WorldWideScience

Sample records for germline lamin b3

  1. Laminates

    Lepedat, Karin; Wagner, Robert; Lang, Jürgen

    The use of phenolic resin for the impregnation of a carrier material such as paper or fabric based on either organic or inorganic fibers was and still is one of the most important application areas for liquid phenolic resins. Substrates like paper, cotton, or glass fabric impregnated with phenolic resins are used as core layers for decorative and technical laminates and for many other different industrial applications. Nowadays, phenolic resins for decorative laminates used for furniture, flooring, or in the construction and transportation industry have gained significant market share. The Laminates chapter mainly describes the manufacture of decorative laminates especially the impregnation and pressing process with special emphasis to new technological developments and recent trends. Moreover, the different types of laminates are introduced, combined with some brief comments as they relate to the market for decorative surfaces.

  2. LAMINATES

    Gökay Nemli

    2004-04-01

    Full Text Available Wood based panel producers afford to present their products either in sized semi-finished form or as covered in general by the in additional investments realized. The fact that the laminated material has a certain market share as well as the increase in demand for furniture types finished in various profiles have put the laminated sheets which provide very comprehensive design facilities at the top place and caused such boards to spread over the market rather more quickly. In line with this development, great developments have also been recorded during recent years in laminate utilization in furniture factoring sector and fast steps taken towards a more rational working environment. In this study, laminates types and manufacturing technologies were investigated.

  3. Invertebrate lamins

    Melcer, Shai; Gruenbaum, Yosef; Krohne, Georg

    2007-01-01

    Lamins are the main component of the nuclear lamina and considered to be the ancestors of all intermediate filament proteins. They are localized mainly at the nuclear periphery where they form protein complexes with integral proteins of the nuclear inner membrane, transcriptional regulators, histones and chromatin modifiers. Studying lamins in invertebrate species has unique advantages including the smaller number of lamin genes in the invertebrate genomes and powerful genetic analyses in Caenorhabditis elegans and Drosophila melanogaster. These simpler nuclear lamina systems allow direct analyses of their structure and functions. Here we give an overview of recent advances in the field of invertebrate nuclear lamins with special emphasis on their evolution, assembly and functions

  4. Laminated articles

    Ridgway, P.C.; Case, D.F.

    1979-01-01

    In a method of bonding laminations of a magnetic core, photo-resist material consisting of a co-polymer is applied as a film to a sheet of magnetic material to define lamination shapes to enable the laminations to be formed by etching. The film of photo-resist material on the laminations is then utilised to bond the laminations together in a stack. In order to permit the core to operate at temperatures higher than the softening temperature of the photo-resist material, the bonded stack is irradiated with 1 - 2 Mer gamma radiation to a dose of 1 - 5 Mrads in 2 - 10 hrs to cause changes to the bonding material such that the material does not soften at the operating temperature of the core. (U.K.)

  5. Human Germline Genome Editing.

    Ormond, Kelly E; Mortlock, Douglas P; Scholes, Derek T; Bombard, Yvonne; Brody, Lawrence C; Faucett, W Andrew; Garrison, Nanibaa' A; Hercher, Laura; Isasi, Rosario; Middleton, Anna; Musunuru, Kiran; Shriner, Daniel; Virani, Alice; Young, Caroline E

    2017-08-03

    With CRISPR/Cas9 and other genome-editing technologies, successful somatic and germline genome editing are becoming feasible. To respond, an American Society of Human Genetics (ASHG) workgroup developed this position statement, which was approved by the ASHG Board in March 2017. The workgroup included representatives from the UK Association of Genetic Nurses and Counsellors, Canadian Association of Genetic Counsellors, International Genetic Epidemiology Society, and US National Society of Genetic Counselors. These groups, as well as the American Society for Reproductive Medicine, Asia Pacific Society of Human Genetics, British Society for Genetic Medicine, Human Genetics Society of Australasia, Professional Society of Genetic Counselors in Asia, and Southern African Society for Human Genetics, endorsed the final statement. The statement includes the following positions. (1) At this time, given the nature and number of unanswered scientific, ethical, and policy questions, it is inappropriate to perform germline gene editing that culminates in human pregnancy. (2) Currently, there is no reason to prohibit in vitro germline genome editing on human embryos and gametes, with appropriate oversight and consent from donors, to facilitate research on the possible future clinical applications of gene editing. There should be no prohibition on making public funds available to support this research. (3) Future clinical application of human germline genome editing should not proceed unless, at a minimum, there is (a) a compelling medical rationale, (b) an evidence base that supports its clinical use, (c) an ethical justification, and (d) a transparent public process to solicit and incorporate stakeholder input. Copyright © 2017 American Society of Human Genetics. All rights reserved.

  6. Human Germline Genome Editing

    Ormond, Kelly E.; Mortlock, Douglas P.; Scholes, Derek T.; Bombard, Yvonne; Brody, Lawrence C.; Faucett, W. Andrew; Garrison, Nanibaa’ A.; Hercher, Laura; Isasi, Rosario; Middleton, Anna; Musunuru, Kiran; Shriner, Daniel; Virani, Alice; Young, Caroline E.

    2017-01-01

    With CRISPR/Cas9 and other genome-editing technologies, successful somatic and germline genome editing are becoming feasible. To respond, an American Society of Human Genetics (ASHG) workgroup developed this position statement, which was approved by the ASHG Board in March 2017. The workgroup included representatives from the UK Association of Genetic Nurses and Counsellors, Canadian Association of Genetic Counsellors, International Genetic Epidemiology Society, and US National Society of Gen...

  7. Lamination cooling system

    Rippel, Wally E.; Kobayashi, Daryl M.

    2005-10-11

    An electric motor, transformer or inductor having a lamination cooling system including a stack of laminations, each defining a plurality of apertures at least partially coincident with apertures of adjacent laminations. The apertures define a plurality of cooling-fluid passageways through the lamination stack, and gaps between the adjacent laminations are sealed to prevent a liquid cooling fluid in the passageways from escaping between the laminations. The gaps are sealed by injecting a heat-cured sealant into the passageways, expelling excess sealant, and heat-curing the lamination stack. The apertures of each lamination can be coincident with the same-sized apertures of adjacent laminations to form straight passageways, or they can vary in size, shape and/or position to form non-axial passageways, angled passageways, bidirectional passageways, and manifold sections of passageways that connect a plurality of different passageway sections. Manifold members adjoin opposite ends of the lamination stack, and each is configured with one or more cavities to act as a manifold to adjacent passageway ends. Complex manifold arrangements can create bidirectional flow in a variety of patterns.

  8. Genetic loss of SH2B3 in acute lymphoblastic leukemia.

    Perez-Garcia, Arianne; Ambesi-Impiombato, Alberto; Hadler, Michael; Rigo, Isaura; LeDuc, Charles A; Kelly, Kara; Jalas, Chaim; Paietta, Elisabeth; Racevskis, Janis; Rowe, Jacob M; Tallman, Martin S; Paganin, Maddalena; Basso, Giuseppe; Tong, Wei; Chung, Wendy K; Ferrando, Adolfo A

    2013-10-03

    The SH2B adaptor protein 3 (SH2B3) gene encodes a negative regulator of cytokine signaling with a critical role in the homeostasis of hematopoietic stem cells and lymphoid progenitors. Here, we report the identification of germline homozygous SH2B3 mutations in 2 siblings affected with developmental delay and autoimmunity, one in whom B-precursor acute lymphoblastic leukemia (ALL) developed. Mechanistically, loss of SH2B3 increases Janus kinase-signal transducer and activator of transcription signaling, promotes lymphoid cell proliferation, and accelerates leukemia development in a mouse model of NOTCH1-induced ALL. Moreover, extended mutation analysis showed homozygous somatic mutations in SH2B3 in 2 of 167 ALLs analyzed. Overall, these results demonstrate a Knudson tumor suppressor role for SH2B3 in the pathogenesis of ALL and highlight a possible link between genetic predisposition factors in the pathogenesis of autoimmunity and leukemogenesis.

  9. Lessons for Inductive Germline Determination

    Seervai, Riyad N.H.; Wessel, Gary M.

    2015-01-01

    SUMMARY Formation of the germline in an embryo marks a fresh round of reproductive potential, yet the developmental stage and location within the embryo where the primordial germ cells (PGCs) form differs wildly among species. In most animals, the germline is formed either by an inherited mechanism, in which maternal provisions within the oocyte drive localized germ-cell fate once acquired in the embryo, or an inductive mechanism that involves signaling between cells that directs germ-cell fate. The inherited mechanism has been widely studied in model organisms such as Drosophila melanogaster, Caenorhabditis elegans, Xenopus laevis, and Danio rerio. Given the rapid generation time and the effective adaptation for laboratory research of these organisms, it is not coincidental that research on these organisms has led the field in elucidating mechanisms for germline specification. The inductive mechanism, however, is less well understood and is studied primarily in the mouse (Mus musculus). In this review, we compare and contrast these two fundamental mechanisms for germline determination, beginning with the key molecular determinants that play a role in the formation of germ cells across all animal taxa. We next explore the current understanding of the inductive mechanism of germ-cell determination in mice, and evaluate the hypotheses for selective pressures on these contrasting mechanisms. We then discuss the hypothesis that the transition between these determination mechanisms, which has happened many times in phylogeny, is more of a continuum than a binary change. Finally, we propose an analogy between germline determination and sex determination in vertebrates—two of the milestones of reproduction and development—in which animals use contrasting strategies to activate similar pathways. PMID:23450642

  10. Photovoltaic-Panel Laminator

    Keenan, R.

    1985-01-01

    Two-piece unit heats and presses protective layers to form laminate. Rubber diaphragm between upper and lower vacuum chambers alternates between neutral position and one that presses against solar-cell array, supplying distributed force necessary to press layers of laminate together. Encapsulation helps to protect cells from environment and to ensure long panel life while allowing efficient generation of electricity from Sunlight.

  11. Composite lamination method

    Dickerson, G. E. (Inventor)

    1977-01-01

    A process was developed for preparing relatively thick composite laminate structure wherein thin layers of prepreg tapes are assembled, these thin layers are cut into strips that are partially cured, and stacked into the desired thickness with uncured prepreg disposed between each layer of strips. The formed laminate is finally cured and thereafter machined to the desired final dimensions.

  12. 8 CFR 343b.3 - Interrogation.

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Interrogation. 343b.3 Section 343b.3 Aliens... NATURALIZATION FOR RECOGNITION BY A FOREIGN STATE § 343b.3 Interrogation. When Form N-565 presents a prima facie... issuance of the certificate. Interrogation of the applicant shall be conducted before the application is...

  13. Lamination cooling system formation method

    Rippel, Wally E [Altadena, CA; Kobayashi, Daryl M [Monrovia, CA

    2009-05-12

    An electric motor, transformer or inductor having a cooling system. A stack of laminations have apertures at least partially coincident with apertures of adjacent laminations. The apertures define straight or angled cooling-fluid passageways through the lamination stack. Gaps between the adjacent laminations are sealed by injecting a heat-cured sealant into the passageways, expelling excess sealant, and heat-curing the lamination stack. Manifold members adjoin opposite ends of the lamination stack, and each is configured with one or more cavities to act as a manifold to adjacent passageway ends. Complex manifold arrangements can create bidirectional flow in a variety of patterns.

  14. Germline V repertoires: Origin, maintenance, diversification.

    Steele, E J; Lindley, R A

    2018-06-01

    In our view, Melvin Cohn (Scand J Immunol. 2018;87:e12640) has set out the logical guidelines towards a resolution of the very real enigma of the selectability of vertebrate germline Ig V repertoires under the current evolutionary paradigm…" A somatically derived repertoire scrambles this (germline VL + VH) substrate so that its specificities are lost, making it un-selectable in the germline. Consequently, evolution faced an incompatibility." It is argued here in Reply that a reverse transcriptase-based soma-to-germline process (S->G) targeting germline V segment arrays goes some considerable way to resolving fundamental contradictions on the origin, maintenance and then real-time adaptive diversification of these limited sets of V segments encoded within various V repertoire arrays. © 2018 The Foundation for the Scandinavian Journal of Immunology.

  15. Germline APC mutations in hepatoblastoma.

    Yang, Adeline; Sisson, Rebecca; Gupta, Anita; Tiao, Greg; Geller, James I

    2018-04-01

    Conflicting reports on the frequency of germline adenomatous polyposis coli (APC) gene mutations in patients with hepatoblastoma (HB) have called into question the clinical value of APC mutation testing on apparently sporadic HB. An Institutional Review Board approved retrospective review of clinical data collected from patients with HB who received APC testing at our institution was conducted. All HB patients seen at Cincinnati Children's Hospital Medical Center were eligible for testing. Potential genotype/phenotype correlations were assessed. As of July 2015, 29 patients with HB had received constitutional APC testing. Four (14%) were found to have APC pathogenic truncations of the APC protein and in addition two (7%) had APC missense variants of unknown clinical significance. Two patients (7%) had family histories indicative of familial adenomatous polyposis (FAP). Response to chemotherapy tracked differently in APC pathogenic cases, with a slower imaging response despite an equivalent or slightly faster α-fetoprotein (AFP) response. The prevalence of pathogenic APC variants in apparently sporadic HB may be higher than previously detected. Differences in time to imaging response, despite similar AFP response, may impact surgical planning. All patients with HB warrant germline APC mutation testing for underlying FAP. © 2017 Wiley Periodicals, Inc.

  16. Lamins, laminopathies and disease mechanisms

    2011-07-08

    Jul 8, 2011 ... Lamins, laminopathies and disease mechanisms: Possible role for proteasomal degradation of ... Mutations in the human lamin genes lead to highly degenerative genetic diseases that affect a number of different ... June 2018.

  17. EB curable laminating adhesives

    Matsuyama, Asao; Kobayashi, Masahide; Gotoh, Sakiko

    1992-01-01

    New developed solvent free EB curable laminating adhesives have two liquid components, A with hydroxy and acryloyl group, B with isocyanate and acryloyl group in a molecule. These EB laminating adhesives do not need any aging process, which is a big advantage, and are very suitable for environment, safety, and health because of no heating process and solvent free formulas. And we have made basic research about the relation of peel strength or heat seal strength versus Tg of cured film, elongation at break, elastic modulus, and so on. Basic specifications of the new developed adhesives are shown. (author)

  18. A historical perspective of laminitis.

    Heymering, Henry W

    2010-04-01

    The causes of laminitis are many-often interrelated, sometimes direct opposites. The history of laminitis has been a search for the cause or causes of laminitis and for effective treatment. Going in and out of fashion, many treatments have lasted for centuries, some for millennia, but very few have been proven. Copyright 2010 Elsevier Inc. All rights reserved.

  19. DESIGN ALTERNATIVES ON THE LAMINATES

    Gökay Nemli

    2004-04-01

    Full Text Available Wood based panel manufacturers use increasing volumes of laminates. Laminates are resistant to the water, humidity, scratch, abrasion, burning and chemicals. These products consist of printed decor papers that have been saturated with thermosetting resin. In this study, laminate types, composition form and design alternatives were investigated.

  20. Photovoltaic module and laminate

    Bunea, Gabriela E.; Kim, Sung Dug; Kavulak, David F.J.

