rate over short distances was substantial and very similar in five dicotyledonous species with different vascular anatomies (two species with bundle sheath extensions, sunflower [Helianthus annuus] and dwarf bean [Phaseolus vulgaris]; and three species without bundle sheath extensions, faba bean [Vicia faba], petunia [Petunia hybrida], and tobacco [Nicotiana tabacum]). Only in the monocot maize (Zea mays) was there little or no evident lateral CO(2) flux. Lateral diffusion rates were low when PPFD diffusion represented 15% to 24% of the normal CO(2) assimilation rate. Smaller patches and higher ambient CO(2) concentration increased lateral CO(2) diffusion rates. Calculations with a two-dimensional diffusion model supported these observations that lateral CO(2) diffusion over short distances inside dicotyledonous leaves can be important to photosynthesis. The results emphasize that supply of CO(2) from nearby stomata usually dominates assimilation, but that lateral supply over distances up to approximately 1 mm can be important if stomata are blocked, particularly when assimilation rate is low.

  4. The Determination of the Biochemical Properties of Some Monofloral Honey Samples Produced across Turkey

    Directory of Open Access Journals (Sweden)

    Aziz Gül

    2016-12-01

    Full Text Available This study was conducted in 2013 to determine the biochemical properties of 10 different monofloral honey types produced across Turkey. For the study, honey samples were obtained from beekeepers and the identity and relative percentage of dominant pollen types in samples was determined through microscopic analysis. Pollen analysis revealed that honey types chaste tree (Vitex agnus-castus and sunflower (Helianthus annuus contained high proportions of each respective pollen type. These proportions reached as high as 86%, while other honey types such as Anason had low Anasom pollen content, occurring at 45% in whole honey samples. Biochemical analysis revealed that the average honey sample quality characteristics were as followings: ash 0.37±0.04, electricity conductivity 0.79±0.07 mS/cm, moisture 19.15±0.09%, pH 3.97±0.02, acidity 29.07±0.39 meq/kg, hydroxymethylfurfural (HMF, 6.17±0.76 mg/kg, diastase 22.05±0.00, invert sugar 69.72±0.49% and sucrose 2.90±0.30%. These analyses confirmed that honey samples met standards outlined by the Turkish Food Codex Honey Standard, European Union Honey Standard and Codex Standards respectively.

  5. Heliolactone, a non-sesquiterpene lactone germination stimulant for root parasitic weeds from sunflower.

    Science.gov (United States)

    Ueno, Kotomi; Furumoto, Toshio; Umeda, Shuhei; Mizutani, Masaharu; Takikawa, Hirosato; Batchvarova, Rossitza; Sugimoto, Yukihiro

    2014-12-01

    Root exudates of sunflower (Helianthus annuus L.) line 2607A induced germination of seeds of root parasitic weeds Striga hermonthica, Orobanche cumana, Orobanche minor, Orobanche crenata, and Phelipanche aegyptiaca. Bioassay-guided purification led to the isolation of a germination stimulant designated as heliolactone. FT-MS analysis indicated a molecular formula of C20H24O6. Detailed NMR spectroscopic studies established a methylfuranone group, a common structural component of strigolactones connected to a methyl ester of a C14 carboxylic acid via an enol ether bridge. The cyclohexenone ring is identical to that of 3-oxo-α-ionol and the other part of the molecule corresponds to an oxidized carlactone at C-19. It is a carlactone-type molecule and functions as a germination stimulant for seeds of root parasitic weeds. Heliolactone induced seed germination of the above mentioned root parasitic weeds, while dehydrocostus lactone and costunolide, sesquiterpene lactones isolated from sunflower root exudates, were effective only on O. cumana and O. minor. Heliolactone production in aquacultures increased when sunflower seedlings were grown hydroponically in tap water and decreased on supplementation of the culture with either phosphorus or nitrogen. Costunolide, on the other hand, was detected at a higher concentration in well-nourished medium as opposed to nutrient-deficient media, thus suggesting a contrasting contribution of heliolactone and the sesquiterpene lactone to the germination of O. cumana under different soil fertility levels. Copyright © 2014 Elsevier Ltd. All rights reserved.

  6. Use of Blue-Green Fluorescence and Thermal Imaging in the Early Detection of Sunflower Infection by the Root Parasitic Weed Orobanche cumana Wallr.

    Directory of Open Access Journals (Sweden)

    Carmen M. Ortiz-Bustos

    2017-05-01

    Full Text Available Although the impact of Orobanche cumana Wallr. on sunflower (Helianthus annuus L. becomes evident with emergence of broomrape shoots aboveground, infection occurs early after sowing, the host physiology being altered during underground parasite stages. Genetic resistance is the most effective control method and one of the main goals of sunflower breeding programmes. Blue-green fluorescence (BGF and thermal imaging allow non-destructive monitoring of plant diseases, since they are sensitive to physiological disorders in plants. We analyzed the BGF emission by leaves of healthy sunflower plantlets, and we implemented BGF and thermal imaging in the detection of the infection by O. cumana during underground parasite development. Increases in BGF emission were observed in leaf pairs of healthy sunflowers during their development. Lower BGF was consistently detected in parasitized plants throughout leaf expansion and low pigment concentration was detected at final time, supporting the interpretation of a decrease in secondary metabolites upon infection. Parasite-induced stomatal closure and transpiration reduction were suggested by warmer leaves of inoculated sunflowers throughout the experiment. BGF imaging and thermography could be implemented for fast screening of sunflower breeding material. Both techniques are valuable approaches to assess the processes by which O. cumana alters physiology (secondary metabolism and photosynthesis of sunflower.

  7. Use of Blue-Green Fluorescence and Thermal Imaging in the Early Detection of Sunflower Infection by the Root Parasitic Weed Orobanche cumana Wallr.

    Science.gov (United States)

    Ortiz-Bustos, Carmen M; Pérez-Bueno, María L; Barón, Matilde; Molinero-Ruiz, Leire

    2017-01-01

    Although the impact of Orobanche cumana Wallr. on sunflower ( Helianthus annuus L.) becomes evident with emergence of broomrape shoots aboveground, infection occurs early after sowing, the host physiology being altered during underground parasite stages. Genetic resistance is the most effective control method and one of the main goals of sunflower breeding programmes. Blue-green fluorescence (BGF) and thermal imaging allow non-destructive monitoring of plant diseases, since they are sensitive to physiological disorders in plants. We analyzed the BGF emission by leaves of healthy sunflower plantlets, and we implemented BGF and thermal imaging in the detection of the infection by O. cumana during underground parasite development. Increases in BGF emission were observed in leaf pairs of healthy sunflowers during their development. Lower BGF was consistently detected in parasitized plants throughout leaf expansion and low pigment concentration was detected at final time, supporting the interpretation of a decrease in secondary metabolites upon infection. Parasite-induced stomatal closure and transpiration reduction were suggested by warmer leaves of inoculated sunflowers throughout the experiment. BGF imaging and thermography could be implemented for fast screening of sunflower breeding material. Both techniques are valuable approaches to assess the processes by which O. cumana alters physiology (secondary metabolism and photosynthesis) of sunflower.

  8. Xanthium italicum, Xanthium strumarium and Arctium lappa as new hosts for Diaporthe helianthi.

    Science.gov (United States)

    Vrandecic, Karolina; Jurkovic, Drazenka; Riccioni, Luca; Cosic, Jasenka; Duvnjak, Tomislav

    2010-07-01

    Sunflower (Helianthus annuus) stem canker caused by Diaporthe helianthi is one of the most important sunflower diseases in Croatia. Until recently, sunflower was the only known host for D. helianthi. In our research carried out in the area of Eastern Croatia, isolates of Diaporthe/Phomospis were collected from Xanthium italicum, X. strumarium and Arctium lappa. Using morphological, cultural and molecular ITS rDNA data, isolates from these weeds were identified as D. helianthi. The following isolates were used in the pathogenicity test: one isolate originated from sunflower (Su5/04), three from X. italicum (Xa2, Xa3 and Xa5), two from X. strumarium (Xa9 and Xa12), one from Xanthium sp. (Xa13) and one from A. lappa (Ar3). According to the results, it was determined that isolate Xa5 (originated from X. italicum) was the most pathogenic to sunflower stems. The average length of the lesion was 11.3 cm. The lowest level of pathogenicity was found in Xa9 (isolated from X. strumarium). The length of the lesion was 0.1 cm.

  9. Response of sunflower to different planting dates in cotton based cropping system

    International Nuclear Information System (INIS)

    Yousaf, M.; Shakoor, A.; Rana, M.A.

    2007-01-01

    A field study on sunflower (Helianthus annuus L) was conducted for three. years (1991-1993) on different planting dates. Two hybrids (Hysun-33 and PI-6480) were sown on five different dates with 15 days interval from January 15 to March 15 at Cotton Research Station, Multan. Significant higher seed yield of 1880 and 2097 kg ha-1 was obtained when the crop was planted on February 1 and 15 than other treatments. The yield significantly decreased when sunflower was planted on January 15 (1264 kg ha-l), March 1 (1382 kg ha-l) and March 15 (927 kg hall. Maturity period was longest (128 days) of early sown (January 15) and shortest of late sown (March 15) sunflower hybrids. Therefore, it can be concluded that sunflower planted on February 1 to 15 gave higher seed yield as well as allowed enough time for land preparation and thereby, planting of cotton crop in the same field during its regular planting time. (author)

  10. A mathematical approach for estimating light absorption by a crop from continuous radiation measurements and restricted absorption data

    International Nuclear Information System (INIS)

    Zanetti, P.; Delfine, S.; Alvino, A.