    2018-04-10

    A photovoltaic module is disclosed. The photovoltaic module has a first side directed toward the sun during normal operation and a second, lower side. The photovoltaic module comprises a perimeter frame and a photovoltaic laminate at least partially enclosed by and supported by the perimeter frame. The photovoltaic laminate comprises a transparent cover layer positioned toward the first side of the photovoltaic module, an upper encapsulant layer beneath and adhering to the cover layer, a plurality of photovoltaic solar cells beneath the upper encapsulant layer, the photovoltaic solar cells electrically interconnected, a lower encapsulant layer beneath the plurality of photovoltaic solar cells, the upper and lower encapsulant layers enclosing the plurality of photovoltaic solar cells, and a homogenous rear environmental protection layer, the rear environmental protection layer adhering to the lower encapsulant layer, the rear environmental protection layer exposed to the ambient environment on the second side of the photovoltaic module.

  1. Laminated piezoelectric transformer

    Vazquez Carazo, Alfredo (Inventor)

    2006-01-01

    A laminated piezoelectric transformer is provided using the longitudinal vibration modes for step-up voltage conversion applications. The input portions are polarized to deform in a longitudinal plane and are bonded to an output portion. The deformation of the input portions is mechanically coupled to the output portion, which deforms in the same longitudinal direction relative to the input portion. The output portion is polarized in the thickness direction relative its electrodes, and piezoelectrically generates a stepped-up output voltage.

  2. A theory of piezoelectric laminates

    Giangreco, E.

    1997-01-01

    A theory of piezoelectric laminates is rationally derived from the three-dimensional Voigt theory of piezoelectricity. The present theory is a generalization to piezoelectric laminates of the Reissner-Mindlin-type layer-wise theory of elastic laminates. Both a differential formulation and a variational formulation of the piezoelectric laminate problem are presented. The proposed theory is adopted in the analysis of simple problems, in order to verify its effectiveness. The results it provides turn out to be in good agreement with the results supplied by the Voigt theory of piezoelectricity

  3. Self-Healing Laminate System

    Beiermann, Brett A. (Inventor); Keller, Michael W. (Inventor); White, Scott R. (Inventor); Sottos, Nancy R. (Inventor)

    2016-01-01

    A laminate material may include a first flexible layer, and a self-healing composite layer in contact with the first flexible layer. The composite layer includes an elastomer matrix, a plurality of first capsules including a polymerizer, and a corresponding activator for the polymerizer. The laminate material may self-heal when subjected to a puncture or a tear.

  4. Laminated dosimetric card

    Cox, F.M.; Chamberlain, J.D.; Shrader, E.F.; Shoffner, B.M.; Szalanczy, A.

    1975-01-01

    A laminated card with one or more apertures, each adapted to peripherally seal an encapsulated dosimeter, is formed by bonding a foraminous, code-adaptable, rigid sheet of low-Z material with a codedly transparent sheet of low-Z material in light-transmitting registry with particular code-holes of the rigid sheet. The laminated card may be coded to identify the person carrying it, and/or the location or circumstances related to its exposure to radiation. This card is particularly adapted for use in an instrument capable of evaluating a multiplicity of cards, substantially continuously. The coded identification from the card may be displayed by an appropriate machine, and if desired an evaluation may be recorded because of a ''parity checking'' system incorporated in each card, which permits ''auto-correction.'' Alternatively, where means for effecting the correction automatically are available, the operation of the machine may be interrupted to permit visual examination of a rejected card. The card of this invention is also coded for identifying the type of card with respect to its specific function, and whether or not a card is correctly positioned at any predetermined location during its sequential progress through the instrument in which it is evaluated. Dosimeters are evaluated and the card identified in one pass through the instrument. (auth)

  5. 216-B-3 expansion ponds closure plan

    1994-10-01

    This document describes the activities for clean closure under the Resource Conservation and Recovery Act of 1976 (RCRA) of the 216-B-3 Expansion Ponds. The 216-B-3 Expansion Ponds are operated by the US Department of Energy, Richland Operations Office (DOE-RL) and co-operated by Westinghouse Hanford Company (Westinghouse Hanford). The 216-B-3 Expansion Ponds consists of a series of three earthen, unlined, interconnected ponds that receive waste water from various 200 East Area operating facilities. The 3A, 3B, and 3C ponds are referred to as Expansion Ponds because they expanded the capability of the B Pond System. Waste water (primarily cooling water, steam condensate, and sanitary water) from various 200 East Area facilities is discharged to the Bypass pipe (Project X-009). Water discharged to the Bypass pipe flows directly into the 216-B-3C Pond. The ponds were operated in a cascade mode, where the Main Pond overflowed into the 3A Pond and the 3A Pond overflowed into the 3C Pond. The 3B Pond has not received waste water since May 1985; however, when in operation, the 3B Pond received overflow from the 3A Pond. In the past, waste water discharges to the Expansion Ponds had the potential to have contained mixed waste (radioactive waste and dangerous waste). The radioactive portion of mixed waste has been interpreted by the US Department of Energy (DOE) to be regulated under the Atomic Energy Act of 1954; the dangerous waste portion of mixed waste is regulated under RCRA.

  6. 216-B-3 expansion ponds closure plan

    1994-10-01

    This document describes the activities for clean closure under the Resource Conservation and Recovery Act of 1976 (RCRA) of the 216-B-3 Expansion Ponds. The 216-B-3 Expansion Ponds are operated by the US Department of Energy, Richland Operations Office (DOE-RL) and co-operated by Westinghouse Hanford Company (Westinghouse Hanford). The 216-B-3 Expansion Ponds consists of a series of three earthen, unlined, interconnected ponds that receive waste water from various 200 East Area operating facilities. The 3A, 3B, and 3C ponds are referred to as Expansion Ponds because they expanded the capability of the B Pond System. Waste water (primarily cooling water, steam condensate, and sanitary water) from various 200 East Area facilities is discharged to the Bypass pipe (Project X-009). Water discharged to the Bypass pipe flows directly into the 216-B-3C Pond. The ponds were operated in a cascade mode, where the Main Pond overflowed into the 3A Pond and the 3A Pond overflowed into the 3C Pond. The 3B Pond has not received waste water since May 1985; however, when in operation, the 3B Pond received overflow from the 3A Pond. In the past, waste water discharges to the Expansion Ponds had the potential to have contained mixed waste (radioactive waste and dangerous waste). The radioactive portion of mixed waste has been interpreted by the US Department of Energy (DOE) to be regulated under the Atomic Energy Act of 1954; the dangerous waste portion of mixed waste is regulated under RCRA

  7. "Subclinical" laminitis in dairy cattle.

    Vermunt, J J

    1992-12-01

    In dairying countries worldwide, the economic importance of lameness in cattle is now recognised. Laminitis is regarded as a major predisposing factor in lameness caused by claw disorders such as white zone lesions, sole ulcer, and heel horn erosion. The existence of subclinical laminitis was first suggested in the late 1970s by Dutch workers describing the symptoms of sole haemorrhages and yellowish-coloured, soft sole horn. In an attempt to clarify some of the confusing and often conflicting terminology, the literature on laminitis is reviewed. Disturbed haemodynamics, in particular repeated or prolonged dilation of arteriovenous anastomoses, have been implicated in the pathogenesis of both equine and bovine laminitis. Some characteristics of the vascular system of the bovine claw which may be of importance in the pathophysiology of the subclinical laminitis syndrome are therefore discussed. Clinical observations suggest that subclinical laminitis is a multifactorial disease. The different factors that are or may be involved in its aetiology vary in complexity and severity according to the management protocol of the animals. The possible involvement of subclinical laminitis in claw lesions is assessed.

  8. Continuous jute fibre reinforced laminated paper composite

    Jute fibre; laminated paper composite; plastic bag pollution. Abstract. Plastic bags create a serious environmental problem. The proposed jute fibre reinforced laminated paper composite and reinforcement-fibre free paper laminate may help to combat the war against this pollutant to certain extent. The paper laminate ...

  9. Subclinical laminitis in dairy heifers.

    Bradley, H K; Shannon, D; Neilson, D R

    1989-08-19

    By causing poorer horn quality, subclinical laminitis is considered to be a major predisposing cause of other hoof problems, particularly sole ulcers in newly calved heifers. In this study the hind hooves of 136 female Friesian/Holstein cattle aged between four months and two years were examined to discover at what age the signs of subclinical laminitis appeared. Sole haemorrhages were found in the hoof horn of calves as young as five months. The consistent finding of these lesions in heifers of all ages indicated that subclinical laminitis of varying degree was a common condition during the early growing period of young dairy heifers.

  10. An update on equine laminitis

    Laskoski, Luciane Maria; Valadão, Carlos Augusto Araújo; Dittrich, Rosangela Locatelli; Deconto, Ivan; Faleiros, Rafael Resende

    2016-01-01

    ABSTRACT: Laminitis is a severe podal affection, which pathophysiology remains partially renowned. Ischemic, enzymatic, metabolic and inflammatory mechanisms are connected to the development of laminar lesions. However, few therapeutic measures are effective to prevent or control the severity of acute laminitis and its prodromal stage, which often determines serious complications such as rotation and/or sinking of the distal phalanx and even the loss of hoof. The purpose of this study is to c...

  11. The oogenic germline starvation response in C. elegans.

    Hannah S Seidel

    Full Text Available Many animals alter their reproductive strategies in response to environmental stress. Here we have investigated how L4 hermaphrodites of Caenorhabditis elegans respond to starvation. To induce starvation, we removed food at 2 h intervals from very early- to very late-stage L4 animals. The starved L4s molted into adulthood, initiated oogenesis, and began producing embryos; however, all three processes were severely delayed, and embryo viability was reduced. Most animals died via 'bagging,' because egg-laying was inhibited, and embryos hatched in utero, consuming their parent hermaphrodites from within. Some animals, however, avoided bagging and survived long term. Long-term survival did not rely on embryonic arrest but instead upon the failure of some animals to produce viable progeny during starvation. Regardless of the bagging fate, starved animals showed two major changes in germline morphology: All oogenic germlines were dramatically reduced in size, and these germlines formed only a single oocyte at a time, separated from the remainder of the germline by a tight constriction. Both changes in germline morphology were reversible: Upon re-feeding, the shrunken germlines regenerated, and multiple oocytes formed concurrently. The capacity for germline regeneration upon re-feeding was not limited to the small subset of animals that normally survive starvation: When bagging was prevented ectopically by par-2 RNAi, virtually all germlines still regenerated. In addition, germline shrinkage strongly correlated with oogenesis, suggesting that during starvation, germline shrinkage may provide material for oocyte production. Finally, germline shrinkage and regeneration did not depend upon crowding. Our study confirms previous findings that starvation uncouples germ cell proliferation from germline stem cell maintenance. Our study also suggests that when nutrients are limited, hermaphrodites scavenge material from their germlines to reproduce. We discuss

  12. Pediatric MDS: GATA screen the germline.

    Stieglitz, Elliot; Loh, Mignon L

    2016-03-17

    In this issue of Blood, Wlodarski and colleagues demonstrate that as many as 72% of adolescents diagnosed with myelodysplastic syndrome (MDS) and monosomy 7 harbor germline mutations in GATA2. Although pediatric MDS is a very rare diagnosis, occurring in 0.8 to 4 cases per million, Wlodarski et al screened >600 cases of primary or secondary MDS in children and adolescents who were enrolled in the European Working Group on MDS consortium over a period of 15 years. The overall frequency of germline GATA2 mutations in children with primary MDS was 7%, and 15% in those presenting with advanced disease. Notably, mutations in GATA2 were absent in patients with therapy-related MDS or acquired aplastic anemia.

  13. Laser cutting of Kevlar laminates

    VanCleave, R.A.

    1977-09-01

    An investigation has been conducted of the use of laser energy for cutting contours, diameters, and holes in flat and shaped Kevlar 49 fiber-reinforced epoxy laminates as an alternate to conventional machining. The investigation has shown that flat laminates 6.35 mm thick may be cut without backup by using a high-powered (1000-watt) continuous wave CO/sub 2/ laser at high feedrates (33.87 mm per second). The cut produced was free of the burrs and delaminations resulting from conventional machining methods without intimate contact backup. In addition, the process cycle time was greatly reduced.

  14. Circular Cationic Compounds B3Rgn+ of Triangular Ion B3 Trapping Rare Gases

    ZHANG Ruiwen; LI Anyong; LI Zhuozhe

    2017-01-01

    The circular cationic compounds B3Rgn+(n=1-3,Rg=He-Rn) formed by the electron-deficient aromatic ion B3+ trapping rare gases were studied theoretically.The formed B-Rg bond has large bonding energy in the range of 60--209 kJ/mol,its length is close to the stun of covalent radii of B and Rg,for Ar-Rn.The analyses based on the natural bond orbitals and electron density topology show that the B-Rg bonds for Ar-Rn have strong covalent character.The geometric structures,binding energy,bond nature and thermodynamic stability of the boron-rare gas compounds show that these species for Ar-Rn may be experimentally available.Several different theoretical studies have demonstrated that these triangular cations are aromatic.

  15. Clerics urge ban on altering germline cells.

    Norman, C

    1983-06-24

    A resolution calling for a ban on genetic engineering of human reproductive cells has been signed by leaders of almost every major church group in the United States. Some of the religious leaders, while not certain that a total moratorium should be placed on altering germline cells, signed the statement in order to stimulate public debate on the issue. Legislation has recently been introduced in Congress to set up a committee to monitor genetic engineering and its human applications, but author Jeremy Rifkin, the impetus behind the church leaders' resolution, argues that such tampering threatens the gene pool and should be banned altogether.

  16. 45 CFR 73b.3 - Reports of violations.

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Reports of violations. 73b.3 Section 73b.3 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION DEBARMENT OR SUSPENSION OF FORMER EMPLOYEES § 73b.3 Reports of violations. (a) If an officer or employee of the Department has reason to...

  17. Failure modes of laminate structures

    Gordon, L.B.; Druce, R.L.; Wilson, M.J.

    1987-06-01

    Laminate structures composed of alternating thin layers of conductor and dielectric material are commonly used in energy storage and transmission components. The failure of the dielectric layers in regions of high field stress, with applied 60 Hz ac, dc and impulse voltages, was studied. Several geometries were compared, including staggered and flush edges. Electrical trees developed between the laminated dielectric layers. The visual characteristics and growth rates of the electrical trees under ac, dc and impulse stresses were different. Partial discharge detection and analysis was used to measure the inception voltage and discharge activity at the conductor edge voids, to observe tree formation and growth, and to predict impending failure due to dielectric erosion. Electric field distributions were modeled and partial discharge inception levels were estimated from known void geometries. The staggered edge geometry appears to enhance the electric field stress at the recessed electrode.

  18. Optimization of Laminated Composite Structures

    Henrichsen, Søren Randrup

    of the contributions of the PhD project are included in the second part of the thesis. Paper A presents a framework for free material optimization where commercially available finite element analysis software is used as analysis tool. Robust buckling optimization of laminated composite structures by including...... allows for a higher degree of tailoring of the resulting material. To enable better utilization of the composite materials, optimum design procedures can be used to assist the engineer. This PhD thesis is focused on developing numerical methods for optimization of laminated composite structures...... nonlinear analysis of structures, buckling and post-buckling analysis of structures, and formulations for optimization of structures considering stiffness, buckling, and post-buckling criteria. Lastly, descriptions, main findings, and conclusions of the papers are presented. The papers forming the basis...

  19. Specific contribution of lamin A and lamin C in the development of laminopathies

    Sylvius, Nicolas; Hathaway, Andrea; Boudreau, Emilie; Gupta, Pallavi; Labib, Sarah; Bolongo, Pierrette M.; Rippstein, Peter; McBride, Heidi; Bilinska, Zofia T.; Tesson, Frederique

    2008-01-01

    Mutations in the lamin A/C gene are involved in multiple human disorders for which the pathophysiological mechanisms are partially understood. Conflicting results prevail regarding the organization of lamin A and C mutants within the nuclear envelope (NE) and on the interactions of each lamin to its counterpart. We over-expressed various lamin A and C mutants both independently and together in COS7 cells. When expressed alone, lamin A with cardiac/muscular disorder mutations forms abnormal aggregates inside the NE and not inside the nucleoplasm. Conversely, the equivalent lamin C organizes as intranucleoplasmic aggregates that never connect to the NE as opposed to wild type lamin C. Interestingly, the lamin C molecules present within these aggregates exhibit an abnormal increased mobility. When co-expressed, the complex formed by lamin A/C aggregates in the NE. Lamin A and C mutants for lipodystrophy behave similarly to the wild type. These findings reveal that lamins A and C may be differentially affected depending on the mutation. This results in multiple possible physiological consequences which likely contribute in the phenotypic variability of laminopathies. The inability of lamin C mutants to join the nuclear rim in the absence of lamin A is a potential pathophysiological mechanism for laminopathies

  20. Human Germline: A New Research Frontier

    M. Azim Surani

    2015-06-01

    Full Text Available We recently elucidated the mechanism of human primordial germ cell (hPGC specification and resetting of the epigenome for totipotency. The regulators of hPGC specification also initiate resetting of the epigenome, leading to a comprehensive erasure of DNA methylation, erasure of imprints and X reactivation in early hPGCs in vivo. These studies reveal differences with the mouse model, which are probably due to differences in the regulation of human pluripotency, and in postimplantation development at gastrulation, which indicates the importance of non-rodent models for investigations. Within the extreme hypomethylated environment of the early human germline are loci that are resistant to DNA demethylation, with subsequent predominant expression in neural cells. These loci provide a model for studies on the mechanism of transgenerational epigenetic inheritance, and their response to environmental factors. Such epigenetic mechanism of inheritance could potentially provide greater phenotypic plasticity, with significant consequences for human development and disease.

  1. Methods in Molecular Biology: Germline Stem Cells | Center for Cancer Research

    The protocols in Germline Stem Cells are intended to present selected genetic, molecular, and cellular techniques used in germline stem cell research. The book is divided into two parts. Part I covers germline stem cell identification and regulation in model organisms. Part II covers current techniques used in in vitro culture and applications of germline stem cells.

  2. Impact damages modeling in laminated composite structures

    Kreculj Dragan D.

    2014-01-01

    Full Text Available Laminated composites have an important application in modern engineering structures. They are characterized by extraordinary properties, such as: high strength and stiffness and lightweight. Nevertheless, a serious obstacle to more widespread use of those materials is their sensitivity to the impact loads. Impacts cause initiation and development of certain types of damages. Failures that occur in laminated composite structures can be intralaminar and interlaminar. To date it was developed a lot of simulation models for impact damages analysis in laminates. Those models can replace real and expensive testing in laminated structures with a certain accuracy. By using specialized software the damage parameters and distributions can be determined (at certain conditions on laminate structures. With performing numerical simulation of impact on composite laminates there are corresponding results valid for the analysis of these structures.

  3. Glucocorticoids and laminitis in the horse.

    Johnson, Philip J; Slight, Simon H; Ganjam, Venkataseshu K; Kreeger, John M

    2002-08-01

    The administration of exogenously administered GCs and syndromes associated with GC excess are both attended by increased risk for the development of laminitis in adult horses. However, there exists substantial controversy as to whether excess GCs cause laminitis de novo. If true, the pathogenesis of laminitis arising from the effects of GC excess is probably different from that associated with diseases of the gastrointestinal tract and endotoxemia. Although a satisfactory explanation for the development of laminitis as a consequence of GC action is currently lacking, numerous possible and plausible theoretical mechanisms do exist. Veterinarians must exert caution with respect to the use of GCs in adult horses. The extent to which individual horses are predisposed to laminitis as a result of GC effect cannot be predicted based on current information. However, the administration of systemic GCs to horses that have been previously affected by laminitis should be used only with extreme caution, and should be accompanied by careful monitoring for further signs of laminitis. The risk of laminitis appears to be greater during treatment using some GCs (especially dexamethasone and triamcinalone) compared with others (prednisone and prednisolone). Whenever possible, to reduce the risk of laminitis, GCs should be administered locally. For example, the risk of GC-associated laminitis is evidently considerably reduced in horses affected with chronic obstructive pulmonary disease (COPD) if GC treatment is administered via inhalation. We have hypothesized that structural changes in the equine hoof that resemble laminitis may arise as a consequence of excess GC effect. Although these changes are not painful per se, and are not associated with inflammation, they could likely predispose affected horses to the development of bona fide laminitis for other reasons. Moreover, the gross morphological appearance of the chronically GC-affected hoof resembles that of a chronically

  4. Embedded adhesive connection for laminated glass plates

    Hansen, Jens Zangenberg; Poulsen, S.H.; Bagger, A.

    2012-01-01

    The structural behavior of a new connection design, the embedded adhesive connection, used for laminated glass plates is investigated. The connection consists of an aluminum plate encapsulated in-between two adjacent triple layered laminated glass plates. Fastening between glass and aluminum...... usage in a design situation. The embedded connection shows promising potential as a future fastening system for load-carrying laminated glass plates....

  5. Misexpression of cyclin B3 leads to aberrant spermatogenesis.

    Refik-Rogers, Jale; Manova, Katia; Koff, Andrew

    2006-09-01

    Mus musculus cyclin B3 is an early meiotic cyclin that is expressed in leptotene and zygotene phases during gametogenesis. In order to determine whether downregulation of cyclin B3 at zygotene-pachytene transition was important for normal spermatogenesis, we investigated the consequences of expressing H. sapiens cyclin B3 after zygotene in mouse testes. Prolonging expression of cyclin B3 until the end of meiosis led to a reduction in sperm counts and disruption of spermatogenesis in four independent lines of transgenic mice. There were three distinct morphological defects associated with the ectopic expression of cyclin B3. Seminiferous tubules were either depleted of germ cells, had an abnormal cell mass in the lumen, or were characterized by the presence of abnormal round spermatids. These defects were associated with increased apoptosis in the testes. These results suggest that downregulation of cyclin B3 at the zygotene-pachytene transition is required to ensure normal spermatogenesis.

  6. Minisatellite germline mutation rate in the Techa River population

    Dubrova, Yuri E. [Department of Genetics, University of Leicester, University Road, Leicester LE1 7RH (United Kingdom)]. E-mail: yed2@le.ac.uk; Ploshchanskaya, Olga G. [Urals Research Centre for Radiation Medicine, Medgorodok, Chelyabinsk 454076 (Russian Federation); Department of Radiobiology, Chelyabinsk State University, Chelyabinsk 454021 (Russian Federation); Kozionova, Olga S. [Urals Research Centre for Radiation Medicine, Medgorodok, Chelyabinsk 454076 (Russian Federation); Department of Radiobiology, Chelyabinsk State University, Chelyabinsk 454021 (Russian Federation); Akleyev, Alexander V. [Urals Research Centre for Radiation Medicine, Medgorodok, Chelyabinsk 454076 (Russian Federation); Department of Radiobiology, Chelyabinsk State University, Chelyabinsk 454021 (Russian Federation)

    2006-12-01

    Germline mutation at eight minisatellite loci has been studied among the irradiated families from the Techa River population and non-exposed families from the rural area of the Chelyabinsk and Kurgan Oblasts. The groups were matched by ethnicity, parental age, occupation and smoking habit. A statistically significant 1.7-fold increase in mutation rate was found in the germline of irradiated fathers, whereas maternal germline mutation rate in the exposed families was not elevated. Most of the minisatellite loci showed an elevated paternal mutation rate in the exposed group, indicating a generalised increase in minisatellite germline mutation rate in the Techa River population. These data suggest that the elevated minisatellite mutation rate can be attributed to radioactive exposure. The spectra of paternal mutation seen in the unexposed and exposed families were indistinguishable.

  7. Minisatellite germline mutation rate in the Techa River population

    Dubrova, Yuri E.; Ploshchanskaya, Olga G.; Kozionova, Olga S.; Akleyev, Alexander V.

    2006-01-01

    Germline mutation at eight minisatellite loci has been studied among the irradiated families from the Techa River population and non-exposed families from the rural area of the Chelyabinsk and Kurgan Oblasts. The groups were matched by ethnicity, parental age, occupation and smoking habit. A statistically significant 1.7-fold increase in mutation rate was found in the germline of irradiated fathers, whereas maternal germline mutation rate in the exposed families was not elevated. Most of the minisatellite loci showed an elevated paternal mutation rate in the exposed group, indicating a generalised increase in minisatellite germline mutation rate in the Techa River population. These data suggest that the elevated minisatellite mutation rate can be attributed to radioactive exposure. The spectra of paternal mutation seen in the unexposed and exposed families were indistinguishable

  8. Identification of germline transcriptional regulatory elements in Aedes aegypti

    Akbari, Omar S.; Papathanos, Philippos A.; Sandler, Jeremy E.; Kennedy, Katie; Hay, Bruce A.

    2014-02-01

    The mosquito Aedes aegypti is the principal vector for the yellow fever and dengue viruses, and is also responsible for recent outbreaks of the alphavirus chikungunya. Vector control strategies utilizing engineered gene drive systems are being developed as a means of replacing wild, pathogen transmitting mosquitoes with individuals refractory to disease transmission, or bringing about population suppression. Several of these systems, including Medea, UDMEL, and site-specific nucleases, which can be used to drive genes into populations or bring about population suppression, utilize transcriptional regulatory elements that drive germline-specific expression. Here we report the identification of multiple regulatory elements able to drive gene expression specifically in the female germline, or in the male and female germline, in the mosquito Aedes aegypti. These elements can also be used as tools with which to probe the roles of specific genes in germline function and in the early embryo, through overexpression or RNA interference.

  9. Genotype and phenotype spectrum of NRAS germline variants

    Altmuller, F.; Lissewski, C.; Bertola, D.; Flex, E.; Stark, Z.; Spranger, S.; Baynam, G.; Buscarilli, M.; Dyack, S.; Gillis, J.; Yntema, H.G.; Pantaleoni, F.; Loon, R.L. van; MacKay, S.; Mina, K.; Schanze, I.; Tan, T.Y.; Walsh, M.; White, S.M.; Niewisch, M.R.; Garcia-Minaur, S.; Plaza, D.; Ahmadian, M.R.; Cave, H.; Tartaglia, M.; Zenker, M.

    2017-01-01

    RASopathies comprise a group of disorders clinically characterized by short stature, heart defects, facial dysmorphism, and varying degrees of intellectual disability and cancer predisposition. They are caused by germline variants in genes encoding key components or modulators of the highly

  10. 26 CFR 48.4161(b)-3 - Use considered sale.

    2010-04-01

    ....4161(b)-3 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) MISCELLANEOUS EXCISE TAXES MANUFACTURERS AND RETAILERS EXCISE TAXES Sporting Goods § 48.4161(b)-3 Use considered sale. For provisions relating to the tax on use of taxable articles by the manufacturer, producer, or...

  11. Lamins of the sea lamprey (Petromyzon marinus) and the evolution of the vertebrate lamin protein family.

    Schilf, Paul; Peter, Annette; Hurek, Thomas; Stick, Reimer

    2014-07-01

    Lamin proteins are found in all metazoans. Most non-vertebrate genomes including those of the closest relatives of vertebrates, the cephalochordates and tunicates, encode only a single lamin. In teleosts and tetrapods the number of lamin genes has quadrupled. They can be divided into four sub-types, lmnb1, lmnb2, LIII, and lmna, each characterized by particular features and functional differentiations. Little is known when during vertebrate evolution these features have emerged. Lampreys belong to the Agnatha, the sister group of the Gnathostomata. They split off first within the vertebrate lineage. Analysis of the sea lamprey (Petromyzon marinus) lamin complement presented here, identified three functional lamin genes, one encoding a lamin LIII, indicating that the characteristic gene structure of this subtype had been established prior to the agnathan/gnathostome split. Two other genes encode lamins for which orthology to gnathostome lamins cannot be designated. Search for lamin gene sequences in all vertebrate taxa for which sufficient sequence data are available reveals the evolutionary time frame in which specific features of the vertebrate lamins were established. Structural features characteristic for A-type lamins are not found in the lamprey genome. In contrast, lmna genes are present in all gnathostome lineages suggesting that this gene evolved with the emergence of the gnathostomes. The analysis of lamin gene neighborhoods reveals noticeable similarities between the different vertebrate lamin genes supporting the hypothesis that they emerged due to two rounds of whole genome duplication and makes clear that an orthologous relationship between a particular vertebrate paralog and lamins outside the vertebrate lineage cannot be established. Copyright © 2014 Elsevier GmbH. All rights reserved.

  12. Germline Manipulation and Our Future Worlds.

    Harris, John

    2015-01-01

    Two genetic technologies capable of making heritable changes to the human genome have revived interest in, and in some quarters a very familiar panic concerning, so-called germline interventions. These technologies are: most recently the use of CRISPR/Cas9 to edit genes in non-viable IVF zygotes and Mitochondrial Replacement Therapy (MRT) the use of which was approved in principle in a landmark vote earlier this year by the United Kingdom Parliament. The possibility of using either of these techniques in humans has encountered the most violent hostility and suspicion. However it is important to be aware that much of this hostility dates back to the fears associated with In Vitro Fertilization (IVF) and other reproductive technologies and by cloning; fears which were baseless at the time concerning both IVF and cloning the use of both of which have proved to be highly beneficial to humanity and which have been effectively regulated and controlled. This paper argues that CRISPR should by pursued through researh until it is safe enough for use in humans but there is no reason to suppose at this stage that such use will be unsafe or unethical (Collins 2015).

  13. Wettability of graphene-laminated micropillar structures

    Bong, Jihye; Seo, Keumyoung; Ju, Sanghyun; Park, Ji-Hoon; Ahn, Joung Real

    2014-01-01

    The wetting control of graphene is of great interest for electronic, mechanical, architectural, and bionic applications. In this study, the wettability of graphene-laminated micropillar structures was manipulated by changing the height of graphene-laminated structures and employing the trichlorosilane (HDF-S)-based self-assembly monolayer. Graphene-laminated micropillar structures with HDF-S exhibited higher hydrophobicity (contact angle of 129.5°) than pristine graphene thin film (78.8°), pristine graphene-laminated micropillar structures (97.5°), and HDF-S self-assembled graphene thin film (98.5°). Wetting states of the graphene-laminated micropillar structure with HDF-S was also examined by using a urea solution, which flowed across the surface without leaving any residues

  14. Rare bile duct anomaly: B3 duct draining to gallbladder

    Seung Eun Lee

    2016-01-01

    Full Text Available A 10-year-old girl presented with recurrent right upper abdominal pain and dyspepsia. Magnetic resonance cholangiopancreatography revealed a dilated common channel of intrahepatic bile duct of segment 3 (B3 and segment 4 (B4 drained into the gallbladder directly. The patient underwent laparoscopic cholecystectomy and Roux-en Y hepaticojejunostomy (B3-jejunostomy. Among the anatomical variability of the biliary system, the cholecystohepatic ducts are controversial in existence and incidence. We report a very rare variant of a cholecystohepatic duct in which the B3 duct drained into gallbladder directly and to the best of our knowledge this is the first report.