    1999-01-01

    A sunflower (Helianthus annuus L.) crop was grown with four different water regimes to obtain different canopy growth and light absorption capability. The incoming solar radiation was recorded by an agrometeorological field station, while the percentage absorbed by the crop was measured by a ceptometer at four times and on a quasi-daily basis over the all reproductive phases. Triangulation on these data points and cubic interpolation was used to model the radiation absorbed by the canopies over time. In order to validate this approach, the procedure was also applied to a small subset of the data. Numerical quadrature based on an adaptive recursive Simpson’s rule was used to integrate the radiation absorbed by the canopies. The numerical quadrature was applied (i) to the whole data collected, represented by a cubic two-dimensional spline interpolation function, and (ii) to the interpolated values obtained from the restricted data set. The differences between (i) and (ii) for the four water regimes varied from 3.6 to 5.2% approximately. These comparisons demonstrated the potential of a restricted data interpolation model for investigating the complex phenomena of light interception by canopies with different plant structure. (author)

  11. Reversible Heat-Induced Inactivation of Chimeric β-Glucuronidase in Transgenic Plants1

    Science.gov (United States)

    Almoguera, Concepción; Rojas, Anabel; Jordano, Juan

    2002-01-01

    We compared the expression patterns in transgenic tobacco (Nicotiana tabacum) of two chimeric genes: a translational fusion to β-glucuronidase (GUS) and a transcriptional fusion, both with the same promoter and 5′-flanking sequences of Ha hsp17.7 G4, a small heat shock protein (sHSP) gene from sunflower (Helianthus annuus). We found that immediately after heat shock, the induced expression from the two fusions in seedlings was similar, considering chimeric mRNA or GUS protein accumulation. Surprisingly, we discovered that the chimeric GUS protein encoded by the translational fusion was mostly inactive in such conditions. We also found that this inactivation was fully reversible. Thus, after returning to control temperature, the GUS activity was fully recovered without substantial changes in GUS protein accumulation. In contrast, we did not find differences in the in vitro heat inactivation of the respective GUS proteins. Insolubilization of the chimeric GUS protein correlated with its inactivation, as indicated by immunoprecipitation analyses. The inclusion in another chimeric gene of the 21 amino-terminal amino acids from a different sHSP lead to a comparable reversible inactivation. That effect not only illustrates unexpected post-translational problems, but may also point to sequences involved in interactions specific to sHSPs and in vivo heat stress conditions. PMID:12011363

  12. SUMO-Dependent Synergism Involving Heat Shock Transcription Factors with Functions Linked to Seed Longevity and Desiccation Tolerance

    Directory of Open Access Journals (Sweden)

    Raúl Carranco

    2017-06-01

    Full Text Available A transcriptional synergism between HaHSFA9 (A9 and HaHSFA4a (A4a contributes to determining longevity and desiccation tolerance of sunflower (Helianthus annuus, L. seeds. Potential lysine SUMOylation sites were identified in A9 and A4a and mutated to arginine. We show that A9 is SUMOylated in planta at K38. Although we did not directly detect SUMOylated A4a in planta, we provide indirect evidence from transient expression experiments indicating that A4a is SUMOylated at K172. Different combinations of wild type and SUMOylation site mutants of A9 and A4a were analyzed by transient expression in sunflower embryos and leaves. Although most of the precedents in literature link SUMOylation with repression, the A9 and A4a synergism was fully abolished when the mutant forms for both factors were combined. However, the combination of mutant forms of A9 and A4a did not affect the nuclear retention of A4a by A9; therefore, the analyzed mutations would affect the synergism after the mutual interaction and nuclear co-localization of A9 and A4a. Our results suggest a role for HSF SUMOylation during late, zygotic, embryogenesis. The SUMOylation of A9 (or A4a would allow a crucial, synergic, transcriptional effect that occurs in maturing sunflower seeds.

  13. Fatty Acid and Proximate Composition of Bee Bread

    Directory of Open Access Journals (Sweden)

    Muammer Kaplan

    2016-01-01

    Full Text Available Palynological spectrum, proximate and fatty acid (FA composition of eight bee bread samples of different botanical origins were examined and significant variations were observed. The samples were all identified as monofloral, namely Castanea sativa (94.4 %, Trifolium spp. (85.6 %, Gossypium hirsutum (66.2 %, Citrus spp. (61.4 % and Helianthus annuus (45.4 %. Each had moisture content between 11.4 and 15.9 %, ash between 1.9 and 2.54 %, fat between 5.9 and 11.5 %, and protein between 14.8 and 24.3 %. A total of 37 FAs were determined with most abundant being (9Z,12Z,15Z-octadeca-9,12,15-trienoic, (9Z,12Z-octadeca-9,12-dienoic, hexadecanoic, (Z-octadec-9-enoic, (Z-icos-11-enoic and octadecanoic acids. Among all, cotton bee bread contained the highest level of ω-3 FAs, i.e. 41.3 %. Unsaturated to saturated FA ratio ranged between 1.38 and 2.39, indicating that the bee bread can be a good source of unsaturated FAs.

  14. Radionuclides: Accumulation and Transport in Plants.

    Science.gov (United States)

    Gupta, D K; Chatterjee, S; Datta, S; Voronina, A V; Walther, C

    Application of radioactive elements or radionuclides for anthropogenic use is a widespread phenomenon nowadays. Radionuclides undergo radioactive decays releasing ionizing radiation like gamma ray(s) and/or alpha or beta particles that can displace electrons in the living matter (like in DNA) and disturb its function. Radionuclides are highly hazardous pollutants of considerable impact on the environment, food chain and human health. Cleaning up of the contaminated environment through plants is a promising technology where the rhizosphere may play an important role. Plants belonging to the families of Brassicaceae, Papilionaceae, Caryophyllaceae, Poaceae, and Asteraceae are most important in this respect and offer the largest potential for heavy metal phytoremediation. Plants like Lactuca sativa L., Silybum marianum Gaertn., Centaurea cyanus L., Carthamus tinctorius L., Helianthus annuus and H. tuberosus are also important plants for heavy metal phytoremediation. However, transfer factors (TF) of radionuclide from soil/water to plant ([Radionuclide]plant/[Radionuclide]soil) vary widely in different plants. Rhizosphere, rhizobacteria and varied metal transporters like NRAMP, ZIP families CDF, ATPases (HMAs) family like P1B-ATPases, are involved in the radio-phytoremediation processes. This review will discuss recent advancements and potential application of plants for radionuclide removal from the environment.

  15. Dicty_cDB: Contig-U15955-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) CCEL1698.b1_D17.ab1 CCE(LMS) endive Cichorium end... 62 6e-17 2 ( EL371825 ) CCEL13847.b1_M05.ab1 CCE(LMS) endive... Cichorium en... 62 6e-17 2 ( EL346889 ) CCEL3046.b1_L18.ab1 CCE(LMS) endive Cichorium end... 62 6e-1...7 2 ( EL344768 ) CCEL12670.b1_L24.ab1 CCE(LMS) endive Cichorium en... 62 6e-17 2 ...( EH685871 ) CCIM10663.b1_N02.ab1 CCI(LMS) chicory Cichorium i... 68 6e-17 2 ( EL350945 ) CCEL757.b1_J22.ab1 CCE(LMS) endive...6 ( CD857717 ) DH0AG9ZB01RM1 HaDisDM710vsCt Helianthus annuus cD... 60 1e-14 3 ( EL371356 ) CCEL13372.b1_H08.ab1 CCE(LMS) endive

  16. Feeding and oviposition preference of Phyllophaga cuyabana (Moser) (Coleoptera: Melolonthidae) on several crops

    International Nuclear Information System (INIS)

    Oliveira, Lenita J.; Hoffmann-Campo, Clara B.

    2007-01-01

    Laboratory and greenhouse experiments were carried out to study food and oviposition preference by Phyllophaga cuyabana (Moser) on different plant species as Cajanus cajan L. (pigeon pea), Crotalaria juncea L. (sun hemp), Crotalaria spectabilis Roth (showy crotalaria), Crotalaria ochroleuca G. Don (slenderleaf rattlebox), Glycine max [L.] Merrill (soybean), Gossypium hirsutum L. (cotton), Helianthus annuus L. (sunflower), Stizolobium aterrimum [Mucuna aterrima] Piper and Tracey (velvetbean) and Zea mays L. (mayze). In no-choice experiments, the number of eggs layed in sunflower, C. juncea and soybean was larger compared to cotton. Despite the fact that the adults did not discriminate among plants, in dual-choice test, the proportion of eggs layed and leaf consumption by P. cuyabana adults in soybean were significantly higher than in C. spectabilis. The larval distribution in the soil was at random in multiple-choice, without any trend of preference, but in dual-choice, when soybean was the control, larvae always preferred to feed on its roots. P. cuyabana adults had preference for more suitable hosts and that could stand their offspring survival. This behaviour can be usefully exploited in an integrated management program for this pest. (author)

  17. Na+ accumulation in shoot is related to water transport in K+-starved sunflower plants but not in plants with a normal K+ status.

    Science.gov (United States)

    Quintero, José Manuel; Fournier, José María; Benlloch, Manuel

    2007-01-01

    Sunflower plants (Helianthus annuus L. cv Sun-Gro 380) grown in nutrient solutions with different K+ levels were used to study the effect of potassium status on water uptake, Na+ uptake and Na+ accumulation in the shoot. Changes in nutrient potassium levels induced evident differences in internal potassium content. When both low and normal-K+ plants were exposed to 22 degrees C and salinity conditions (25 or 50 mM NaCl) during a short time period (9h), water uptake in low-K+ plants was greater than in normal-K+ plants. In addition, K+ starvation favoured the Na+ uptake and the Na+ accumulation both in the root and in the shoot. When the plants were exposed to heat stress by a sharp increase of the temperature to 32 degrees C during the same period of time, the stimulating effect of K+ starvation on the water uptake was even greater. The high temperature increased Na+ uptake in both types of plants, but the Na+ accumulation in the shoot was only favoured in low-K+ plants. The results suggest that Na+ accumulation in the shoot is more dependent on the water uptake in low-K+ plants than in normal-K+ plants, and this effect could explain the greatest susceptibility to the salinity in K+-starved plants under high transpiration conditions, which are typical in dry climates.