  15. Predisposing factors of laminitis in cattle.

    Vermunt, J J; Greenough, P R

    1994-01-01

    Laminitis is regarded as a major predisposing factor in lameness caused by claw disorders. Despite intensive study, both by experiment and by clinical observation, knowledge of the precise aetiology and pathogenesis of bovine laminitis is still incomplete. It is often hypothesized that changes in the micro-circulation of the corum (dermis) of the bovine claw contribute significantly to the development of laminitis; arteriovenous anastomoses (AVAs) playing a crucial role. Many factors have been implicated as contributing causes of laminitis in cattle; the disease has a multifactorial aetiology. The cause of laminitis should be considered as a combination of predisposing factors leading to vascular (AVAs in particular) reactivity and inhibition of normal horn synthesis. Nutrition, disease, management and behaviour appear to be closely involved in the pathogenesis of bovine laminitis. The major factors predisposing to laminitis in cattle, as reported or suggested in the literature, are reviewed, including systemic disease, nutrition (barley grain, protein, carbohydrate and fibre), management (housing, bedding and exercise), calving, season, age, growth, genetics, conformation and behaviour.

  16. Laminitis and the equine metabolic syndrome.

    Johnson, Philip J; Wiedmeyer, Charles E; LaCarrubba, Alison; Ganjam, V K Seshu; Messer, Nat T

    2010-08-01

    Although much has been written about laminitis in the context of its association with inflammatory processes, recognition is growing that most cases of laminitis examined by veterinarians in private practice are those associated with pasture grazing, obesity, and insulin resistance (IR). The term 'endocrinopathic laminitis' has been adopted to classify the instances of laminitis in which the origin seems to be more strongly associated with an underlying endocrinopathy, such as either IR or the influence of corticosteroids. Results of a recent study suggest that obesity and IR represent the most common metabolic and endocrinopathic predispositions for laminitis in horses. IR also plays an important role in the pathogenesis of laminitis that develops when some horses or ponies are allowed to graze pastures at certain times of the year. The term equine metabolic syndrome (EMS) has been proposed as a label for horses whose clinical examination results (including both physical examination and laboratory testing) suggest heightened risk for developing laminitis as a result of underlying IR. Copyright (c) 2010 Elsevier Inc. All rights reserved.

  17. Meshfree modeling in laminated composites

    Simkins, Daniel Craig; Collier, Nathan; Alford, Joseph B.

    2012-01-01

    A problem of increasing importance in the aerospace industry is in detailed modeling of explicit fracture in laminated composite materials. For design applications, the simulation must be capable of initiation and propagation of changes in the problem domain. Further, these changes must be able to be incorporated within a design-scale simulation. The use of a visibility condition, coupled with the local and dynamic nature of meshfree shape function construction allows one to initiate and explicitly open and propagate holes inside a previously continuous problem domain. The method to be presented naturally couples to a hierarchical multi-scale material model incorporating external knowldege bases to achieve the goal of a practical explicit fracture modeling capability for full-scale problems. © 2013 Springer-Verlag.

  18. Meshfree modeling in laminated composites

    Simkins, Daniel Craig

    2012-09-27

    A problem of increasing importance in the aerospace industry is in detailed modeling of explicit fracture in laminated composite materials. For design applications, the simulation must be capable of initiation and propagation of changes in the problem domain. Further, these changes must be able to be incorporated within a design-scale simulation. The use of a visibility condition, coupled with the local and dynamic nature of meshfree shape function construction allows one to initiate and explicitly open and propagate holes inside a previously continuous problem domain. The method to be presented naturally couples to a hierarchical multi-scale material model incorporating external knowldege bases to achieve the goal of a practical explicit fracture modeling capability for full-scale problems. © 2013 Springer-Verlag.

  19. Influence of bress laminate volume fraction on electromechanical properties of externally laminated coated conductor tapes

    Bautista, Zhierwinjay M.; Shin, Hyung Seop [Dept. of Mechanical Design Engineering, Andong National University, Andong (Korea, Republic of); Lee, Jae Hun; Lee, Hun Ju; Moon, Seung Hyun [SuNAM Co Ltd., Anseong (Korea, Republic of)

    2016-09-15

    The enhancement of mechanical properties of coated conductor (CC) tapes in practical application are usually achieved by reinforcing through lamination or electroplating metal layers on either sides of the CC tape. Mechanical or electromechanical properties of the CC tapes have been largely affected by the lamination structure under various loading modes such as tension, bending or even cyclic. In this study, the influence of brass laminate volume fraction on electromechanical properties of RCE-DR processed Gadolinium-barium-copper-oxide (GdBCO) CC tapes was investigated. The samples used were composed of single-side and both-side laminate of brass layer to the Cu-stabilized CC tape and their Ic behaviors were compared to those of the Cu-stabilized CC tape without external lamination. The stress/strain dependences of Ic in laminated CC tapes under uniaxial tension were analyzed and the irreversible stress/strain limits were determined. As a result, the increase of brass laminate volume fraction initially increased the irreversible strain limit and became gradual. The corresponding irreversible stress limit, however, showed no difference even though the brass laminate volume fraction increased to 3.4. But the irreversible load limit linearly increased with the brass laminate volume fraction.

  20. Laminate mechanics for balanced woven fabrics

    Akkerman, Remko

    2006-01-01

    Laminate mechanics equations are presented for composites with balanced woven fabric reinforcements. It is shown that mimicking these textile composites with equivalent transversely isotropic (‘unidirectional’) layers requires disputable manipulations. Various micromechanics predictions of textile

  1. Natural fabric sandwich laminate composites: development and ...

    3Department of Production Technology, MIT Campus, Anna University, Chennai 600044, India. MS received ... In this work, eco-friendly natural fabric sandwich laminate (NFSL) composites are formulated using ... and eco-friendly quality [22].

  2. Behaviour of Mechanically Laminated CLT Members

    Kuklík, P.; Velebil, L.

    2015-11-01

    Cross laminated timber (CLT) is one of the structural building systems based on the lamination of multiple layers, where each layer is oriented perpendicularly to each other. Recent requirements are placed to develop an alternative process based on the mechanical lamination of the layers, which is of particular interest to our research group at the University Centre for Energy Efficient Buildings. The goal is to develop and verify the behaviour of mechanically laminated CLT wall panels exposed to shear stresses in the plane. The shear resistance of mechanically jointed CLT is ensured by connecting the layers by screws. The paper deals with the experimental analysis focused on the determination of the torsional stiffness and the slip modulus of crossing areas for different numbers of orthogonally connected layers. The results of the experiments were compared with the current analytical model.

  3. Germline fumarate hydratase mutations in patients with ovarian mucinous cystadenoma

    Ylisaukko-oja, Sanna K.; Cybulski, Cezary; Lehtonen, Rainer

    2006-01-01

    Germline mutations in the fumarate hydratase (FH) gene were recently shown to predispose to the dominantly inherited syndrome, hereditary leiomyomatosis and renal cell cancer (HLRCC). HLRCC is characterized by benign leiomyomas of the skin and the uterus, renal cell carcinoma, and uterine...... leiomyosarcoma. The aim of this study was to identify new families with FH mutations, and to further examine the tumor spectrum associated with FH mutations. FH germline mutations were screened from 89 patients with RCC, skin leiomyomas or ovarian tumors. Subsequently, 13 ovarian and 48 bladder carcinomas were...

  4. Germline Variants in Targeted Tumor Sequencing Using Matched Normal DNA.

    Schrader, Kasmintan A; Cheng, Donavan T; Joseph, Vijai; Prasad, Meera; Walsh, Michael; Zehir, Ahmet; Ni, Ai; Thomas, Tinu; Benayed, Ryma; Ashraf, Asad; Lincoln, Annie; Arcila, Maria; Stadler, Zsofia; Solit, David; Hyman, David M; Hyman, David; Zhang, Liying; Klimstra, David; Ladanyi, Marc; Offit, Kenneth; Berger, Michael; Robson, Mark

    2016-01-01

    Tumor genetic sequencing identifies potentially targetable genetic alterations with therapeutic implications. Analysis has concentrated on detecting tumor-specific variants, but recognition of germline variants may prove valuable as well. To estimate the burden of germline variants identified through routine clinical tumor sequencing. Patients with advanced cancer diagnoses eligible for studies of targeted agents at Memorial Sloan Kettering Cancer Center are offered tumor-normal sequencing with MSK-IMPACT, a 341-gene panel. We surveyed the germline variants seen in 187 overlapping genes with Mendelian disease associations in 1566 patients who had undergone tumor profiling between March and October 2014. The number of presumed pathogenic germline variants (PPGVs) and variants of uncertain significance per person in 187 genes associated with single-gene disorders and the proportions of individuals with PPGVs in clinically relevant gene subsets, in genes consistent with known tumor phenotypes, and in genes with evidence of second somatic hits in their tumors. The mean age of the 1566 patients was 58 years, and 54% were women. Presumed pathogenic germline variants in known Mendelian disease-associated genes were identified in 246 of 1566 patients (15.7%; 95% CI, 14.0%-17.6%), including 198 individuals with mutations in genes associated with cancer susceptibility. Germline findings in cancer susceptibility genes were concordant with the individual's cancer type in only 81 of 198 cases (40.9%; 95% CI, 34.3%-47.9%). In individuals with PPGVs retained in the tumor, somatic alteration of the other allele was seen in 39 of 182 cases (21.4%; 95% CI, 16.1%-28.0%), of which 13 cases did not show a known correlation of the germline mutation and a known syndrome. Mutations in non-cancer-related Mendelian disease genes were seen in 55 of 1566 cases (3.5%; 95% CI, 27.1%-45.4%). Almost every individual had more than 1 variant of uncertain significance (1565 of 1566 patients; 99

  5. Electrification Beyond Light Duty: Class 2b-3 Commercial Vehicles

    Birky, Alicia [Energetics Incorporated; Laughlin, Michael [Energetics Incorporated; Tartaglia, Katie [Energetics Incorporated; Price, Rebecca [Energetics Incorporated; Lim, Brandon [Energetics Incorporated; Lin, Zhenhong [ORNL

    2018-01-01

    The class 2b-3 truck market covers a wide range of commercial truck applications across a half-million vehicle sales annually. This report collected public information and stakeholder input to assess the opportunity for electrification in this market. Although class 2b-3 pickup truck and van bodies are very similar to personal light vehicles, their functional requirements are quite different due to the demands of the commercial market. These demands vary by application and often vary from day to day for a single application. Fleet customers purchase these vehicles to perform a particular job for their business and are concerned about the overall cost of doing that job. Therefore, the vehicles must meet the job requirements cost effectively. Customers also are sensitive to initial cost. Electrification offers the potential to reduce vehicle operating costs and possibly improve vehicle functionality. However, the current market for class 2b-3 electrified trucks is very small, and the trucks are costly. Increased production volumes are key to cost reductions and may be assisted by sharing components with larger or smaller truck classes. Expanding demand is also crucial and stakeholders identified several niche markets with duty cycles that are likely well-suited to electrified class 2b-3 trucks. To expand beyond these niches, class 2b-3 electric solutions must be robust, flexible, and adaptable in order to cover a wide range of vocations, applications, and duty cycles.

  6. Yield Stress Model for Molten Composition B-3

    Davis, Stephen; Zerkle, David

    2017-06-01

    Composition B-3 (Comp B-3) is a melt-castable explosive composed of 60/40 wt% RDX/TNT (hexahydro-1,3,5-trinitro-1,3,5-triazine/2,4,6-trinitrotoluene). During casting operations thermal conditions are controlled which along with the low melting point of TNT and the insensitivity of the mixture to external stimuli leading to safe use. Outside these standard operating conditions a more rigorous model of Comp B-3 rheological properties is necessary to model thermal transport as Comp B-3 evolves from quiescent solid through vaporization/decomposition upon heating. One particular rheological phenomena of interest is Bingham plasticity, where a material behaves as a quiescent solid unless a sufficient load is applied, resulting in fluid flow. In this study falling ball viscometer data is used to model the change in Bingham plastic yield stresses as a function of RDX particle volume fraction; a function of temperature. Results show the yield stress of Comp B-3 (τy) follows the expression τy = B ϕ -ϕc N , where Φ and Φc are the volume fraction of RDX and a critical volume fraction, respectively and B and N are experimentally evaluated constants.

  7. Scarf Repair of Composite Laminates

    Xie Zonghong

    2016-01-01

    Full Text Available The use of composite materials, such as carbon-fiber reinforced plastic (CFRP composites, aero-structures has led to an increased need of advanced assembly joining and repair technologies. Adhesive bonded repairs as an alternative to recover full or part of initial strength were investigated. Tests were conducted with the objective of evaluating the effectiveness of techniques used for repairing damage fiber reinforced laminated composites. Failure loads and failure modes were generated and compared with the following parameters: scarf angles, roughness of grind tool and number of external plies. Results showed that scarf angle was the critical parameter and the largest tensile strength was observed with the smallest scarf angle. Besides, the use of external plies at the outer surface could not increase the repairs efficiency for large scarf angle. Preparing the repair surfaces by sanding them with a sander ranging from 60 to 100 grit number had significant effect on the failure load. These results allowed the proposal of design principles for repairing CFRP structures.

  8. Bovine laminitis: clinical aspects, pathology and pathogenesis with reference to acute equine laminitis.

    Boosman, R; Németh, F; Gruys, E

    1991-07-01

    This review deals with the features of clinical and subclinical laminitis in cattle. Prominent clinical signs of acute laminitis are a tender gait and arched back. The sole horn reveals red and yellowish discolourations within five days. In subacute and chronic cases clinical signs are less severe. In chronic laminitis the shape of the claws is altered. Laminitis is frequently followed by sole ulceration and white zone lesions. Blood tests showed no significant changes for laminitic animals. Arteriographic studies of claws affected by laminitis indicated that blood vessels had narrowed lumens. Gross pathology revealed congestion of the corium and rotation of the distal phalanx. Histopathologic studies indicate that laminitis is associated with changes of the vasculature. Peripartum management and nutrition are important factors in its aetiology. It is hypothesised that laminitis is evoked by disturbed digital circulation. In the pathogenesis of acute laminitis three factors are considered important: the occurrence of thrombosis, haemodynamic aspects of the corium, and endotoxins which trigger these pathologic events.

  9. Effect of laminate edge conditions on the formation of microvoids in composite laminates

    Anderson, J. P.; Altan, M. C.

    2015-05-01

    Manufacturing defects such as microvoids are common in thermoset composite components and are known to negatively affect their strength. The resin pressure developed in and the resin flow out from the laminates during cure have been reported to be the primary factors influencing the final void content of a composite component. In this work, the effect of laminate edge conditions during the cure process on the formation of microvoids was experimentally investigated. This was achieved by fabricating eight-ply laminates from TenCate® BT250/7781 prepreg in a hot-press at a constant cure pressure of 170 kPa while limiting the laminate perimeter available for resin flow by 0%, 25%, 50%, 75%, and 100%. The individual plies of these five laminates were conditioned at 99% relative humidity before curing to maximize the moisture present in the lay-up before fabrication. The presence of moisture in the lay-ups was expected to promote void formation and allow the effect of restricting flow at the edges of a laminate to be better identified. The restriction of resin outflow was found to cause the average characteristic void diameter to decrease by 17% and void content to rise by 33%. This phenomenon was identified to be a result of the outflow restriction increasing the number of voids trapped within the laminate and indicates that for laminates cured at low pressures resin outflow is the dominant mechanism for void reduction.

  10. Cancer-germline antigen vaccines and epigenetic enhancers

    Gjerstorff, Morten Frier; Burns, Jorge; Ditzel, Henrik Jorn

    2010-01-01

    IMPORTANCE OF THE FIELD: Immunotherapy holds great potential for disseminated cancer, and cancer-germline (CG) antigens are among the most promising tumor targets. They are widely expressed in different cancer types and are essentially tumor-specific, since their expression in normal tissues is l...

  11. Human germline gene editing: Recommendations of ESHG and ESHRE

    de Wert, Guido; Pennings, Guido; Clarke, Angus; Eichenlaub-Ritter, Ursula; van El, Carla G.; Forzano, Francesca; Goddijn, Mariëtte; Heindryckx, Björn; Howard, Heidi C.; Radojkovic, Dragica; Rial-Sebbag, Emmanuelle; Tarlatzis, Basil C.; Cornel, Martina C.

    2018-01-01

    Technological developments in gene editing raise high expectations for clinical applications, first of all for somatic gene editing but in theory also for germline gene editing (GLGE). GLGE is currently not allowed in many countries. This makes clinical applications in these countries impossible

  12. Effects of hypervitaminosis of vitamin B3 on silkworm biology

    Unknown

    [Etebari K and Matindoost L 2004 Effects of hypervitaminosis of vitamin B3 on silkworm biology; J. Biosci. 29 417–422]. 1. ... ate growth of larvae and the reproduction in many insects and also mites has been ... were dried in air for 10 min.

  13. Evaluation of Behaviours of Laminated Glass

    Sable, L.; Japins, G.; Kalnins, K.

    2015-11-01

    Visual appearance of building facades and other load bearing structures, which now are part of modern architecture, is the reason why it is important to investigate in more detail the reliability of laminated glass for civil structures. Laminated glass in particular has become one of the trendy materials, for example Apple© stores have both load carrying capacity and transparent appearance. Glass has high mechanical strength and relatively medium density, however, the risk of sudden brittle failure like concrete or other ceramics determine relatively high conservatism in design practice of glass structures. This should be changed as consumer requirements evolve calling for a safe and reliable design methodology and corresponding building standards. A design methodology for glass and glass laminates should be urgently developed and included as a chapter in Eurocode. This paper presents initial experimental investigation of behaviour of simple glass sheets and laminated glass samples in 4-point bending test. The aim of the current research is to investigate laminated glass characteristic values and to verify the obtained experimental results with finite element method for glass and EVA material in line with future European Structural Design of Glass Components code.

  14. Radioprotective action of pantothenic acid (vitamin B3)

    Perepelkin, S.P.; Egorova, N.D.; Kovalenko, V.A.; Demin, V.I.

    1976-01-01

    A protective action of pantothenic acid (vitamin B 3 ) administered orally with food in doses of 150, 750 and 1500 μg per animal has been studied in albino male rats exposed to a total-body X-irradiation of 600 R. Applied in the doses of 150 and 750 μg, the vitamin increases the animals radioresistance, while the dose of 1500 μg aggravates the course of radiation sickness

  15. Hybrid Laminates for Application in North Conditions

    Antipov, V. V.; Oreshko, E. I.; Erasov, V. S.; Serebrennikova, N. Yu.

    2016-11-01

    A hybrid aluminum-lithium alloy/SIAL laminate as a possible material for application in structures operated in North conditions is considered. The finite-element method is used for a buckling stability analysis of hybrid panels, bars, and plates. A technique allowing one to compare the buckling stability of multilayered hybrid plates is offered. Compression tests were run on a hybrid laminate wing panel as a prototype of the top panel of TU-204SM airplane made from a high-strength B95T2 aluminum alloy. It turned out that the lighter composite panel had a higher load-carrying capacity than the aluminum one. Results of investigation into the properties the hybrid aluminum-lithium alloy/SIAL laminate and an analysis of scientific-technical data on this subject showed that this composite material could be used in the elements of airframes, including those operated in north conditions.

  16. Plated lamination structures for integrated magnetic devices

    Webb, Bucknell C.

    2014-06-17

    Semiconductor integrated magnetic devices such as inductors, transformers, etc., having laminated magnetic-insulator stack structures are provided, wherein the laminated magnetic-insulator stack structures are formed using electroplating techniques. For example, an integrated laminated magnetic device includes a multilayer stack structure having alternating magnetic and insulating layers formed on a substrate, wherein each magnetic layer in the multilayer stack structure is separated from another magnetic layer in the multilayer stack structure by an insulating layer, and a local shorting structure to electrically connect each magnetic layer in the multilayer stack structure to an underlying magnetic layer in the multilayer stack structure to facilitate electroplating of the magnetic layers using an underlying conductive layer (magnetic or seed layer) in the stack as an electrical cathode/anode for each electroplated magnetic layer in the stack structure.

  17. Optimal Design of Laminated Composite Beams

    Blasques, José Pedro Albergaria Amaral

    model for the analysis of laminated composite beams is proposed. The structural analysis is performed in a beam finite element context. The development of a finite element based tool for the analysis of the cross section stiffness properties is described. The resulting beam finite element formulation...... is able to account for the effects of material anisotropy and inhomogeneity in the global response of the beam. Beam finite element models allow for a significant reduction in problem size and are therefore an efficient alternative in computationally intensive applications like optimization frameworks...... design of laminated composite beams. The devised framework is applied in the optimal design of laminated composite beams with different cross section geometries and subjected to different load cases. Design criteria such as beam stiffness, weight, magnitude of the natural frequencies of vibration...

  18. On Subsurface Crack Growth in Fibre Metal Laminate Materials

    Randall, Christian

    2003-01-01

    Fatigue crack growth in fibre metal laminates (FMLs) is significantly more complex than in monolithic materials due to the interaction of various physical mechanisms that govern the growth of cracks in laminates...

  19. Modeling Bistable Composite Laminates for Piezoelectric Morphing Structures

    Darryl V. Murray; Oliver J. Myers

    2013-01-01

    A sequential modeling effort for bistable composite laminates for piezoelectric morphing structures is presented. Thin unsymmetric carbon fiber composite laminates are examined for use of morphing structures using piezoelectric actuation. When cooling from the elevated cure temperature to room temperature, these unsymmetric composite laminates will deform. These postcure room temperature deformation shapes can be used as morphing structures. Applying a force to these deformed laminates will c...

  20. Investigation into the Quality of Thermally Treated Package Lamination

    Darius Kazlauskas

    2011-02-01

    Full Text Available The article deals with the problem of delaminating the package after pasteurization at relatively high temperatures. The main parameters of the lamination process influencing lamination strength were determined. The role of the amount of lamination glue and tension in the rewinder for two glue types were experimentally examined defining lamination regimes at which the process of delamination is excluded.Article in Lithuanian

  1. Properties of Chitosan-Laminated Collagen Film

    Vera Lazić

    2012-01-01

    Full Text Available The objective of this study is to determine physical, mechanical and barrier properties of chitosan-laminated collagen film. Commercial collagen film, which is used for making collagen casings for dry fermented sausage production, was laminated with chitosan film layer in order to improve the collagen film barrier properties. Different volumes of oregano essential oil per 100 mL of filmogenic solution were added to chitosan film layer: 0, 0.2, 0.4, 0.6 and 0.8 mL to optimize water vapour barrier properties. Chitosan layer with 0.6 or 0.8 % of oregano essential oil lowered the water vapour transmission rate to (1.85±0.10·10–6 and (1.78±0.03·10–6 g/(m2·s·Pa respectively, compared to collagen film ((2.51±0.05·10–6 g/(m2·s·Pa. However, chitosan-laminated collagen film did not show improved mechanical properties compared to the collagen one. Tensile strength decreased from (54.0±3.8 MPa of the uncoated collagen film to (36.3±4.0 MPa when the film was laminated with 0.8 % oregano essential oil chitosan layer. Elongation at break values of laminated films did not differ from those of collagen film ((18.4±2.7 %. Oxygen barrier properties were considerably improved by lamination. Oxygen permeability of collagen film was (1806.8±628.0·10–14 cm3/(m·s·Pa and values of laminated films were below 35·10–14 cm3/(m·s·Pa. Regarding film appearance and colour, lamination with chitosan reduced lightness (L and yellowness (+b of collagen film, while film redness (+a increased. These changes were not visible to the naked eye.

  2. Germline TERT promoter mutations are rare in familial melanoma

    Harland, Mark; Petljak, Mia; Robles-Espinoza, Carla Daniela

    2016-01-01

    Germline CDKN2A mutations occur in 40 % of 3-or-more case melanoma families while mutations of CDK4, BAP1, and genes involved in telomere function (ACD, TERF2IP, POT1), have also been implicated in melanomagenesis. Mutation of the promoter of the telomerase reverse transcriptase (TERT) gene (c.-57...... T>G variant) has been reported in one family. We tested for the TERT promoter variant in 675 multicase families wild-type for the known high penetrance familial melanoma genes, 1863 UK population-based melanoma cases and 529 controls. Germline lymphocyte telomere length was estimated in carriers....... The c.-57 T>G TERT promoter variant was identified in one 7-case family with multiple primaries and early age of onset (earliest, 15 years) but not among population cases or controls. One family member had multiple primary melanomas, basal cell carcinomas and a bladder tumour. The blood leukocyte...

  3. Prevalence of deleterious ATM germline mutations in gastric cancer patients.

    Huang, Dong-Sheng; Tao, Hou-Quan; He, Xu-Jun; Long, Ming; Yu, Sheng; Xia, Ying-Jie; Wei, Zhang; Xiong, Zikai; Jones, Sian; He, Yiping; Yan, Hai; Wang, Xiaoyue

    2015-12-01

    Besides CDH1, few hereditary gastric cancer predisposition genes have been previously reported. In this study, we discovered two germline ATM mutations (p.Y1203fs and p.N1223S) in a Chinese family with a history of gastric cancer by screening 83 cancer susceptibility genes. Using a published exome sequencing dataset, we found deleterious germline mutations of ATM in 2.7% of 335 gastric cancer patients of different ethnic origins. The frequency of deleterious ATM mutations in gastric cancer patients is significantly higher than that in general population (p=0.0000435), suggesting an association of ATM mutations with gastric cancer predisposition. We also observed biallelic inactivation of ATM in tumors of two gastric cancer patients. Further evaluation of ATM mutations in hereditary gastric cancer will facilitate genetic testing and risk assessment.

  4. Germline Genetic Modification and Identity: the Mitochondrial and Nuclear Genomes.

    Scott, Rosamund; Wilkinson, Stephen

    2017-12-01

    In a legal 'first', the UK removed a prohibition against modifying embryos in human reproduction, to enable mitochondrial replacement techniques (MRTs), a move the Government distanced from 'germline genetic modification', which it aligned with modifying the nuclear genome. This paper (1) analyzes the uses and meanings of this term in UK/US legal and policy debates; and (2) evaluates related ethical concerns about identity. It shows that, with respect to identity, MRTs and nuclear genome editing techniques such as CRISPR/Cas-9 (now a policy topic), are not as different as has been supposed. While it does not follow that the two should be treated exactly alike, one of the central reasons offered for treating MRTs more permissively than nuclear genetic modification, and for not regarding MRTs as 'germline genetic modification', is thereby in doubt. Identity cannot, by itself, do the work thus far assigned to it, explicitly or otherwise, in law and policy.

  5. In Vitro Cytotoxicity of Nanoparticles in Mammalian Germline Stem Cells

    Braydich-Stolle, Laura; Hussain, Saber; Schlager, John J.; Hofmann, Marie-Claude

    2005-01-01

    Gametogenesis is a complex biological process that is particularly sensitive to environmental insults such as chemicals. Many chemicals have a negative impact on the germline, either by directly affecting the germ cells, or indirectly through their action on the somatic nursing cells. Ultimately, these effects can inhibit fertility, and they may have negative consequences for the development of the offspring. Recently, nanomaterials such as nanotubes, nanowires, fullerene derivatives (buckyba...

  6. Male germline stem cells in non-human primates

    S. Sharma

    2017-09-01

    Full Text Available Over the past few decades, several studies have attempted to decipher the biology of mammalian germline stem cells (GSCs. These studies provide evidence that regulatory mechanisms for germ cell specification and migration are evolutionarily conserved across species. The characteristics and functions of primate GSCs are highly distinct from rodent species; therefore the findings from rodent models cannot be extrapolated to primates. Due to limited availability of human embryonic and testicular samples for research purposes, two non-human primate models (marmoset and macaque monkeys are extensively employed to understand human germline development and differentiation. This review provides a broader introduction to the in vivo and in vitro germline stem cell terminology from primordial to differentiating germ cells. Primordial germ cells (PGCs are the most immature germ cells colonizing the gonad prior to sex differentiation into testes or ovaries. PGC specification and migratory patterns among different primate species are compared in the review. It also reports the distinctions and similarities in expression patterns of pluripotency markers (OCT4A, NANOG, SALL4 and LIN28 during embryonic developmental stages, among marmosets, macaques and humans. This review presents a comparative summary with immunohistochemical and molecular evidence of germ cell marker expression patterns during postnatal developmental stages, among humans and non-human primates. Furthermore, it reports findings from the recent literature investigating the plasticity behavior of germ cells and stem cells in other organs of humans and monkeys. The use of non-human primate models would enable bridging the knowledge gap in primate GSC research and understanding the mechanisms involved in germline development. Reported similarities in regulatory mechanisms and germ cell expression profile in primates demonstrate the preclinical significance of monkey models for development of

  7. Enterocin B3A-B3B produced by LAB collected from infant faeces: potential utilization in the food industry for Listeria monocytogenes biofilm management.

    Al-Seraih, Alaa; Belguesmia, Yanath; Baah, John; Szunerits, Sabine; Boukherroub, Rabah; Drider, Djamel

    2017-02-01

    Enterococcus faecalis B3A-B3B produces the bacteriocin B3A-B3B with activity against Listeria monocytogenes, Staphylococcus aureus, methicillin-resistant Staphylococcus aureus (MRSA) and Clostridium perfringens, but apparently not against fungi or Gram-negative bacteria, except for Salmonella Newport. B3A-B3B enterocin has two different nucleotides but similar amino acid composition to the class IIb MR10A-MR10B enterocin. B3A-B3B consists of two peptides of predicted molecular mass of 5176.31 Da (B3A) and 5182.21 Da (B3B). Importantly, B3A-B3B impeded biofilm formation of the foodborne pathogen L. monocytogenes 162 grown on stainless steel. The antimicrobial treatment of stainless steel with nisin (1 or 16 mg ml -1 ) decreased the cell numbers by about 2 log CFU ml -1 , thereby impeding the biofilm formation by L. monocytogenes 162 or its nisin-resistant derivative strain L. monocytogenes 162R. Furthermore, the combination of nisin and B3A-B3B enterocin reduced the MIC required to inhibit this pathogen grown in planktonic or biofilm cultures.