  18. Targeted mRNA Oxidation Regulates Sunflower Seed Dormancy Alleviation during Dry After-Ripening[C][W

    Science.gov (United States)

    Bazin, Jérémie; Langlade, Nicolas; Vincourt, Patrick; Arribat, Sandrine; Balzergue, Sandrine; El-Maarouf-Bouteau, Hayat; Bailly, Christophe

    2011-01-01

    After-ripening is the mechanism by which dormant seeds become nondormant during their dry storage after harvest. The absence of free water in mature seeds does not allow detectable metabolism; thus, the processes associated with dormancy release under these conditions are largely unknown. We show here that sunflower (Helianthus annuus) seed alleviation of dormancy during after-ripening is associated with mRNA oxidation and that this oxidation is prevented when seeds are maintained dormant. In vitro approaches demonstrate that mRNA oxidation results in artifacts in cDNA–amplified fragment length polymorphim analysis and alters protein translation. The oxidation of transcripts is not random but selective, and, using microarrays, we identified 24 stored mRNAs that became highly oxidized during after-ripening. Oxidized transcripts mainly correspond to genes involved in responses to stress and in cell signaling. Among them, protein phosphatase 2C PPH1, mitogen-activated protein kinase phosphatase 1, and phenyl ammonia lyase 1 were identified. We propose that targeted mRNA oxidation during dry after-ripening of dormant seeds could be a process that governs cell signaling toward germination in the early steps of seed imbibition. PMID:21642546

  19. The Mechanisms Involved in Seed Dormancy Alleviation by Hydrogen Cyanide Unravel the Role of Reactive Oxygen Species as Key Factors of Cellular Signaling during Germination[C][W

    Science.gov (United States)

    Oracz, Krystyna; El-Maarouf-Bouteau, Hayat; Kranner, Ilse; Bogatek, Renata; Corbineau, Françoise; Bailly, Christophe

    2009-01-01

    The physiological dormancy of sunflower (Helianthus annuus) embryos can be overcome during dry storage (after-ripening) or by applying exogenous ethylene or hydrogen cyanide (HCN) during imbibition. The aim of this work was to provide a comprehensive model, based on oxidative signaling by reactive oxygen species (ROS), for explaining the cellular mode of action of HCN in dormancy alleviation. Beneficial HCN effect on germination of dormant embryos is associated with a marked increase in hydrogen peroxide and superoxide anion generation in the embryonic axes. It is mimicked by the ROS-generating compounds methylviologen and menadione but suppressed by ROS scavengers. This increase results from an inhibition of catalase and superoxide dismutase activities and also involves activation of NADPH oxidase. However, it is not related to lipid reserve degradation or gluconeogenesis and not associated with marked changes in the cellular redox status controlled by the glutathione/glutathione disulfide couple. The expression of genes related to ROS production (NADPHox, POX, AO1, and AO2) and signaling (MAPK6, Ser/ThrPK, CaM, and PTP) is differentially affected by dormancy alleviation either during after-ripening or by HCN treatment, and the effect of cyanide on gene expression is likely to be mediated by ROS. It is also demonstrated that HCN and ROS both activate similarly ERF1, a component of the ethylene signaling pathway. We propose that ROS play a key role in the control of sunflower seed germination and are second messengers of cyanide in seed dormancy release. PMID:19329562

  20. DNA alteration and programmed cell death during ageing of sunflower seed

    Science.gov (United States)

    El-Maarouf-Bouteau, Hayat; Mazuy, Claire; Corbineau, Françoise; Bailly, Christophe

    2011-01-01

    Sunflower (Helianthus annuus L.) seed viability is affected by moisture content (MC) during ageing and is related to accumulation of hydrogen peroxide and changes in energy metabolism. The aim of the present work was to investigate the effect of ageing on DNA alteration events by RAPD (random amplification of polymorphic DNA) analysis and to determine whether loss of seed viability might correspond to a controlled programmed cell death (PCD). Ageing of sunflower seeds was carried out at 35 °C for 7 d at different MCs. The higher the MC, the lower was the seed viability. RAPD analysis showed that DNA alterations occurred during ageing especially in seeds containing a high MC. In addition, PCD, as revealed by DNA fragmentation and TUNEL (terminal deoxynucleotide transferase-mediated dUTP nick-end labelling) assay, was detected in aged seeds at MCs which resulted in ∼50% seed viability. At the cellular level, TUNEL assay and propidium iodide staining showed that cell death concerns all the cells of the embryonic axis. The quantification of the adenylate pool highlights mitochondrial dysfunction in aged seeds containing a high MC. The involvement of oxidative burst, mitochondria dysfunction, and PCD in seed loss of viability is proposed. PMID:21765164

  1. Catalase degradation in sunflower cotyledons during peroxisome transition from glyoxysomal to leaf peroxisomal function

    International Nuclear Information System (INIS)

    Eising, R.; Gerhardt, B.

    1987-01-01

    First order rate constant for the degradation (degradation constants) of catalase in the cotyledons of sunflower (Helianthus annuus L.) were determined by measuring the loss of catalase containing 14 C-labeled heme. During greening of the cotyledons, a period when peroxisomes change from glyoxysomal to leaf peroxisomal function, the degradation of glyoxysomal catalase is significantly slower than during all other stages of cotyledon development in light or darkness. The degradation constant during the transition stage of peroxisome function amounts to 0.205 day -1 in contrast to the constants ranging from 0.304 day -1 to 0.515 day -1 during the other developmental stages. Density labeling experiments comprising labeling of catalase with 2 H 2 O and its isopycnic centrifugation on CsCl gradients demonstrated that the determinations of the degradation constants were not substantially affected by reutilization of 14 C-labeled compounds for catalase synthesis. The degradation constants for both glyoxysomal catalase and catalase synthesized during the transition of peroxisome function do not differ. This was shown by labeling the catalases with different isotopes and measuring the isotope ratio during the development of the cotyledons. The results are inconsistent with the concept that an accelerated and selective degradation of glyoxysomes underlies the change in peroxisome function. The data suggest that catalase degradation is at least partially due to an individual turnover of catalase and does not only result from a turnover of the whole peroxisomes

  2. Dermocosmetics for dry skin: a new role for botanical extracts.

    Science.gov (United States)

    Casetti, F; Wölfle, U; Gehring, W; Schempp, C M

    2011-01-01

    Dry skin is associated with a disturbed skin barrier and reduced formation of epidermal proteins and lipids. During recent years, skin-barrier-reinforcing properties of some botanical compounds have been described. Searching the PubMed database revealed 9 botanical extracts that specifically improve skin barrier and/or promote keratinocyte differentiation in vivo after topical application. The topical application of Aloe vera (leaf gel), Betula alba (birch bark extract), Helianthus annuus (sunflower oleodistillate), Hypericum perforatum (St. John's wort extract), Lithospermum erythrorhizon (root extract), Piptadenia colubrina (angico-branco extract) and Simarouba amara (bitter wood extract) increased skin hydration, reduced the transepidermal water loss, or promoted keratinocyte differentiation in humans in vivo. The topical application of Rubia cordifolia root extract and rose oil obtained from Rosa spp. flowers stimulated keratinocyte differentiation in mouse models. The underlying mechanisms of these effects are discussed. It is concluded that some botanical compounds display skin-barrier-reinforcing properties that may be used in dermocosmetics for dry skin. However, more investigations on the mode of action and more vehicle-controlled studies are required. Copyright © 2011 S. Karger AG, Basel.

  3. Molecular Cloning and Expression Analysis of Cu/Zn SOD Gene from Gynura bicolor DC.

    Directory of Open Access Journals (Sweden)

    Xin Xu

    2017-01-01

    Full Text Available Superoxide dismutase is an important antioxidant enzyme extensively existing in eukaryote, which scavenges reactive oxygen species (ROS and plays an essential role in stress tolerance of higher plants. A full-length cDNA encoding Cu/Zn SOD was cloned from leaves of Gynura bicolor DC. by rapid amplification of cDNA ends (RACE. The full-length cDNA of Cu/Zn SOD is 924 bp and has a 681 bp open reading frame encoding 227 amino acids. Bioinformatics analysis revealed that belonged to the plant SOD super family. Cu/Zn SODs of the Helianthus annuus, Mikania micrantha, and Solidago canadensis var. scabra all have 86% similarity to the G. bicolor Cu/Zn SOD. Analysis of the expression of Cu/Zn SOD under different treatments revealed that Cu/Zn SOD was a stress-responsive gene, especially to 1-MCP. It indicates that the Cu/Zn SOD gene would be an important gene in the resistance to stresses and will be helpful in providing evidence for future research on underlying molecular mechanism and choosing proper postharvest treatments for G. bicolor.

  4. Ion distribution and gas exchange of hydroponically grown sunflower plants as affected by salinity

    Directory of Open Access Journals (Sweden)

    Anna Rita Rivelli

    Full Text Available This paper reports the results of a trial carried out on sunflower plants (Helianthus annuus L., Romsun HS90 grown in the greenhouse using inert substrate and two automatic and closed hydroponic systems: one of them hosting the control (C with plants grown under optimal conditions on Hoagland nutrient solution, the other one, the salt treatment (S, with plants exposed to constant salt stress through adding 150 mM of NaCl to the nutrient solution. Salt supply caused a sharp reduction in leaf area development and dry matter production, especially in the first 4 weeks when leaves showed to be more sensitive than stem and roots. Such a reduction is attributable to the drop in net CO2 assimilation rate, transpiration and stomatal conductance and it was, on average, equal to 30, 26 and 40%, respectively, with respect to the control. The investigated genotype was not able to exclude Cl- and Na+ and considerable amounts accumulated in leaves, stem and roots. Concentration increased in leaves in the basipetal direction. Though sunflower has an efficient endogenous adaptation system by which it redistributes ions in the whole plant, with greater accumulation in older leaves, growth inhibition could be attributed to specific ion toxicity effects, and of chlorine in particular, on metabolic processes and thus on photosynthesis.

  5. Behavior of two phenyl urea herbicides in clayey soils and effect of alternating dry-wet conditions on their availability.