  8. Germline Variants of Prostate Cancer in Japanese Families.

    Takahide Hayano

    Full Text Available Prostate cancer (PC is the second most common cancer in men. Family history is the major risk factor for PC. Only two susceptibility genes were identified in PC, BRCA2 and HOXB13. A comprehensive search of germline variants for patients with PC has not been reported in Japanese families. In this study, we conducted exome sequencing followed by Sanger sequencing to explore responsible germline variants in 140 Japanese patients with PC from 66 families. In addition to known susceptibility genes, BRCA2 and HOXB13, we identified TRRAP variants in a mutually exclusive manner in seven large PC families (three or four patients per family. We also found shared variants of BRCA2, HOXB13, and TRRAP from 59 additional small PC families (two patients per family. We identified two deleterious HOXB13 variants (F127C and G132E. Further exploration of the shared variants in rest of the families revealed deleterious variants of the so-called cancer genes (ATP1A1, BRIP1, FANCA, FGFR3, FLT3, HOXD11, MUTYH, PDGFRA, SMARCA4, and TCF3. The germline variant profile provides a new insight to clarify the genetic etiology and heterogeneity of PC among Japanese men.

  9. Cell lineage analysis of the mammalian female germline.

    Yitzhak Reizel

    Full Text Available Fundamental aspects of embryonic and post-natal development, including maintenance of the mammalian female germline, are largely unknown. Here we employ a retrospective, phylogenetic-based method for reconstructing cell lineage trees utilizing somatic mutations accumulated in microsatellites, to study female germline dynamics in mice. Reconstructed cell lineage trees can be used to estimate lineage relationships between different cell types, as well as cell depth (number of cell divisions since the zygote. We show that, in the reconstructed mouse cell lineage trees, oocytes form clusters that are separate from hematopoietic and mesenchymal stem cells, both in young and old mice, indicating that these populations belong to distinct lineages. Furthermore, while cumulus cells sampled from different ovarian follicles are distinctly clustered on the reconstructed trees, oocytes from the left and right ovaries are not, suggesting a mixing of their progenitor pools. We also observed an increase in oocyte depth with mouse age, which can be explained either by depth-guided selection of oocytes for ovulation or by post-natal renewal. Overall, our study sheds light on substantial novel aspects of female germline preservation and development.

  10. Classical and quantum electrodynamics and the B(3) field

    Evans, Myron W

    2001-01-01

    It is well known that classical electrodynamics is riddled with internal inconsistencies springing from the fact that it is a linear, Abelian theory in which the potentials are unphysical. This volume offers a self-consistent hypothesis which removes some of these problems, as well as builds a framework on which linear and nonlinear optics are treated as a non-Abelian gauge field theory based on the emergence of the fundamental magnetizing field of radiation, the B(3) field. Contents: Interaction of Electromagnetic Radiation with One Fermion; The Field Equations of Classical O (3) b Electrodyn

  11. Lamination sheet of AA BST magnet

    CERN PhotoLab

    1979-01-01

    The AA had 2 types of bending magnets: BLG (window-frame, long and narrow)and BST (H-type, short and wide). The BST had a very wide aperture, 0.564 m of "good field". To demonstrate the size, the petite AA secretary, Val Mansfield, poses with a lamination sheet. See also 7811105, 7906163, 8006050.

  12. Laminated Root Rot of Western Conifers

    E.E. Nelson; N.E. Martin; R.E. Williams

    1981-01-01

    Laminated root rot is caused by the native fungus Phellinus weirii (Murr.) Gilb. It occurs throughout the Northwestern United States and in southern British Columbia, Canada. The disease has also been reported in Japan and Manchuria. In the United States, the pathogen is most destructive in pure Douglas-fir stands west of the crest of the Cascade Range in Washington...

  13. [Laminitis in cattle: a literature review].

    Lischer, C; Ossent, P

    1994-10-01

    Worldwide afflictions of the claws belong to the economically important diseases in dairy cattle. The significance of laminitis has gained importance in the last years since the condition is regarded as the most important predisposing factor for the development of lesions such as sole ulcer, white line disease and heel horn erosion. Apart from the clinical stages (acute, subacute, chronic, chronic-recurrent) there is also a subclinical form of laminitis which does not cause lameness. It is characterized by soft yellowish sole and heel horn with haemorrhages in the sole and along the white line. Laminitis is a multifactorial event in which nutrition, genetic disposition and the perinatal period, combined with the associated diseases of high-yielding cows, have a particular significance. Currently, two principally different hypotheses on the pathogenesis are discussed. The generally accepted theory bases on a disturbance in the microcirculation of the corium. According to the other theory the circulatory disturbances are secondary to changes which occur in the horn producing cells of the stratum basale of the epidermis. The predisposing factors and the pathogenesis of laminitis are discussed in the light of possible therapeutic and prophylactic measures.

  14. Nuclear Structures Surrounding Internal Lamin Invaginations

    Legartová, Soňa; Stixová, Lenka; Laur, O.; Kozubek, Stanislav; Sehnalová, Petra; Bártová, Eva

    2014-01-01

    Roč. 115, č. 3 (2014), s. 476-487 ISSN 0730-2312 R&D Projects: GA MŠk(CZ) LD11020 Institutional support: RVO:68081707 Keywords : LAMINS * NUCLEAR PORES * CHROMATIN Subject RIV: BO - Biophysics Impact factor: 3.263, year: 2014

  15. Doped LZO buffer layers for laminated conductors

    Paranthaman, Mariappan Parans [Knoxville, TN; Schoop, Urs [Westborough, MA; Goyal, Amit [Knoxville, TN; Thieme, Cornelis Leo Hans [Westborough, MA; Verebelyi, Darren T [Oxford, MA; Rupich, Martin W [Framingham, MA

    2010-03-23

    A laminated conductor includes a metallic substrate having a surface, a biaxially textured buffer layer supported by the surface of the substrate, the biaxially textured buffer layer comprising LZO and a dopant for mitigating metal diffusion through the LZO, and a biaxially textured conductor layer supported by the biaxially textured buffer layer.

  16. Tropicalized Lambda Lengths, Measured Laminations and Convexity

    C. Penner, R.

    This work uncovers the tropical analogue for measured laminations of the convex hull construction of decorated Teichmueller theory, namely, it is a study in coordinates of geometric degeneration to a point of Thurston's boundary for Teichmueller space. This may offer a paradigm for the extension ...

  17. Progressive delamination in polymer matrix composite laminates: A new approach

    Chamis, C. C.; Murthy, P. L. N.; Minnetyan, L.

    1992-01-01

    A new approach independent of stress intensity factors and fracture toughness parameters has been developed and is described for the computational simulation of progressive delamination in polymer matrix composite laminates. The damage stages are quantified based on physics via composite mechanics while the degradation of the laminate behavior is quantified via the finite element method. The approach accounts for all types of composite behavior, laminate configuration, load conditions, and delamination processes starting from damage initiation, to unstable propagation, and to laminate fracture. Results of laminate fracture in composite beams, panels, plates, and shells are presented to demonstrate the effectiveness and versatility of this new approach.

  18. Probing the germline-dependence of epigenetic inheritance using artificial insemination in mice

    Bohacek, Johannes; von Werdt, Sarah; Mansuy, Isabelle M.

    2016-01-01

    Abstract We developed a simple, noninvasive artificial insemination technique to study epigenetic germline inheritance in mice. This technique avoids interfering factors introduced by superovulation, surgery, in vitro culture or mating that can confound the transmission of acquired epigenetic information through the germline. Using a stress model, we demonstrate that our method is suited to test the causal involvement of the male germline in transmitting acquired information from father to offspring. PMID:29492284

  19. Parallel germline infiltration of a lentivirus in two Malagasy lemurs.

    Clément Gilbert

    2009-03-01

    Full Text Available Retroviruses normally infect the somatic cells of their host and are transmitted horizontally, i.e., in an exogenous way. Occasionally, however, some retroviruses can also infect and integrate into the genome of germ cells, which may allow for their vertical inheritance and fixation in a given species; a process known as endogenization. Lentiviruses, a group of mammalian retroviruses that includes HIV, are known to infect primates, ruminants, horses, and cats. Unlike many other retroviruses, these viruses have not been demonstrably successful at germline infiltration. Here, we report on the discovery of endogenous lentiviral insertions in seven species of Malagasy lemurs from two different genera -- Cheirogaleus and Microcebus. Combining molecular clock analyses and cross-species screening of orthologous insertions, we show that the presence of this endogenous lentivirus in six species of Microcebus is the result of one endogenization event that occurred about 4.2 million years ago. In addition, we demonstrate that this lentivirus independently infiltrated the germline of Cheirogaleus and that the two endogenization events occurred quasi-simultaneously. Using multiple proviral copies, we derive and characterize an apparently full length and intact consensus for this lentivirus. These results provide evidence that lentiviruses have repeatedly infiltrated the germline of prosimian species and that primates have been exposed to lentiviruses for a much longer time than what can be inferred based on sequence comparison of circulating lentiviruses. The study sets the stage for an unprecedented opportunity to reconstruct an ancestral primate lentivirus and thereby advance our knowledge of host-virus interactions.

  20. Fatigue and fracture of fibre metal laminates

    Alderliesten, René

    2017-01-01

    This book contributes to the field of hybrid technology, describing the current state of knowledge concerning the hybrid material concept of laminated metallic and composite sheets for primary aeronautical structural applications. It is the only book to date on fatigue and fracture of fibre metal laminates (FMLs). The first section of the book provides a general background of the FML technology, highlighting the major FML types developed and studied over the past decades in conjunction with an overview of industrial developments based on filed patents. In turn, the second section discusses the mechanical response to quasi-static loading, together with the fracture phenomena during quasi-static and cyclic loading. To consider the durability aspects related to strength justification and certification of primary aircraft structures, the third section discusses thermal aspects related to FMLs and their mechanical response to various environmental and acoustic conditions.

  1. Prediction of fatigue damage in tapered laminates

    Raeis Hosseiny, Seyed Aydin; Jakobsen, Johnny

    2017-01-01

    Effective implementation of ply-drops configurations substantially improve the damage tolerant design of flexible and aero-elastic wind turbine blades. Terminating a number of layers for an optimized blade design creates local bending effects. Inter-laminar stress states in tapered areas give rise...... to delamination and premature structural failure. Precise calculation of the stress levels for embedded ply-drops is required to predict failure initiation within acceptable limits. Multi-axial stress states in orthotropic laminates subjected to diverse loading mechanisms nucleate microscopic cracks....... By increasing the cracks density, damage occurs when residual material properties reduce to a critical level. Residual strength and stiffness of simple laminates are assigned in a set of fatigue failure criteria to assess the remaining life of the components by increasing number of loading cycles. The mode...

  2. Fabrication of CFRP/Al Active Laminates

    Asanuma, Hiroshi; Haga, Osamu; Ohira, Junichiro; Takemoto, Kyosuke; Imori, Masataka

    This paper describes fabrication and evaluation of the active laminate. It was made by hot-pressing of an aluminum plate as a high CTE material, a unidirectional CFRP prepreg as a low CTE material and an electric resistance heater, a KFRP prepreg as a low CTE material and an insulator between them, and copper foils as electrodes. In this study, fabricating conditions and performances such as curvature change and output force were examined. Under optimized fabricating conditions, it became clear that 1) the curvature of the active laminate linearly changes as a function of temperature, between room temperature and its hot pressing temperature without hysteresis by electric resistance heating of carbon fiber in the CFRP layer and cooling, and 2) the output force against a fixed punch almost linearly increases with increasing temperature during heating from 313K up to around the glass transition temperature of the epoxy matrix.

  3. Germ-line gene therapy and the medical imperative.

    Munson, Ronald; Davis, Lawrence H

    1992-06-01

    Somatic cell gene therapy has yielded promising results. If germ cell gene therapy can be developed, the promise is even greater: hundreds of genetic diseases might be virtually eliminated. But some claim the procedure is morally unacceptable. We thoroughly and sympathetically examine several possible reasons for this claim but find them inadequate. There is no moral reason, then, not to develop and employ germ-line gene therapy. Taking the offensive, we argue next that medicine has a prima facie moral obligation to do so.

  4. Laminated multilayer sheet structure and its utilization

    Chiba, K.; Itoh, K.; Mitani, Y.; Sobajima, S.; Yonemura, U.

    1980-01-01

    A laminated multilayer sheet structure is described comprising (A) an opaque flexible sheet layer, and (B) a flexible layer laminated on the surface of layer (A) and composed of a transparent thermic ray reflecting layer (B 1 ) bonded to a transparent synthetic resin layer (B 2 ), said layer (B 1 ) being a transparent thermic ray reflecting layer composed of (I) a layer of a metal having a thickness of about 50 to about 600 A, said metal being selected from the group consisting of gold, silver, copper, aluminum and a mixture of alloy of at least two of said metals, and (II) a high refractive substance layer having a thickness of about 50 to about 600 A, of an oxide of titanium derived from a layer of an organic titanium compound of the formula Ti 1 O/sub m/R/sub n/, where R is alkyl of 1-20 carbon atoms, l=1-30, m=4+3(1-1), and n=4+2(1-1), and containing the organic residual moiety of the organic titanium compound, the amount of said organic residual moiety being 0.1 to 30% by weight based on the weight of the high refractive substance layer; or said layer (B 1 ) being a transparent semiconductive layer having a thickness of about 500 to about 5,000 a and being composed of a compound selected from the group consisting of indium oxide, tin oxide, cadmium oxide, antimony oxide, copper iodide, and a mixture of at least two of said compounds. A method is described for heat-insulating a room, which comprises applying to the surface of a floor, wall, ceiling or partition in the room a laminated multilayer sheet structure comprising (A) an opaque flexible sheet layer, and (B) a flexible layer laminated on the surface of layer (A) and composed of a transparent thermic ray reflecting layer (B 1 ) bonded to a transparent synthetic resin layer

  5. Numerical analysis of laminated elastomer by FEM

    Mazda, T.; Shiojiri, H.

    1993-01-01

    A Computer code based on mixed finite element method was developed for three dimensional large strain analyses of laminated elastomers including nonlinear bulk stress vs. bulk strain relationships. The adopted element is the variable node element with maximum node numbers of 27 for displacements and 4 for pressures. At first, the displacements and pressures were calculated by the code using single element under various loading conditions. The results were compared with theoretical solutions and the both results' exactly coincided with each other. Next, the analyses of laminated elastomers subjected to axial loadings were conducted using both the new code and ABAQUS code, and the results were compared with the test results. The agreement of the results of the present code were better than ABAQUS code mainly due to the capability of handling wider range of material properties. Lastly, the shearing tests of laminated elastomers were simulated by the new code. The results were shown to be in good agreement with the test results. (author)

  6. Germline Hypermethylation of MLH1 and EPCAM Deletions Are a Frequent Cause of Lynch Syndrome

    Niessen, Renee C.; Hofstra, Robert M. W.; Westers, Helga; Ligtenberg, Marjolijn J. L.; Kooi, Krista; Jager, Paul O. J.; de Groote, Marloes L.; Dijkhuizen, Trijnie; Olderode-Berends, Maran J. W.; Hollema, Harry; Kleibeuker, Jan H.; Sijmons, Rolf H.

    It was shown that Lynch syndrome can be caused by germline hypermethylation of the MLH1 and MSH2 promoters. Furthermore, it has been demonstrated very recently that germline deletions of the 3' region of EPCAM cause transcriptional read-through which results in silencing of MSH2 by hypermethylation.

  7. Germline hypermethylation of MLH1 and EPCAM deletions are a frequent cause of Lynch syndrome.

    Niessen, R.C.; Hofstra, R.M.; Westers, H.; Ligtenberg, M.J.L.; Kooi, K.; Jager, P.O.; Groote, M.L. de; Dijkhuizen, T.; Olderode-Berends, M.J.; Hollema, H.; Kleibeuker, J.H.; Sijmons, R.H.

    2009-01-01

    It was shown that Lynch syndrome can be caused by germline hypermethylation of the MLH1 and MSH2 promoters. Furthermore, it has been demonstrated very recently that germline deletions of the 3' region of EPCAM cause transcriptional read-through which results in silencing of MSH2 by hypermethylation.

  8. Germline CDKN1B/p27Kip1 mutation in multiple endocrine neoplasia

    Georgitsi, Marianthi; Raitila, Anniina; Karhu, Auli; van der Luijt, Rob B.; Aalfs, Cora M.; Sane, Timo; Vierimaa, Outi; Mäkinen, Markus J.; Tuppurainen, Karoliina; Paschke, Ralph; Gimm, Oliver; Koch, Christian A.; Gündogdu, Sadi; Lucassen, Anneke; Tischkowitz, Marc; Izatt, Louise; Aylwin, Simon; Bano, Gul; Hodgson, Shirley; de Menis, Ernesto; Launonen, Virpi; Vahteristo, Pia; Aaltonen, Lauri A.

    2007-01-01

    Germline mutations in the MEN1 gene predispose to multiple endocrine neoplasia type 1 (MEN1) syndrome, but in up to 20-25% of clinical MEN1 cases, no MEN1 mutations can be found. Recently, a germline mutation in the CDKN1B gene, encoding p27(Kip1), was reported in one suspected MEN1 family with two

  9. Crystal growth of Li10B3O5

    Sugiyama, Akira; Gallagher, Hugh G.; Han, Thomas P.J.

    1999-09-01

    The growth of boron 10 isotope enriched L 10 BO (Li 10 B 3 O 5 ) optical crystal has been developed from Top-Seeded-Solution-Growth using a resistance furnace. In the preparation for growth materials, we have made further improvement on a charge loading technique to a crucible and succeeded in forming suitable high temperature flux for producing crystals. Adequate temperature gradient of 1K/cm inside the crucible was achieved from searching for a combination of setting temperatures in the vertical three-zone furnace and installing a ceramic ring under the crucible. We have also optimized seed holder configuration and established growth conditions by several attempts. As a result, two good quality L 10 BO crystals were produced with sizes of 14 x 25 x 22 mm and 13 x 10 x 12 mm from oriented seed crystals. Although these sizes were limited by the size of the crucible used, appropriate oriented samples were extracted for detailed studies in optical measurements. (author)

  10. Coxsackievirus B3 2A protease promotes encephalomyocarditis virus replication.

    Song, Qin-Qin; Lu, Ming-Zhi; Song, Juan; Chi, Miao-Miao; Sheng, Lin-Jun; Yu, Jie; Luo, Xiao-Nuan; Zhang, Lu; Yao, Hai-Lan; Han, Jun

    2015-10-02

    To determine whether 2A protease of the enterovirus genus with type I internal ribosome entry site (IRES) effect on the viral replication of type II IRES, coxsackievirus B3(CVB3)-encoded protease 2A and encephalomyocarditis virus (EMCV) IRES (Type II)-dependent or cap-dependent report gene were transiently co-expressed in eukaryotic cells. We found that CVB3 2A protease not only inhibited translation of cap-dependent reporter genes through the cleavage of eIF4GI, but also conferred high EMCV IRES-dependent translation ability and promoted EMCV replication. Moreover, deletions of short motif (aa13-18 RVVNRH, aa65-70 KNKHYP, or aa88-93 PRRYQSH) resembling the nuclear localization signals (NLS) or COOH-terminal acidic amino acid motif (aa133-147 DIRDLLWLEDDAMEQ) of CVB3 2A protease decreased both its EMCV IRES-dependent translation efficiency and destroy its cleavage on eukaryotic initiation factor 4G (eIF4G) I. Our results may provide better understanding into more effective interventions and treatments for co-infection of viral diseases. Copyright © 2015 Elsevier B.V. All rights reserved.

  11. LWR containment thermal hydraulic codes benchmark demona B3 exercise

    Della Loggia, E.; Gauvain, J.

    1988-01-01

    Recent discussion about the aerosol codes currently used for the analysis of containment retention capabilities have revealed a number of questions concerning the reliabilities and verifications of the thermal-hydraulic modules of these codes with respect to the validity of implemented physical models and the stability and effectiveness of numerical schemes. Since these codes are used for the calculation of the Source Term for the assessment of radiological consequences of severe accidents, they are an important part of reactor safety evaluation. For this reason the Commission of European Communities (CEC), following the recommendation mode by experts from Member Stades, is promoting research in this field with the aim also of establishing and increasing collaboration among Research Organisations of member countries. In view of the results of the studies, the CEC has decided to carry out a Benchmark exercise for severe accident containment thermal hydraulics codes. This exercise is based on experiment B3 in the DEMONA programme. The main objective of the benchmark exercise has been to assess the ability of the participating codes to predict atmosphere saturation levels and bulk condensation rates under conditions similar to those predicted to follow a severe accident in a PWR. This exercise follows logically on from the LA-4 exercise, which, is related to an experiment with a simpler internal geometry. We present here the results obtained so far and from them preliminary conclusions are drawn, concerning condensation temperature, pressure, flow rates, in the reactor containment

  12. Arteriographical and pathological changes in chronic laminitis in dairy cattle.

    Boosman, R; Nemeth, F; Gruys, E; Klarenbeek, A

    1989-07-01

    The arteriographic appearance of 76 bovine hind digits, obtained from a slaughterhouse, was related to the macroscopic signs of chronic laminitis in the digits. There were statistically significant correlations between the macroscopic and the arteriographic appearance of the claws. Subsequent histological examination of the radiographically abnormal arteries revealed features indicative of arteriosclerosis. The results of this study indicate that chronic laminitis develops following a subclinical attack of laminitis due to a continous hypoperfusion of the digit.

  13. Energy Saving Glass Lamination via Selective Radio-Frequency Heating

    Shulman, Holly S.; Allan, Shawn M.

    2009-11-11

    This Inventions and Innovations program supported the technical and commercial research and development needed to elevate Ceralink's energy saving process for flat glass lamination from bench scale to a self-supporting technology with significant potential for growth. Radio-frequency heating was any un-explored option for laminating glass prior to this program. With significant commercial success through time and energy savings in the wood, paper, and plastics industries, RF heating was found to have significant promise for the energy intensive glass lamination industry. A major technical goal of the program was to demonstrate RF lamination across a wide range of laminate sizes and materials. This was successfully accomplished, dispelling many skeptics' concerns about the abilities of the technology. Ceralink laminated panels up to 2 ft x 3 ft, with four sets processed simultaneously, in a 3 minute cycle. All major categories of interlayer materials were found to work with RF lamination. In addition to laminating glass, other materials including photovoltaic silicon solar cells, light emitting diodes, metallized glass, plastics (acrylic and polycarbonate), and ceramics (alumina) were found compatible with the RF process. This opens up a wide range of commercial opportunities beyond the initially targeted automotive industry. The dramatic energy savings reported for RF lamination at the bench scale were found to be maintained through the scale up of the process. Even at 2 ft x 3 ft panel sizes, energy savings are estimated to be at least 90% compared to autoclaving or vacuum lamination. With targeted promotion through conference presentations, press releases and internet presence, RF lamination has gained significant attention, drawing large audiences at American Ceramic Society meetings. The commercialization success of the project includes the establishment of a revenue-generating business model for providing process development and demonstrations for

  14. C. elegans germline-deficient mutants respond to pathogen infection using shared and distinct mechanisms.

    Michael TeKippe

    2010-07-01

    Full Text Available Reproduction extracts a cost in resources that organisms are then unable to utilize to deal with a multitude of environmental stressors. In the nematode C. elegans, development of the germline shortens the lifespan of the animal and increases its susceptibility to microbial pathogens. Prior studies have demonstrated germline-deficient nematodes to have increased resistance to gram negative bacteria. We show that germline-deficient strains display increased resistance across a broad range of pathogens including gram positive and gram negative bacteria, and the fungal pathogen Cryptococcus neoformans. Furthermore, we show that the FOXO transcription factor DAF-16, which regulates longevity and immunity in C. elegans, appears to be crucial for maintaining longevity in both wild-type and germline-deficient backgrounds. Our studies indicate that germline-deficient mutants glp-1 and glp-4 respond to pathogen infection using common and different mechanisms that involve the activation of DAF-16.

  15. Selfish genetic elements favor the evolution of a distinction between soma and germline.

    Johnson, Louise J

    2008-08-01

    Many multicellular organisms have evolved a dedicated germline. This can benefit the whole organism, but its advantages to genetic parasites have not been explored. Here I model the evolutionary success of a selfish element, such as a transposable element or endosymbiont, which is capable of creating or strengthening a germline-soma distinction in a primitively multicellular host, and find that it will always benefit the element to do so. Genes causing germline sequestration can therefore spread in a population even if germline sequestration is maladaptive for the host organism. Costly selfish elements are expected to survive only in sexual populations, so sexual species may experience an additional push toward germline-soma distinction, and hence toward cell differentiation and multicellularity.

  16. Immunoregulatory effect of evodiamine in mice of various germlines.

    Hu, Hai-Yan; Song, Zhao-Yang; Deng, Lan; Zhang, Mei-Xia

    2008-08-01

    The aim of this study was to investigate the effect of evodiamine on the proliferation and the immune function of thymocytes and splenocyte of mice from three germlines, which were 8 weeks old masculinity BALB/c, C57BL/6 and F1 hybridization mice. Cells of thymus and spleen were harvested and prepared as unicellular suspension. Cell proliferation was detected by MTT method, while the concentration of IL-2 was detected by ELISA, mRNA levels of bcl-2 and cdk2 in cells treated with evodiamine were detected by RT-PCR, the apoptosis rate and intracellular reactive oxygen species (ROS) concentration were analyzed by FCM, and the protein levels of BCL-2, CDK2 and BAX were determined by fluorescence microscope. The results indicated that at 0.5, 0.75 and 1 micromol/L, evodiamine inhibited the proliferation and externalization of thymocytes and splenocytes stimulated with ConA (p rate increased at a prolong period of time. After treatment with evodiamine for 24 and 48 hours, the cells were divided into two groups, one of which was negatively stained by 2 7-dichlorofluorescein (DCF), which indicated that ROS level decreased significantly in the dying cells. It is concluded that evodiamine inhibits proliferation and induces apoptosis of thymocytes and splenocytes from different germline mice, and at the same time decreases secretion of IL-2 through down-regulating bcl-2 and cdk2 levels.

  17. Foxn1[Cre] Expression in the Male Germline.

    Shi, Jianjun; Getun, Irina; Torres, Bivian; Petrie, Howard T

    2016-01-01

    Foxn1 (forkhead box N1), also known as the nude gene or winged-helix nude (Whn), is a forkhead transcription factor thought to be restricted to keratinocytes in the skin and thymus. Consistent with this tissue distribution, spontaneous or targeted mutation of Foxn1 results in the absence of both hair and a thymus. Genetic manipulation of the Foxn1 locus thus represents a powerful tool for tissue specific gene control in the skin and thymus, and tools such as Cre recombinase under control of the Foxn1 locus are widely used for this purpose. Unexpectedly, we show that Foxn1[Cre] exhibits unexpected activity in male germ cells, resulting in ubiquitous targeting of loxP-flanked alleles in all tissues in offspring from Foxn1[Cre] expressing male mice. Inheritance of recombined loxP alleles occurs independently of Cre inheritance (i.e., offspring lacking Cre nonetheless exhibit recombined alleles), suggesting that Foxn1[Cre] induced recombination in male germ cells must occur prior to meiosis in diploid germ cells. Together with previously published data, our results show that Foxn1, and alleles under its control, are expressed in the pre-meiotic male germline, revealing a new tool for germline targeting of genes, and raising important concerns for gender selection when using Foxn1 regulatory elements.

  18. In vitro cytotoxicity of nanoparticles in mammalian germline stem cells.

    Braydich-Stolle, Laura; Hussain, Saber; Schlager, John J; Hofmann, Marie-Claude

    2005-12-01

    Gametogenesis is a complex biological process that is particularly sensitive to environmental insults such as chemicals. Many chemicals have a negative impact on the germline, either by directly affecting the germ cells, or indirectly through their action on the somatic nursing cells. Ultimately, these effects can inhibit fertility, and they may have negative consequences for the development of the offspring. Recently, nanomaterials such as nanotubes, nanowires, fullerene derivatives (buckyballs), and quantum dots have received enormous national attention in the creation of new types of analytical tools for biotechnology and the life sciences. Despite the wide application of nanomaterials, there is a serious lack of information concerning their impact on human health and the environment. Thus, there are limited studies available on toxicity of nanoparticles for risk assessment of nanomaterials. The purpose of this study was to assess the suitability of a mouse spermatogonial stem cell line as a model to assess nanotoxicity in the male germline in vitro. The effects of different types of nanoparticles on these cells were evaluated by light microscopy, and by cell proliferation and standard cytotoxicity assays. Our results demonstrate a concentration-dependent toxicity for all types of particles tested, whereas the corresponding soluble salts had no significant effect. Silver nanoparticles were the most toxic while molybdenum trioxide (MoO(3)) nanoparticles were the least toxic. Our results suggest that this cell line provides a valuable model with which to assess the cytotoxicity of nanoparticles in the germ line in vitro.

  19. File list: Unc.Adl.10.AllAg.Germline_containing_young_adult [Chip-atlas[Archive

    Full Text Available Unc.Adl.10.AllAg.Germline_containing_young_adult ce10 Unclassified Adult Germline containing young adult... http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/assembled/Unc.Adl.10.AllAg.Germline_containing_young_adult.bed ...

  20. File list: His.Adl.05.AllAg.Germline_containing_young_adult [Chip-atlas[Archive

    Full Text Available His.Adl.05.AllAg.Germline_containing_young_adult ce10 Histone Adult Germline containing young adult...archive.biosciencedbc.jp/kyushu-u/ce10/assembled/His.Adl.05.AllAg.Germline_containing_young_adult.bed ...

  1. File list: Oth.Adl.05.AllAg.Germline_containing_young_adult [Chip-atlas[Archive

    Full Text Available Oth.Adl.05.AllAg.Germline_containing_young_adult ce10 TFs and others Adult Germline containing young adult....jp/kyushu-u/ce10/assembled/Oth.Adl.05.AllAg.Germline_containing_young_adult.bed ...

  2. File list: Unc.Adl.20.AllAg.Germline_containing_young_adult [Chip-atlas[Archive

    Full Text Available Unc.Adl.20.AllAg.Germline_containing_young_adult ce10 Unclassified Adult Germline containing young adult... http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/assembled/Unc.Adl.20.AllAg.Germline_containing_young_adult.bed ...

  3. File list: ALL.Adl.20.AllAg.Germline_containing_young_adult [Chip-atlas[Archive

    Full Text Available ALL.Adl.20.AllAg.Germline_containing_young_adult ce10 All antigens Adult Germline containing young adult...6563,SRX495065,SRX495061,SRX495102,SRX495062,SRX494887,SRX495066 http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/assembled/ALL.Adl.20.AllAg.Germline_containing_young_adult.bed ...

  4. File list: Unc.Adl.50.AllAg.Germline_containing_young_adult [Chip-atlas[Archive

    Full Text Available Unc.Adl.50.AllAg.Germline_containing_young_adult ce10 Unclassified Adult Germline containing young adult... http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/assembled/Unc.Adl.50.AllAg.Germline_containing_young_adult.bed ...