    Science.gov (United States)

    Haouari, Jamila; Dahchour, Abdelmalek; Peña-Heras, Arancha; Louchard, Xzavier; Lennartz, Berndt; Alaoui, Mohamed Elbelghiti; Satrallah, Ahmad

    2006-01-01

    Adsorption and mobility of linuron (3-(3,4-dichlorophenyl)-1-methoxy-1-methylurea) and diuron (3-(3,4-dichlorophenyl)-1, 1-dimethylurea) were studied in clayey soils from the Gharb area (Morocco). Soils A and B were planted with sun flower (Helianthus annuus) while soil C was planted with sugar cane (Saccharum offcinarum). Adsorption was studied for linuron in soils A and B, while mobility was studied only in soil B. Adsorption data were found to fit the Freundlich equation with correlation coefficients r2 > 0.9. Freundlich coefficients (Kf, nf) were in agreement with L and S isotherm types for soils A and B, respectively. Values of Koc (195 and 102) indicate moderate adsorption. Desorption isotherms for linuron showed hysteresis for both soils. The pesticide would be more bound to soil A (H = 8.44) than to soil B (H = 4.01). The effect of alternating wet and dry conditions was tested for soils A and B. Results showed that retention would increase in soil subject to an additional wet and dry cycle. In the case of diuron isotherm was of type L in soil C. Desorption was noticeable at high concentrations and tended to decrease when concentrations diminished. Mobility of linuron was tested in polyvinyle chloride (PVC) columns, which received different treatments before their percolation. The pesticide was more mobile in a previously saturated column. In columns subject to a drying step after saturation with water, linuron mobility was greatly reduced.

  6. Use of oleaginous plants in phytotreatment of grey water and yellow water from source separation of sewage.

    Science.gov (United States)

    Lavagnolo, Maria Cristina; Malagoli, Mario; Alibardi, Luca; Garbo, Francesco; Pivato, Alberto; Cossu, Raffaello

    2017-05-01

    Efficient and economic reuse of waste is one of the pillars of modern environmental engineering. In the field of domestic sewage management, source separation of yellow (urine), brown (faecal matter) and grey waters aims to recover the organic substances concentrated in brown water, the nutrients (nitrogen and phosphorous) in the urine and to ensure an easier treatment and recycling of grey waters. With the objective of emphasizing the potential of recovery of resources from sewage management, a lab-scale research study was carried out at the University of Padova in order to evaluate the performances of oleaginous plants (suitable for biodiesel production) in the phytotreatment of source separated yellow and grey waters. The plant species used were Brassica napus (rapeseed), Glycine max (soybean) and Helianthus annuus (sunflower). Phytotreatment tests were carried out using 20L pots. Different testing runs were performed at an increasing nitrogen concentration in the feedstock. The results proved that oleaginous species can conveniently be used for the phytotreatment of grey and yellow waters from source separation of domestic sewage, displaying high removal efficiencies of nutrients and organic substances (nitrogen>80%; phosphorous >90%; COD nearly 90%). No inhibition was registered in the growth of plants irrigated with different mixtures of yellow and grey waters, where the characteristics of the two streams were reciprocally and beneficially integrated. Copyright © 2016. Published by Elsevier B.V.

  7. Co-regulation of water and K(+) transport in sunflower plants during water stress recovery.

    Science.gov (United States)

    Benlloch, Manuel; Benlloch-González, María

    2016-06-01

    16-day-old sunflower (Helianthus annuus L.) plants were subjected to deficit irrigation for 12 days. Following this period, plants were rehydrated for 2 days to study plant responses to post-stress recovery. The moderate water stress treatment applied reduced growth in all plant organs and the accumulation of K(+) in the shoot. After the rehydration period, the stem recovered its growth and reached a similar length to the control, an effect which was not observed in either root or leaves. Moreover, plant rehydration after water stress favored the accumulation of K(+) in the apical zone of the stem and expanding leaves. In the roots of plants under water stress, watering to field capacity, once the plants were de- topped, rapidly favored K(+) and water transport in the excised roots. This quick and short-lived response was not observed in roots of plants recovered from water stress for 2 days. These results suggest that the recovery of plant growth after water stress is related to coordinated water and K(+) transport from the root to the apical zone of the ​​stem and expanding leaves. This stimulation of K(+) transport in the root and its accumulation in the cells of the growing zones of the ​​stem must be one of the first responses induced in the plant during water stress recovery. Copyright © 2016 Elsevier GmbH. All rights reserved.

  8. Production and morphological components of sunflower on soil fertilized with cassava wastewater

    Directory of Open Access Journals (Sweden)

    Mara Suyane Marques Dantas

    Full Text Available ABSTRACT Agroindustrial residues, such as cassava wastewater, have been used as soil fertilizers, reducing environmental pollution and recovering nutrients. The objective of this work was to evaluate production and morphological components and oil yield of sunflower (Helianthus annuus, hybrid Helio-250, fertilized with cassava wastewater. The experiment was conducted at the Experimental Station of the Instituto Agronomico de Pernambuco, Vitória de Santo Antão, State of Pernambuco, Brazil. A randomized block experimental design was used, with six cassava wastewater rates (0, 8.5, 17.0, 34.0, 68.0 and 136 m3 ha-1 and four replications. The variables evaluated were shoot fresh and dry weight, capitulum fresh and dry weight, capitulum diameter, seed yield, oil yield and seed oil content. The use cassava wastewater as soil fertilizer improved the production and morphological variables evaluated, except the seed oil content, which decreased with application of cassava wastewater rates above 25 m3 ha-1.

  9. NÍVEL DE CONTROLE DE Diloboderus abderus EM AVEIA PRETA, LINHO, MILHO E GIRASSOL

    Directory of Open Access Journals (Sweden)

    Silva Mauro Tadeu Braga da

    2002-01-01

    Full Text Available O estudo aqui relatado foi conduzido nas safras agrícolas de 1991 e 1992, em Cruz Alta, no Rio Grande do Sul. O objetivo foi avaliar o efeito de diferentes níveis de infestação de Diloboderus abderus Sturm, 1826 (Coleoptera: Melolonthidae em aveia preta (Avena strigosa L., em linho (Linum usitatissimum L., em milho (Zea mays L. e em girassol (Helianthus annuus L., no sistema de plantio direto. O aumento do número de larvas/m² propiciou a ocorrência de danos e, em conseqüência, a diminuição da população de plantas, da massa seca da parte aérea e da produtividade. Os níveis de controle obtidos foram variáveis dependendo da cultura. Com base nos danos produzidos pelo inseto, sugerem-se os níveis de controle de 12 larvas/m² em linho, de 10 larvas/m² em aveia preta, de 0,5 larva/m² em milho e de 0,4 larva/m² em girassol, como indicador para tratamento de sementes destas culturas com inseticidas.

  10. Seed priming with extracts of Acacia nilotica (L.) Willd. ex Delile and Sapindus mukorossi (L.) plant parts in the control of root rot fungi and growth of plants

    International Nuclear Information System (INIS)

    Rafi, H.; Dawar, S.; Zaki, M.J.

    2015-01-01

    Seed priming with plant extracts and chemicals has been used as an important growth enhancement tool in crop plants. In this research, an attempt was made to understand the mechanism of various seed priming treatments on greenhouse-grown okra (Abelmoschus esculentus (L.) Moench.), sunflower (Helianthus annuus L.), peanut (Arachis hypogaea L.) and chickpea (Cicer arietinum L.) for the control of root infecting fungi like Rhizoctonia solani (Kn), Fusarium spp. and Macrophomina phaseolina (Tassi) Goid by plant parts extracts (stem, leaves and seeds) of Acacia nilotica (L.) Willd. ex Delile and Sapindus mukorossi (L) at different time intervals (5, 10, 20, 40 minutes). Results showed significant suppression of root rot fungi and significantly enhanced the growth parameters like shoot length, root length, shoot weight and root weight. Seed-priming with A. nilotica and S. mukorossi leaves extract for 10 minutes time interval was found to be effective for the control of root rot fungi and growth of all tested leguminous and non-leguminous plants. (author)

  11. THE INFLUENCE OF THE BOTANIC ORIGIN OF HONEY PLANTS ON THE QUALITY OF HONEY

    Directory of Open Access Journals (Sweden)

    Z. Tucak

    2007-06-01

    Full Text Available Numerous parameters affect the quality of honey from different beehive types (Albert – Žindaršić AŽ, Langstroth – Roott LR i Dadant – Blatt DB, i.e. the material of beehives are made of, the origin of queen bees (natural and selected, etc. Our research focuses on the influence of the botanic origin of honey plants (Tilia sp. L. (lime, Amorpha fructirosa L. (desert false indigo, Helianthus annuus L. (sunflower, Brassica napus subsp. olifera DC. (oil beet and Robina pseudoacacia L. (acacia on the quality of honey. The physical and chemical analyses of honey (N=133 (water %, water insoluble compounds %, acidity level, mmol of acid per kg, electrical conductivity, mS/cm, reducing sugar %, sucrose %, HMF, mg/kg, and diastasic number were conducted by Harmonised methods of the European Honey. The pollen analysis was conducted by Harmonised methods of melissopalynology. The pollen analysis indicates that the botanic origin has had a statistically significant influence (P<0.001 on the quality of all investigated characteristics of honey, except on the share of the non–dissolving substances (P=0.088. The research was conducted in the Vukovar-Srijem County, the Republic of Croatia. All bees used in this research belong to the Carniolan honey bee (Apis mellifera carnica, the European bee species.

  12. Genetic parameters, phenotypic, genotypic and environmental correlations and genetic variability on sunflower in the Brazilian Savannah

    Directory of Open Access Journals (Sweden)

    Ellen Grippi Lira

    Full Text Available ABSTRACT: Sunflower (Helianthus annuus L. is an annual crop that stands out for its production of high quality oil and for an efficient selection, being necessary to estimate the components of genetic and phenotypic variance. This study aimed to estimate genetic parameters, phenotypic, genotypic and environmental correlations and genetic variability on sunflower in the Brazilian Savannah, evaluating the characters grain yield (YIELD, days to start flowering (DFL based on flowering date in R5, chapter length (CL, weight of a thousand achenes (WTA, plant height (H and oil content (OilC of 16 sunflower genotypes. The experiment was conducted at Embrapa Cerrados, Planaltina, DF, situated at 15º 35’ 30”S latitude, 47º 42’ 30”W longitude and 1.007m above sea level, in soil classified as dystroferric Oxisol. The experimental design used was a complete randomized block with four replicates. The nature for the effects of genotypes and blocks was fixed. Except for the character chapter length, genetic variance was the main component of the phenotypic variance among the genotypes, indicating high genetic variability and experimental efficiency with proper environmental control. In absolute terms, the genetic correlations were superior to phenotypic and environmental. The high values reported for heritability and selective accuracy indicated efficiency of phenotypic selection. Results showed high genetic variability among genotypes, which may contribute to the genetic improvement of sunflower.

  13. Simulating sunflower canopy temperatures to infer root-zone soil water potential

    Science.gov (United States)

    Choudhury, B. J.; Idso, S. B.

    1983-01-01

    A soil-plant-atmosphere model for sunflower (Helianthus annuus L.), together with clear sky weather data for several days, is used to study the relationship between canopy temperature and root-zone soil water potential. Considering the empirical dependence of stomatal resistance on insolation, air temperature and leaf water potential, a continuity equation for water flux in the soil-plant-atmosphere system is solved for the leaf water potential. The transpirational flux is calculated using Monteith's combination equation, while the canopy temperature is calculated from the energy balance equation. The simulation shows that, at high soil water potentials, canopy temperature is determined primarily by air and dew point temperatures. These results agree with an empirically derived linear regression equation relating canopy-air temperature differential to air vapor pressure deficit. The model predictions of leaf water potential are also in agreement with observations, indicating that measurements of canopy temperature together with a knowledge of air and dew point temperatures can provide a reliable estimate of the root-zone soil water potential.

  14. Influence of pollen quality on ovarian development in honeybee workers (Apis mellifera scutellata).

    Science.gov (United States)

    Human, H; Nicolson, S W; Strauss, K; Pirk, C W W; Dietemann, V

    2007-07-01

    Protein-rich diets are known to promote ovarian and egg development in workers of the honeybee, Apis mellifera, even in the presence of a queen. Since the main source of protein for honeybees is pollen, its quality and digestibility might be important dietary factors determining reproductive capacity. We have compared the effect of two types of pollen-sunflower, Helianthus annuus, and aloe, Aloe greatheadii var davyana-on ovarian development in A. mellifera scutellata workers. Under queenright conditions in the field, worker bees exhibited greater ovarian development when feeding on aloe pollen than on sunflower pollen. In their midgut, we observed higher extraction efficiency for aloe (80%) than for sunflower (69%) pollen. This may be attributed to the morphology and size of the two kinds of pollen grains and explains, together with the high protein content of aloe pollen (32% dry mass in bee-collected pollen) compared to sunflower pollen (15%), why aloe pollen promoted higher ovarian development. However, in the laboratory workers sustained on aloe pollen had significantly less-developed ovaries and higher mortality than those fed sunflower pollen. These detrimental effects may be due to an unbalanced protein:carbohydrate ratio. We discuss the effects of unbalanced diets on the physiology and ecology of honeybee reproduction.

  15. Role of the polypeptide backbone and post-translational modifications in cross-reactivity of Art v 1, the major mugwort pollen allergen.

    Science.gov (United States)

    Gruber, Petra; Gadermaier, Gabriele; Bauer, Roman; Weiss, Richard; Wagner, Stefan; Leonard, Renaud; Breiteneder, Heimo; Ebner, Christof; Ferreira, Fatima; Egger, Matthias

    2009-01-01

    Artemisia vulgaris (mugwort) is one of the main causes of late summer pollinosis in Europe, with >95% of patients sensitized to the glycoallergen Art v 1. Despite the importance of this allergen, little is known about its cross-reactive behavior. Here we investigated the occurrence of conserved Art v 1 antigenic determinants in sources known to display clinically relevant cross-reactivity with mugwort pollen. For this purpose, monoclonal antibodies specific for a cysteine-stabilized epitope of the Art v 1 defensin domain and for carbohydrates attached to the proline domain were produced by hybridoma and phage display technologies. Using polyclonal Art v 1-specific rabbit sera and antibodies against both the Art v 1 carbohydrate and polypeptide moieties, we could identify cross-reactive structures in pollen from botanically related Asteraceae weeds (Artemisia absinthium, Helianthus annuus and Ambrosia sp.). Homologous allergens were also recognized by IgE from mugwort-sensitized patients and the reactivity could be decreased by serum pre-incubation with natural and recombinant Art v 1. As no cross-reactive structures could be found in foods associated with mugwort pollinosis, we conclude that Art v 1 is poorly involved in mugwort cross-reactivity to food allergens.

  16. Contribution of botanical origin and sugar composition of honeys on the crystallization phenomenon.

    Science.gov (United States)

    Escuredo, Olga; Dobre, Irina; Fernández-González, María; Seijo, M Carmen

    2014-04-15

    The present work provides information regarding the statistical relationships among the palynological characteristics, sugars (fructose, glucose, sucrose, melezitose and maltose), moisture content and sugar ratios (F+G, F/G and G/W) of 136 different honey types (including bramble, chestnut, eucalyptus, heather, acacia, lime, rape, sunflower and honeydew). Results of the statistical analyses (multiple comparison Bonferroni test, Spearman rank correlations and principal components) revealed the valuable significance of the botanical origin on the sugar ratios (F+G, F/G and G/W). Brassica napus and Helianthus annuus pollen were the variables situated near F+G and G/W ratio, while Castanea sativa, Rubus and Eucalyptus pollen were located further away, as shown in the principal component analysis. The F/G ratio of sunflower, rape and lime honeys were lower than those found for the chestnut, eucalyptus, heather, acacia and honeydew honeys (>1.4). A lower value F/G ratio and lower water content were related with a faster crystallization in the honey. Copyright © 2013 Elsevier Ltd. All rights reserved.

  17. The possibility of using 5-aminolevulinic acid in lead phytoextraction process

    Directory of Open Access Journals (Sweden)

    Zbigniew Jarosz

    2013-04-01

    Full Text Available Studies conducted in the greenhouse involving a sunflower (Helianthus annuus L. grown in medium containing 200 mg Pb ∙ dm -3 which were designed to evaluate the impact of foliar nutrition with 5-aminolevulinic acid (5-ALA on the chemical composition of sunflower in reference to possible use of this plant in the process of induced phytoextraction. The study revealed from 4.8% to 34.1% increase in aboveground matter of sunflower which was sprayed by 5-ALA solution at concentrations of 0.01-0.1 ppm in comparison with plants grown in a medium containing 200 mg Pb ∙ dm -3 with no 5-ALA spraying. The sunflower leaves sprayed by 5-ALA solution contained from 3.78% to 27.1% more lead in comparison to plants not sprayed by this agent. As well as remarkable decrease in lead content from 17.4 to 33.4% was recorded in the roots of sunflower sprayed by 5-ALA solution. The lead content in plant shoots was independent from foliar application of 5-aminolevulinic acid

  18. Nitrogen effects on growth and development of sunflower hybrids under agro-climatic conditions of malonate

    International Nuclear Information System (INIS)

    Nasim, W.; Ahmad, A.; Wajid, A.; Muhammad, D.

    2011-01-01

    The effect of nitrogen (N) on growth, development, yield and yield components of different sunflower (Helianthus annuus L.) hybrids was evaluated under agro-climatic conditions of Multan during spring 2008 and 2009. The experiment was laid out in a randomized complete block design with split plot arrangement having three replications, keeping cultivars in the main plots and N levels in the subplots. The net plot size was 4.2 m x 5 m. The results showed that, with increasing N rates, there was increment in the biomass, yield and yield components while the oil contents were adversely affected. However, there was high seed yield in 2008 as compared to 2009. Among sunflower hybrids, Hysun-38 gave more yield as compared to other sunflower hybrids (Hysun-33, Pioneer 64A93), while in case of N levels, 180 kg ha/sup -1/ provided higher yield than other N rates (0, 60, 120, 240 kg ha/sup -1/) in both years of study especially during 2008. (author)

  19. RXLR and CRN Effectors from the Sunflower Downy Mildew Pathogen Plasmopara halstedii Induce Hypersensitive-Like Responses in Resistant Sunflower Lines

    Science.gov (United States)

    Gascuel, Quentin; Buendia, Luis; Pecrix, Yann; Blanchet, Nicolas; Muños, Stéphane; Vear, Felicity; Godiard, Laurence

    2016-01-01

    Plasmopara halstedii is an obligate biotrophic oomycete causing downy mildew disease on sunflower, Helianthus annuus, an economically important oil crop. Severe symptoms of the disease (e.g., plant dwarfism, leaf bleaching, sporulation and production of infertile flower) strongly impair seed yield. Pl resistance genes conferring resistance to specific P. halstedii pathotypes were located on sunflower genetic map but yet not cloned. They are present in cultivated lines to protect them against downy mildew disease. Among the 16 different P. halstedii pathotypes recorded in France, pathotype 710 is frequently found, and therefore continuously controlled in sunflower by different Pl genes. High-throughput sequencing of cDNA from P. halstedii led us to identify potential effectors with the characteristic RXLR or CRN motifs described in other oomycetes. Expression of six P. halstedii putative effectors, five RXLR and one CRN, was analyzed by qRT-PCR in pathogen spores and in the pathogen infecting sunflower leaves and selected for functional analyses. We developed a new method for transient expression in sunflower plant leaves and showed for the first time subcellular localization of P. halstedii effectors fused to a fluorescent protein in sunflower leaf cells. Overexpression of the CRN and of 3 RXLR effectors induced hypersensitive-like cell death reactions in some sunflower near-isogenic lines resistant to pathotype 710 and not in susceptible corresponding lines, suggesting they could be involved in Pl loci-mediated resistances. PMID:28066456

  20. Genetic progress in sunflower crop in Rio Grande do Sul State, Brazil.

    Science.gov (United States)

    Follmann, D N; Cargnelutti Filho, A; Lorentz, L H; Boligon, A A; Caraffa, M; Wartha, C A

    2017-04-13

    The sunflower has adaptability to growing regions with different climatic and soil characteristics, showing drought tolerance and high-quality oil production. The State of Rio Grande do Sul is the third largest sunflower producer in Brazil, with research related to the sunflower breeding initiated after the decade of 1950. The aim of this study was to evaluate the genetic progress for grain yield, oil content, and oil yield of sunflower (Helianthus annuus L.) in the State of Rio Grande do Sul. Data of grain yield, oil content, and oil yield obtained from 58 sunflower cultivar yield trials in 19 municipalities in Rio Grande do Sul during the period from 2005 to 2014 were used. Genetic progress was studied according to the methodology proposed by Vencovsky and data from sunflower cultivar yield trials were used. Annual genetic progress of sunflower during the period of 10 years (2005-2014) was 132.46 kg⋅ha -1 ⋅year -1 for grain yield, -0.17%/year for oil content, and 48.11 kg⋅ha -1 ⋅year -1 for oil yield. The sunflower-breeding programs in the State of Rio Grande do Sul were efficient for the traits grain yield and oil yield and presented no efficiency for oil content.

  1. Foliar nitrogen and potassium applications improve photosynthetic activities and water relations in sunflower under moisture deficit condition

    International Nuclear Information System (INIS)

    Hussain, R.A.; Ahmad, R.

    2016-01-01

    This study investigated the influence of foliar supplementation of nitrogen (N) potassium (K) and their combination on photosynthetic activities, physiological indices and water relations of two sunflower (Helianthus annuus L.) hybrids Hysen-33 and LG-5551 under water deficit condition. Studies were conducted in a wire-house at Nuclear Institute for Agriculture and Biology, Faisalabad, Pakistan. Treatments were two water stress levels [100 (control) and 60% field capacity (water deficit)], six levels of foliar spray (no spray, water spray, 1% N, 1% K, 0.5% N + 0.5% K and 1% N + 1% K) and each treatment was replicated three times. Results showed that water stress reduced the photosynthetic activities: Pn (photosynthetic rate), E (rate of tanspiration) and gs (stomatal conductance) and water relations i.e., pie w (water potential), pie s (osmotic potential) and pie p (turgor potential) . Soil moisture deficit also significantly reduced the plant height, root length, fresh and dry matter which consequently affected the plant height stress tolerance index (PHSI), root length stress tolerance index (RLSI) and dry matter stress tolerance index (DMSI) in both sunflower hybrids. However, foliar supplementation with N and K or N+K improved the photosynthetic activities, water relations and physiological indices of both the sunflower hybrids. The findings of present study suggest that application of N+K is necessary to have high plant productivity. (author)

  2. Association Mapping and the Genomic Consequences of Selection in Sunflower

    Science.gov (United States)

    Mandel, Jennifer R.; Nambeesan, Savithri; Bowers, John E.; Marek, Laura F.; Ebert, Daniel; Rieseberg, Loren H.; Knapp, Steven J.; Burke, John M.

    2013-01-01

    The combination of large-scale population genomic analyses and trait-based mapping approaches has the potential to provide novel insights into the evolutionary history and genome organization of crop plants. Here, we describe the detailed genotypic and phenotypic analysis of a sunflower (Helianthus annuus L.) association mapping population that captures nearly 90% of the allelic diversity present within the cultivated sunflower germplasm collection. We used these data to characterize overall patterns of genomic diversity and to perform association analyses on plant architecture (i.e., branching) and flowering time, successfully identifying numerous associations underlying these agronomically and evolutionarily important traits. Overall, we found variable levels of linkage disequilibrium (LD) across the genome. In general, islands of elevated LD correspond to genomic regions underlying traits that are known to have been targeted by selection during the evolution of cultivated sunflower. In many cases, these regions also showed significantly elevated levels of differentiation between the two major sunflower breeding groups, consistent with the occurrence of divergence due to strong selection. One of these regions, which harbors a major branching locus, spans a surprisingly long genetic interval (ca. 25 cM), indicating the occurrence of an extended selective sweep in an otherwise recombinogenic interval. PMID:23555290

  3. Phyto remediation of Depleted Uranium from Contaminated Soil and Sediments

    International Nuclear Information System (INIS)

    Al-Saad, K.A.; Amr, M.A.

    2012-01-01

    Seedlings of sunflower (Helianthus annuus L.) was used to test the effect of ph, citric acid, phosphoric acid, and ethylene-diamine-tetraacetic acid (EDTA) on the uptake and the translocation of depleted uranium (DU). The experiments was performed in hydroponic cultures and environmental soil samples collected from Qatar. The results of hydroponic experiment indicated that DU accumulated more in the roots than leaves, in the plants that was grown in contaminated water. The presence of phosphoric acid, citric acid, or EDTA showed different patterns of DU uptake. Higher transfer factor was observed when phosphoric acid was added. When EDTA was added, higher DU uptake was observed. The data suggested the DU was mostly retained to the root when EDTA was added. Also, the experiments were applied on environmental soil samples collected from Qatar. The presence of phosphoric acid, citric acid, or EDTA showed different patterns of DU uptake for the three different soil samples. The addition of EDTA increased the DU uptake in the sunflowers planted in the three types of soils. The results indicated that, generally, DU accumulated more in the roots compared to leaves and stems, except when soil was spiked with phosphoric acid. The translocation ratio was limited but highest ( 1.4) in the sunflower planted in soil S2705 when spiked with phosphoric acid. In the three soils tested, the result suggested higher DU translocation of sunflower with the presence of phosphoric acid.

  4. Whole plant senescence of sunflower following seedhead removal

    International Nuclear Information System (INIS)

    Ho, InSun; Below, F.E.

    1989-01-01

    This study was undertaken to further clarify the relationship between seed development and monocarpic senescence of sunflower (Helianthus annuus L.). Field-grown plants with and without seedheads were evaluated for rate and duration of accumulation of dry weight, reduced N, and P by whole shoots, and for partitioning of these constituents within the individual plant parts. Concurrent with seedhead removal, [ 15 N]nitrate was applied to the plants in a selected are of the experimental plot. Whole plants (above ground portions) were harvested seven times during the seed-filling period and analyzed from dry weight, reduced N, and P. Although seedhead removal depressed the rates of dry weight, reduced N, and P accumulation by whole shoots, it extended the duration of accumulation of these constituents, relative to headed control plants. As a result, the final whole shoot dry weight and N and P contents at seed maturity were similar for deheaded and headed plants. Seedhead removal also affected the partitioning of dry matter, reduced N, and P but the relative proportions varied as a function of constituent and growth stage. Analysis of 15 N present in whole shoots at physiological maturity showed that similar amounts of nitrate were absorbed during the postflowering period by headed and deheaded plants. These data indicate that the absence of seeds does not affect the total accumulation of dry matter, reduced N, or P, by sunflower plants, but does alter the rates of accumulation and partitioning of these constituents

  5. Effect of radiation environment on radiation use efficiency and growth of sunflower

    International Nuclear Information System (INIS)

    Bange, M.P.; Hammer, G.L.; Rickert, K.G.

    1997-01-01

    The level of incident radiation and the proportion of radiation that is diffuse affects radiation use efficiency (RUE) in crops. However, the degree of this effect, and its importance to growth and yield of sunflower (Helianthus annuus L.) have not been established. A field experiment was conducted to investigate the effects of radiation environment on RUE, growth, and yield of sunflower. A fully irrigated crop was sown on an alluvial-prairie soil (Fluventic Haplustoll) and was exposed to three distinct radiation environments. In two treatments, the level of incident radiation was reduced by 14 and 20% by suspending two different types of polyethylene plastic films well above the crop. In addition to the reductions in incident radiation, the proportion of radiation that was diffuse was increased by about 14% in these treatments. Lower incident radiation and increased proportion of diffuse radiation had no effect on total biomass, phenology, leaf area, and the canopy light extinction coefficient (k = 0.89). However, yield was reduced in shaded treatments due to smaller grain size and lower harvest index. Although crop RUE measured over the entire crop cycle (1.25 g/MJ) did not differ significantly among treatments, there was a trend where RUE compensated for less intercepted incident radiation. Theoretical derivations of the response of RUE to different levels of incident radiation supported this finding. Shaded sunflower crops have the ability to produce biomass similar to unshaded crops by increasing RUE, but have lower harvest indices

  6. Genotypic variation in transpiration efficiency, carbon-isotope discrimination and carbon allocation during early growth in sunflower

    International Nuclear Information System (INIS)

    Virgona, J.M.; Farquhar, G.D.; Hubick, K.T.; Rawson, H.M.; Downes, R.W.

    1990-01-01

    Transpiration efficiency of dry matter production (W), carbon-isotope discrimination (Δ) and dry matter partitioning were measured on six sunflower (Helianthus annuus L.) genotypes grown for 32 days in a glasshouse. Two watering regimes, one well watered (HW) and the other delivering half the water used by the HW plants (LW), were imposed. Four major results emerged from this study: Three was significant genotypic variation in W in sunflower and this was closely reflected in Δ for both watering treatments; the low watering regime caused a decrease in Δ but no change in W; nonetheless the genotypic ranking for either Δ or W was not significantly altered by water stress; a positive correlation between W and biomass accumulation occurred among genotypes of HW plants; ρ, the ratio of total plant carbon content to leaf area, was positively correlated with W and negatively correlated with Δ. These results are discussed with reference to the connection between transpiration efficiency and plant growth, indicating that Δ can be used to select for W among young sunflower plants. However, selection for W may be accompanied by changes in other important plant growth characteristics such as ρ. 19 refs., 4 figs

  7. Productivity analysis of sunflower production in Turkey

    International Nuclear Information System (INIS)

    Semerci, A.

    2012-01-01

    In Turkey, which ranks the tenth country worldwide in the sunflower (Helianthus annuus L.) production, 55% of the production is carried out in Thrace Region. Therefore, agricultural enterprises in Thrace Region, situated in the European part of Turkey have specialized in producing sunflower, and have become the centre of vegetable oil industry in the region in terms of produced raw material. This research was conducted in 182 agricultural enterprises in 3 provinces of Thrace Region in Turkey and its objective was to determine input/output relations in sunflower production. The study indicates that the determination coefficient (r/sup 2/) derived from Cobb-Douglas production function was significant at 0.01 level and the elasticity coefficients of the variables (except chemical fertilizer) were found beta i positive in derived equation. It was determined that the variable of herbicide cost had the highest value of the marginal effectiveness coefficients and none of the variables was used at economically optimal level in the study area. When the Marginal Technical Substitution and the Price Rates were taken into consideration, it was noted that only the seed cost/hoeing cost was closest to economically optimum level (1.10). According to stepwise analysis the Land Renting Value was determined as the most important variable in sunflower production. (author)

  8. SNP Discovery and Development of a High-Density Genotyping Array for Sunflower

    Science.gov (United States)

    Bachlava, Eleni; Taylor, Christopher A.; Tang, Shunxue; Bowers, John E.; Mandel, Jennifer R.; Burke, John M.; Knapp, Steven J.

    2012-01-01

    Recent advances in next-generation DNA sequencing technologies have made possible the development of high-throughput SNP genotyping platforms that allow for the simultaneous interrogation of thousands of single-nucleotide polymorphisms (SNPs). Such resources have the potential to facilitate the rapid development of high-density genetic maps, and to enable genome-wide association studies as well as molecular breeding approaches in a variety of taxa. Herein, we describe the development of a SNP genotyping resource for use in sunflower (Helianthus annuus L.). This work involved the development of a reference transcriptome assembly for sunflower, the discovery of thousands of high quality SNPs based on the generation and analysis of ca. 6 Gb of transcriptome re-sequencing data derived from multiple genotypes, the selection of 10,640 SNPs for inclusion in the genotyping array, and the use of the resulting array to screen a diverse panel of sunflower accessions as well as related wild species. The results of this work revealed a high frequency of polymorphic SNPs and relatively high level of cross-species transferability. Indeed, greater than 95% of successful SNP assays revealed polymorphism, and more than 90% of these assays could be successfully transferred to related wild species. Analysis of the polymorphism data revealed patterns of genetic differentiation that were largely congruent with the evolutionary history of sunflower, though the large number of markers allowed for finer resolution than has previously been possible. PMID:22238659

  9. The sunflower genome provides insights into oil metabolism, flowering and Asterid evolution.

    Science.gov (United States)

    Badouin, Hélène; Gouzy, Jérôme; Grassa, Christopher J; Murat, Florent; Staton, S Evan; Cottret, Ludovic; Lelandais-Brière, Christine; Owens, Gregory L; Carrère, Sébastien; Mayjonade, Baptiste; Legrand, Ludovic; Gill, Navdeep; Kane, Nolan C; Bowers, John E; Hubner, Sariel; Bellec, Arnaud; Bérard, Aurélie; Bergès, Hélène; Blanchet, Nicolas; Boniface, Marie-Claude; Brunel, Dominique; Catrice, Olivier; Chaidir, Nadia; Claudel, Clotilde; Donnadieu, Cécile; Faraut, Thomas; Fievet, Ghislain; Helmstetter, Nicolas; King, Matthew; Knapp, Steven J; Lai, Zhao; Le Paslier, Marie-Christine; Lippi, Yannick; Lorenzon, Lolita; Mandel, Jennifer R; Marage, Gwenola; Marchand, Gwenaëlle; Marquand, Elodie; Bret-Mestries, Emmanuelle; Morien, Evan; Nambeesan, Savithri; Nguyen, Thuy; Pegot-Espagnet, Prune; Pouilly, Nicolas; Raftis, Frances; Sallet, Erika; Schiex, Thomas; Thomas, Justine; Vandecasteele, Céline; Varès, Didier; Vear, Felicity; Vautrin, Sonia; Crespi, Martin; Mangin, Brigitte; Burke, John M; Salse, Jérôme; Muños, Stéphane; Vincourt, Patrick; Rieseberg, Loren H; Langlade, Nicolas B

    2017-06-01

    The domesticated sunflower, Helianthus annuus L., is a global oil crop that has promise for climate change adaptation, because it can maintain stable yields across a wide variety of environmental conditions, including drought. Even greater resilience is achievable through the mining of resistance alleles from compatible wild sunflower relatives, including numerous extremophile species. Here we report a high-quality reference for the sunflower genome (3.6 gigabases), together with extensive transcriptomic data from vegetative and floral organs. The genome mostly consists of highly similar, related sequences and required single-molecule real-time sequencing technologies for successful assembly. Genome analyses enabled the reconstruction of the evolutionary history of the Asterids, further establishing the existence of a whole-genome triplication at the base of the Asterids II clade and a sunflower-specific whole-genome duplication around 29 million years ago. An integrative approach combining quantitative genetics, expression and diversity data permitted development of comprehensive gene networks for two major breeding traits, flowering time and oil metabolism, and revealed new candidate genes in these networks. We found that the genomic architecture of flowering time has been shaped by the most recent whole-genome duplication, which suggests that ancient paralogues can remain in the same regulatory networks for dozens of millions of years. This genome represents a cornerstone for future research programs aiming to exploit genetic diversity to improve biotic and abiotic stress resistance and oil production, while also considering agricultural constraints and human nutritional needs.

  10. Proteomic analysis of oil body membrane proteins accompanying the onset of desiccation phase during sunflower seed development

    Science.gov (United States)

    Thakur, Anita; Bhatla, Satish C

    2015-01-01

    A noteworthy metabolic signature accompanying oil body (OB) biogenesis during oilseed development is associated with the modulation of the oil body membranes proteins. Present work focuses on 2-dimensional polyacrylamide gel electrophoresis (2-D PAGE)-based analysis of the temporal changes in the OB membrane proteins analyzed by LC-MS/MS accompanying the onset of desiccation (20–30 d after anthesis; DAA) in the developing seeds of sunflower (Helianthus annuus L.). Protein spots unique to 20–30 DAA stages were picked up from 2-D gels for identification and the identified proteins were categorized into 7 functional classes. These include proteins involved in energy metabolism, reactive oxygen scavenging, proteolysis and protein turnover, signaling, oleosin and oil body biogenesis-associated proteins, desiccation and cytoskeleton. At 30 DAA stage, exclusive expressions of enzymes belonging to energy metabolism, desiccation and cytoskeleton were evident which indicated an increase in the metabolic and enzymatic activity in the cells at this stage of seed development (seed filling). Increased expression of cruciferina-like protein and dehydrin at 30 DAA stage marks the onset of desiccation. The data has been analyzed and discussed to highlight desiccation stage-associated metabolic events during oilseed development. PMID:26786011

  11. Tracking the spring migration of a bar-headed goose (Anser indicus) across the Himalaya with satellite telemetry

    Science.gov (United States)

    Javed, Sàlim; Takekawa, John Y.; Douglas, David C.; Rahmani, Asad R.; Kanai, Yutaka; Nagendran, Meenakshi; Choudhury, Binod C.; Sharma, Shruti

    2000-01-01

    Soil-food-chain-pesticide wildlife relationships were investigated to learn the concentration of pesticide residues present in soils, macro-invertebrates, vertebrates, and seeds as a result of annual applications of aldrin at recommended rates for pest control. Two central Missouri cornfields treated witb aldrin at 1 lb/acre, for 16 and 15 of the past 17 years, were selected for study during 1965-67. Primary samples collected for residue analyses included soils, earthworms (Lumbricidae), crickets (GryIlidae), and two kinds of ground beetles (Carabidae) obtained during early April, June, August, and October. Vertebrates and plant seeds collected during 1967 included white-footed mice (Peromyscus maniculatus), toads (Bufo americanus), snakes (Thamnophis sirtalis and Pituophis sayi), corn (Zea Mays), foxtail (Setaria Faberii), and annual sunflower (Helianthus annuus). Pesticide residues consisted primarily of dieldrin, the degradation product of aldrin. Combined aldrin and dieldrin residues, as two field all-season averages, wet weight basis, were: soils, 0.31 ppm; earthworms, 1.49 ppm; crickets, 0.23 ppm; Harpalus ground beetles, 1.10 ppm; Poecilus ground beetles, 9.67 ppm; white-footed mice, 0.98 ppm; toads, 3.53 ppm; garter snakes, 12.35 ppm; and corn, foxtail, and sunflower seeds less than 0.02 ppm each. Unusually high average residues (37.48 ppm) in Poecilus beetles during June, 1967, were attributed to abnormally high soil moisture and predacious feeding habits of these insects.

  12. Soil-food chain-pesticide wildlife relationships in aldrin-treated fields

    Science.gov (United States)

    Korschgen, L.J.

    1970-01-01

    Soil-food-chain-pesticide wildlife relationships were investigated to learn the concentration of pesticide residues present in soils, macro-invertebrates, vertebrates, and seeds as a result of annual applications of aldrin at recommended rates for pest control. Two central Missouri cornfields treated witb aldrin at 1 lb/acre, for 16 and 15 of the past 17 years, were selected for study during 1965-67. Primary samples collected for residue analyses included soils, earthworms (Lumbricidae), crickets (GryIlidae), and two kinds of ground beetles (Carabidae) obtained during early April, June, August, and October. Vertebrates and plant seeds collected during 1967 included white-footed mice (Peromyscus maniculatus), toads (Bufo americanus), snakes (Thamnophis sirtalis and Pituophis sayi), corn (Zea Mays), foxtail (Setaria Faberii), and annual sunflower (Helianthus annuus). Pesticide residues consisted primarily of dieldrin, the degradation product of aldrin. Combined aldrin and dieldrin residues, as two field all-season averages, wet weight basis, were: soils, 0.31 ppm; earthworms, 1.49 ppm; crickets, 0.23 ppm; Harpalus ground beetles, 1.10 ppm; Poecilus ground beetles, 9.67 ppm; white-footed mice, 0.98 ppm; toads, 3.53 ppm; garter snakes, 12.35 ppm; and corn, foxtail, and sunflower seeds less than 0.02 ppm each. Unusually high average residues (37.48 ppm) in Poecilus beetles during June, 1967, were attributed to abnormally high soil moisture and predacious feeding habits of these insects.

  13. Hydrolysis and speciation of Al bound to pectin and plant cell wall material and its reaction with the dye chrome azurol S.

    Science.gov (United States)

    Wehr, J Bernhard; Blamey, F P C; Hanna, J V; Kopittke, P M; Kerven, G L; Menzies, N W

    2010-05-12

    Hydrolysis of aluminum (Al) in solution increases at pH >or= 4 and with an Al concentration. Pectin, an important anionic polysaccharide of plant cell walls, adsorbs Al, but this phenomenon is poorly understood. This study showed that Al(3+) hydrolysis results in binding of Al to pectin in excess of the stoichiometric equivalent, leading to oversaturation of the pectin with Al. However, the degree of pectin methyl-esterification did not affect the extent of Al hydrolysis. Binding of Al to purified cell wall material also resulted in Al hydrolysis in a pH- and soluble Al concentration-dependent manner, but the source of cell wall material had no effect at fixed pH. Staining of Al-treated pectin and cell wall material from wheat ( Triticum aestivum L.) and sunflower ( Helianthus annuus L.) with the Al-specific dye, chrome azurol S (CAS), resulted in the formation of a purple color, with the intensity related to the extent of Al hydrolysis.

  14. Weed Control in Corn (Zea mays L. as Influenced by Preemergence Herbicides

    Directory of Open Access Journals (Sweden)

    Travis W. Janak

    2016-01-01

    Full Text Available Field studies were conducted in central and south-central Texas from 2013 through 2015 to evaluate crop tolerance and efficacy of various preemergence herbicides alone and in combination for weed control in field corn. Acetochlor and pendimethalin alone, S-metolachlor plus mesotrione, and the three-way combination of S-metolachlor plus atrazine plus mesotrione provided the most consistent control of annual grasses including browntop panicum (Panicum fasciculatum L., Texas millet (Urochloa texana L., barnyardgrass (Echinochloa crus-galli L., and sprawling signalgrass (Brachiaria reptans L.. Palmer amaranth [Amaranthus palmeri (S. Wats.] control was at least 90% with fluthiacet-methyl plus pyroxasulfone, atrazine plus either acetochlor, alachlor, dimethenamid-P, S-metolachlor, or S-metolachlor plus mesotrione, saflufenacil plus dimethenamid-P, and S-metolachlor plus mesotrione. Hophornbeam copperleaf (Acalypha ostryifolia L. was difficult to control; however, acetochlor, saflufenacil or pyroxasulfone alone, saflufenacil plus dimethenamid-P, and S-metolachlor plus mesotrione provided at least 90% control. Acetochlor or saflufenacil alone, thiencarbazone-methyl plus isoxaflutole, dimethenamid-P plus atrazine, rimsulfuron plus mesotrione, and saflufenacil plus dimethenamid-P controlled common sunflower (Helianthus annuus L. at least 90%. Corn injury was minimal (≤3% with all herbicides. In general, corn grain yield was greatest with herbicide treatments containing more than one active ingredient compared with a single active ingredient.

  15. Seed fates in crop–wild hybrid sunflower: crop allele and maternal effects

    Science.gov (United States)

    Pace, Brian A; Alexander, Helen M; Emry, Jason D; Mercer, Kristin L

    2015-01-01

    Domestication has resulted in selection upon seed traits found in wild populations, yet crop-wild hybrids retain some aspects of both parental phenotypes. Seed fates of germination, dormancy, and mortality can influence the success of crop allele introgression in crop-wild hybrid zones, especially if crop alleles or crop-imparted seed coverings result in out-of-season germination. We performed a seed burial experiment using crop, wild, and diverse hybrid sunflower (Helianthus annuus) cross types to test how a cross type's maternal parent and nuclear genetic composition might affect its fate under field conditions. We observed higher maladaptive fall germination in the crop- and F1- produced seeds than wild-produced seeds and, due to an interaction with percent crop alleles, fall germination was higher for cross types with more crop-like nuclear genetics. By spring, crop-produced cross types had the highest overwintering mortality, primarily due to higher fall germination. Early spring germination was identical across maternal types, but germination continued for F1-produced seeds. In conclusion, the more wild-like the maternal parent or the less proportion of the cross type's genome contributed by the crop, the greater likelihood a seed will remain ungerminated than die. Wild-like dormancy may facilitate introgression through future recruitment from the soil seed bank. PMID:25685189

  16. Melatonin and nitric oxide regulate sunflower seedling growth under salt stress accompanying differential expression of Cu/Zn SOD and Mn SOD.

    Science.gov (United States)

    Arora, Dhara; Bhatla, Satish C

    2017-05-01

    Salinity results in significant reduction in sunflower (Helianthus annuus L.) seedling growth and excessive generation of reactive oxygen species (ROS). Present work highlights the possible role of melatonin as an antioxidant through its interaction with nitric oxide (NO), and as an early and long distance NaCl-stress sensing signaling molecule in seedling cotyledons. Exogenous melatonin (15µM)±NaCl (120mM) inhibit seedling growth, which is also correlated with NO availability, accumulation of potential superoxide anion (O 2 •- ) and peroxynitrite anion (ONOO - ), extent of tyrosine-nitration of proteins, spatial localization and activity of superoxide dismutase (SOD) isoforms. NO acts as a positive modulator of melatonin accumulation in seedling cotyledons as a long-distance signaling response. Modulation of superoxide anion and peroxynitrite anion content by melatonin highlights its crucial role in combating deleterious effects of ROS and reactive nitrogen species (RNS). Present findings provide evidence for an interaction between melatonin and NO in their effect on seedling growth under salt stress accompanying differential modulation of two SOD isoforms, i.e. Cu/Zn SOD and Mn SOD. Copyright © 2017 Elsevier Inc. All rights reserved.

  17. Temperature and sowing date affect the linear increase of sunflower harvest index

    International Nuclear Information System (INIS)

    Bange, M.P.; Hammer, G.L.; Rickert, K.G.

    1998-01-01

    The linearity of daily linear harvest index (HI) increase can provide a simple means to predict grain growth and yield in field crops. However, the stability of the rate of increase across genotypes and environments is uncertain. Data from three field experiments were collated to investigate the phase of linear HI increase of sunflower (Helianthus annuus L.) across environments by changing genotypes, sowing time, N level, and solar irradiation level. Linear increase in HI was similar among different genotypes, N levels, and radiation treatments (mean 0.0125 d-1), but significant differences occurred between sowings. The linear increase in HI was not stable at very low temperatures (down to 9 degrees C) during grain filling, due to possible limitations to biomass accumulation and translocation (mean 0.0091 d-1). Using the linear increase in HI to predict grain yield requires predictions of the duration from an thesis to the onset of linear HI increase (lag phase) and the cessation of linear HI increase. These studies showed that the lag phase differed, and the linear HI increase ceased when 91% of the anthesis to physiological maturity period had been completed

  18. Contribution of non-target-site resistance in imidazolinone-resistant Imisun sunflower

    Directory of Open Access Journals (Sweden)

    Gabriela Breccia

    2017-08-01

    Full Text Available ABSTRACT The first commercial herbicide-resistant trait in sunflower (Helianthus annuus L. is known as ‘Imisun’. Imidazolinone resistance in Imisun cultivars has been reported to be genetically controlled by a major gene (known as Imr1 or Ahasl1-1 and modifier genes. Imr1 is an allelic variant of the Ahasl1 locus that codes for the acetohydroxyacid synthase, which is the target site of these herbicides. The mechanism of resistance endowed by modifier genes has not been characterized and it could be related to non-target-site resistance. The objective of this study was to evaluate the role of cytochrome P450 monooxygenases (P450s in Imisun resistance. The response to imazapyr herbicide in combination with P450s inhibitor malathion was evaluated in 2 Imisun lines, IMI-1 and RHA426. Malathion reduced herbicide efficacy in both lines, but IMI-1 was affected in a greater extent. A significant reduction in plant growth in response to P450s inhibitors 1-aminobenzotriazole and piperonyl butoxide treatment was detected in the Imisun line HA425. The increased susceptibility to imazapyr after P450s-inhibitor treatment indicates that herbicide metabolism by P450s is a mechanism involved in Imisun resistance. These results also suggest the involvement of different P450s isozymes in endowing resistance to imazapyr in Imisun cultivars.

  19. Molecular mapping of a sunflower rust resistance gene from HAR6.

    Science.gov (United States)

    Bulos, Mariano; Ramos, María L; Altieri, Emiliano; Sala, Carlos A

    2013-03-01

    Sunflower rust, caused by Puccinia helianthi Schw., can result in significant yield losses in cultivated sunflower (Helianthus annuus L. var. macrocarpus Ckll.). HAR6 is a germplasm population resistant to most predominant rust races. The objectives of this study were to map the resistance factor present in HAR6 (R HAR6 ), and to provide and validate molecular tools for the identification of this gene for marker assisted selection purposes. Virulence reaction of seedlings for the F2 population and F2:3 families suggested that a single dominant gene confers rust resistance in HAR6-1, a selected rust resistance line from the original population. Genetic mapping with eight markers covered 97.4 cM of genetic distance on linkage group 13 of the sunflower consensus map. A co-dominant marker ZVG61 is the closest marker distal to R HAR6 at a genetic distance of 0.7 cM, while ORS581, a dominant marker linked in the coupling phase, is proximal to R HAR6 at a genetic distance of 1.5 cM. Validation of these markers was assessed by converting a susceptible line into a rust resistant isoline by means of marker assisted backcrossing. The application of these results to assist the breeding process and to design new strategies for rust control in sunflower is discussed.

  20. Phenotypic characterization, genetic mapping and candidate gene analysis of a source conferring reduced plant height in sunflower.

    Science.gov (United States)

    Ramos, María Laura; Altieri, Emiliano; Bulos, Mariano; Sala, Carlos A

    2013-01-01

    Reduced height germplasm has the potential to increase stem strength, standability, and also yields potential of the sunflower crop (Helianthus annuus L. var. macrocarpus Ckll.). In this study, we report on the inheritance, mapping, phenotypic and molecular characterization of a reduced plant height trait in inbred lines derived from the source DDR. This trait is controlled by a semidominant allele, Rht1, which maps on linkage group 12 of the sunflower public consensus map. Phenotypic effects of this allele include shorter height and internode length, insensibility to exogenous gibberellin application, normal skotomorphogenetic response, and reduced seed set under self-pollination conditions. This later effect presumably is related to the reduced pollen viability observed in all DDR-derived lines studied. Rht1 completely cosegregated with a haplotype of the HaDella1 gene sequence. This haplotype consists of a point mutation converting a leucine residue in a proline within the conserved DELLA domain. Taken together, the phenotypic, genetic, and molecular results reported here indicate that Rht1 in sunflower likely encodes an altered DELLA protein. If the DELPA motif of the HaDELLA1 sequence in the Rht1-encoded protein determines by itself the observed reduction in height is a matter that remains to be investigated.