  5. File list: InP.Adl.05.AllAg.Germline_containing_young_adult [Chip-atlas[Archive

    Full Text Available InP.Adl.05.AllAg.Germline_containing_young_adult ce10 Input control Adult Germline containing young adult...X495065,SRX495061,SRX495042,SRX495102 http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/assembled/InP.Adl.05.AllAg.Germline_containing_young_adult.bed ...

  6. File list: Oth.Adl.20.AllAg.Germline_containing_young_adult [Chip-atlas[Archive

    Full Text Available Oth.Adl.20.AllAg.Germline_containing_young_adult ce10 TFs and others Adult Germline containing young adult....jp/kyushu-u/ce10/assembled/Oth.Adl.20.AllAg.Germline_containing_young_adult.bed ...

  7. File list: InP.Adl.10.AllAg.Germline_containing_young_adult [Chip-atlas[Archive

    Full Text Available InP.Adl.10.AllAg.Germline_containing_young_adult ce10 Input control Adult Germline containing young adult...X466563,SRX495065,SRX495061,SRX495102 http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/assembled/InP.Adl.10.AllAg.Germline_containing_young_adult.bed ...

  8. File list: His.Adl.10.AllAg.Germline_containing_young_adult [Chip-atlas[Archive

    Full Text Available His.Adl.10.AllAg.Germline_containing_young_adult ce10 Histone Adult Germline containing young adult...archive.biosciencedbc.jp/kyushu-u/ce10/assembled/His.Adl.10.AllAg.Germline_containing_young_adult.bed ...

  9. File list: Pol.Adl.20.AllAg.Germline_containing_young_adult [Chip-atlas[Archive

    Full Text Available Pol.Adl.20.AllAg.Germline_containing_young_adult ce10 RNA polymerase Adult Germline containing young adult... http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/assembled/Pol.Adl.20.AllAg.Germline_containing_young_adult.bed ...

  10. File list: His.Adl.20.AllAg.Germline_containing_young_adult [Chip-atlas[Archive

    Full Text Available His.Adl.20.AllAg.Germline_containing_young_adult ce10 Histone Adult Germline containing young adult...archive.biosciencedbc.jp/kyushu-u/ce10/assembled/His.Adl.20.AllAg.Germline_containing_young_adult.bed ...

  11. File list: InP.Adl.50.AllAg.Germline_containing_young_adult [Chip-atlas[Archive

    Full Text Available InP.Adl.50.AllAg.Germline_containing_young_adult ce10 Input control Adult Germline containing young adult...p/kyushu-u/ce10/assembled/InP.Adl.50.AllAg.Germline_containing_young_adult.bed ...

  12. File list: ALL.Adl.50.AllAg.Germline_containing_young_adult [Chip-atlas[Archive

    Full Text Available ALL.Adl.50.AllAg.Germline_containing_young_adult ce10 All antigens Adult Germline containing young adult...e.biosciencedbc.jp/kyushu-u/ce10/assembled/ALL.Adl.50.AllAg.Germline_containing_young_adult.bed ...

  13. File list: Pol.Adl.50.AllAg.Germline_containing_young_adult [Chip-atlas[Archive

    Full Text Available Pol.Adl.50.AllAg.Germline_containing_young_adult ce10 RNA polymerase Adult Germline containing young adult... http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/assembled/Pol.Adl.50.AllAg.Germline_containing_young_adult.bed ...

  14. File list: NoD.Adl.05.AllAg.Germline_containing_young_adult [Chip-atlas[Archive

    Full Text Available NoD.Adl.05.AllAg.Germline_containing_young_adult ce10 No description Adult Germline containing young adult... http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/assembled/NoD.Adl.05.AllAg.Germline_containing_young_adult.bed ...

  15. File list: Pol.Adl.05.AllAg.Germline_containing_young_adult [Chip-atlas[Archive

    Full Text Available Pol.Adl.05.AllAg.Germline_containing_young_adult ce10 RNA polymerase Adult Germline containing young adult... http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/assembled/Pol.Adl.05.AllAg.Germline_containing_young_adult.bed ...

  16. File list: NoD.Adl.10.AllAg.Germline_containing_young_adult [Chip-atlas[Archive

    Full Text Available NoD.Adl.10.AllAg.Germline_containing_young_adult ce10 No description Adult Germline containing young adult... http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/assembled/NoD.Adl.10.AllAg.Germline_containing_young_adult.bed ...

  17. File list: His.Adl.50.AllAg.Germline_containing_young_adult [Chip-atlas[Archive

    Full Text Available His.Adl.50.AllAg.Germline_containing_young_adult ce10 Histone Adult Germline containing young adult...osciencedbc.jp/kyushu-u/ce10/assembled/His.Adl.50.AllAg.Germline_containing_young_adult.bed ...

  18. File list: ALL.Adl.05.AllAg.Germline_containing_young_adult [Chip-atlas[Archive

    Full Text Available ALL.Adl.05.AllAg.Germline_containing_young_adult ce10 All antigens Adult Germline containing young adult...4871,SRX494938,SRX495065,SRX495061,SRX494933,SRX495042,SRX495102 http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/assembled/ALL.Adl.05.AllAg.Germline_containing_young_adult.bed ...

  19. File list: Oth.Adl.10.AllAg.Germline_containing_young_adult [Chip-atlas[Archive

    Full Text Available Oth.Adl.10.AllAg.Germline_containing_young_adult ce10 TFs and others Adult Germline containing young adult....jp/kyushu-u/ce10/assembled/Oth.Adl.10.AllAg.Germline_containing_young_adult.bed ...

  20. File list: Oth.Adl.50.AllAg.Germline_containing_young_adult [Chip-atlas[Archive

    Full Text Available Oth.Adl.50.AllAg.Germline_containing_young_adult ce10 TFs and others Adult Germline containing young adult....jp/kyushu-u/ce10/assembled/Oth.Adl.50.AllAg.Germline_containing_young_adult.bed ...

  1. File list: ALL.Adl.10.AllAg.Germline_containing_young_adult [Chip-atlas[Archive

    Full Text Available ALL.Adl.10.AllAg.Germline_containing_young_adult ce10 All antigens Adult Germline containing young adult...4938,SRX466563,SRX495065,SRX495061,SRX494933,SRX495102,SRX494887 http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/assembled/ALL.Adl.10.AllAg.Germline_containing_young_adult.bed ...

  2. File list: NoD.Adl.20.AllAg.Germline_containing_young_adult [Chip-atlas[Archive

    Full Text Available NoD.Adl.20.AllAg.Germline_containing_young_adult ce10 No description Adult Germline containing young adult... http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/assembled/NoD.Adl.20.AllAg.Germline_containing_young_adult.bed ...

  3. File list: NoD.Adl.50.AllAg.Germline_containing_young_adult [Chip-atlas[Archive

    Full Text Available NoD.Adl.50.AllAg.Germline_containing_young_adult ce10 No description Adult Germline containing young adult... http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/assembled/NoD.Adl.50.AllAg.Germline_containing_young_adult.bed ...

  4. File list: InP.Adl.20.AllAg.Germline_containing_young_adult [Chip-atlas[Archive

    Full Text Available InP.Adl.20.AllAg.Germline_containing_young_adult ce10 Input control Adult Germline containing young adult...X495061,SRX495102,SRX495062,SRX495066 http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/assembled/InP.Adl.20.AllAg.Germline_containing_young_adult.bed ...

  5. Energy Saving Glass Lamination via Selective Radio Frequency Heating

    Allan, Shawn M; Baranova, Inessa; Poley, Joseph; Reis, Henrique

    2012-02-27

    This project focused on advancing radio-frequency (RF) lamination technology closer to commercial implementation, in order to reduce the energy intensity of glass lamination by up to 90%. Lamination comprises a wide range of products including autoglass, architectural safety and innovative design glass, transparent armor (e.g. bullet proof glass), smart glass, mirrors, and encapsulation of photovoltaics. Lamination is also the fastest growing segment of glass manufacturing, with photovoltaics, architectural needs, and an anticipated transition to laminated side windows in vehicles. The state-of-the-art for glass lamination is to use autoclaves, which apply heat and uniform gas pressure to bond the laminates over the course of 1 to 18 hours. Laminates consist of layers of glass or other materials bonded with vinyl or urethane interlayers. In autoclaving, significant heat energy is lost heating the chamber, pressurized air, glass racks, and the glass. In RF lamination, the heat is generated directly in the vinyl interlayer, causing it to heat and melt quickly, in just 1 to 10 minutes, without significantly heating the glass or the equipment. The main purpose of this project was to provide evidence that low energy, rapid RF lamination quality met the same standards as conventionally autoclaved windows. The development of concepts for laminating curved glass with RF lamination was a major goal. Other primary goals included developing a stronger understanding of the lamination product markets described above, and to refine the potential benefits of commercial implementation. The scope of the project was to complete implementation concept studies in preparation for continuation into advanced development, pilot studies, and commercial implementation. The project consisted of 6 main tasks. The first dealt with lamination with poly-vinyl butyral (PVB) interlayers, which prior work had shown difficulties in achieving good quality laminates, working with Pilkington North

  6. Energy Saving Glass Lamination via Selective Radio Frequency Heating

    Allan, Shawn M.

    2012-02-27

    This project focused on advancing radio-frequency (RF) lamination technology closer to commercial implementation, in order to reduce the energy intensity of glass lamination by up to 90%. Lamination comprises a wide range of products including autoglass, architectural safety and innovative design glass, transparent armor (e.g. bullet proof glass), smart glass, mirrors, and encapsulation of photovoltaics. Lamination is also the fastest growing segment of glass manufacturing, with photovoltaics, architectural needs, and an anticipated transition to laminated side windows in vehicles. The state-of-the-art for glass lamination is to use autoclaves, which apply heat and uniform gas pressure to bond the laminates over the course of 1 to 18 hours. Laminates consist of layers of glass or other materials bonded with vinyl or urethane interlayers. In autoclaving, significant heat energy is lost heating the chamber, pressurized air, glass racks, and the glass. In RF lamination, the heat is generated directly in the vinyl interlayer, causing it to heat and melt quickly, in just 1 to 10 minutes, without significantly heating the glass or the equipment. The main purpose of this project was to provide evidence that low energy, rapid RF lamination quality met the same standards as conventionally autoclaved windows. The development of concepts for laminating curved glass with RF lamination was a major goal. Other primary goals included developing a stronger understanding of the lamination product markets described above, and to refine the potential benefits of commercial implementation. The scope of the project was to complete implementation concept studies in preparation for continuation into advanced development, pilot studies, and commercial implementation. The project consisted of 6 main tasks. The first dealt with lamination with poly-vinyl butyral (PVB) interlayers, which prior work had shown difficulties in achieving good quality laminates, working with Pilkington North

  7. Current perpendicular to plane giant magnetoresistance in laminated nanostructures

    Vedyayev, A.; Zhukov, I.; Dieny, B.

    2005-01-01

    We theoretically studied spin-dependent electron transport perpendicular-to-plain (CPP) in magnetic laminated multilayered structures by using Kubo formalism. We took into account not only bulk scattering, but the interface resistance due to both specular and diffuse reflection and also spin conserving and spin-flip processes. It was shown that spin-flip scattering at interfaces substantially reduces the value of giant magnetoresistance (GMR). This can explain the experimental observations that the CPP GMR ratio for laminated structures only slightly increases as compared to non-laminated ones even though lamination induces a significant increase in CPP resistance

  8. Germline contamination and leakage in whole genome somatic single nucleotide variant detection.

    Sendorek, Dorota H; Caloian, Cristian; Ellrott, Kyle; Bare, J Christopher; Yamaguchi, Takafumi N; Ewing, Adam D; Houlahan, Kathleen E; Norman, Thea C; Margolin, Adam A; Stuart, Joshua M; Boutros, Paul C

    2018-01-31

    The clinical sequencing of cancer genomes to personalize therapy is becoming routine across the world. However, concerns over patient re-identification from these data lead to questions about how tightly access should be controlled. It is not thought to be possible to re-identify patients from somatic variant data. However, somatic variant detection pipelines can mistakenly identify germline variants as somatic ones, a process called "germline leakage". The rate of germline leakage across different somatic variant detection pipelines is not well-understood, and it is uncertain whether or not somatic variant calls should be considered re-identifiable. To fill this gap, we quantified germline leakage across 259 sets of whole-genome somatic single nucleotide variant (SNVs) predictions made by 21 teams as part of the ICGC-TCGA DREAM Somatic Mutation Calling Challenge. The median somatic SNV prediction set contained 4325 somatic SNVs and leaked one germline polymorphism. The level of germline leakage was inversely correlated with somatic SNV prediction accuracy and positively correlated with the amount of infiltrating normal cells. The specific germline variants leaked differed by tumour and algorithm. To aid in quantitation and correction of leakage, we created a tool, called GermlineFilter, for use in public-facing somatic SNV databases. The potential for patient re-identification from leaked germline variants in somatic SNV predictions has led to divergent open data access policies, based on different assessments of the risks. Indeed, a single, well-publicized re-identification event could reshape public perceptions of the values of genomic data sharing. We find that modern somatic SNV prediction pipelines have low germline-leakage rates, which can be further reduced, especially for cloud-sharing, using pre-filtering software.

  9. Effect of BRCA germline mutations on breast cancer prognosis

    Baretta, Zora; Mocellin, Simone; Goldin, Elena; Olopade, Olufunmilayo I.; Huo, Dezheng

    2016-01-01

    Abstract Background: The contribution of BRCA germline mutational status to breast cancer patients’ prognosis is unclear. We aimed to systematically review and perform meta-analysis of the available evidence of effects of BRCA germline mutations on multiple survival outcomes of breast cancer patients as a whole and in specific subgroups of interest, including those with triple negative breast cancer, those with Ashkenazi Jewish ancestry, and patients with stage I–III disease. Methods: Sixty studies met all inclusion criteria and were considered for this meta-analysis. These studies involved 105,220 breast cancer patients, whose 3588 (3.4%) were BRCA mutations carriers. The associations between BRCA genes mutational status and overall survival (OS), breast cancer-specific survival (BCSS), recurrence-free survival (RFS), and distant metastasis-free survival (DMFS) were evaluated using random-effect models. Results: BRCA1 mutation carriers have worse OS than BRCA-negative/sporadic cases (hazard ratio, HR 1.30, 95% CI: 1.11–1.52) and worse BCSS than sporadic/BRCA-negative cases among patients with stage I–III breast cancer (HR 1.45, 95% CI: 1.01–2.07). BRCA2 mutation carriers have worse BCSS than sporadic/BRCA-negative cases (HR 1.29, 95% CI: 1.03–1.62), although they have similar OS. Among triple negative breast cancer, BRCA1/2 mutations carriers had better OS than BRCA-negative counterpart (HR 0.49, 95% CI: 0.26–0.92). Among Ashkenazi Jewish women, BRCA1/2 mutations carriers presented higher risk of death from breast cancer (HR 1.44, 95% CI: 1.05–1.97) and of distant metastases (HR 1.82, 95% CI: 1.05–3.16) than sporadic/BRCA-negative patients. Conclusion: Our results support the evaluation of BRCA mutational status in patients with high risk of harboring BRCA germline mutations to better define the prognosis of breast cancer in these patients. PMID:27749552

  10. The molecular anatomy of spontaneous germline mutations in human testes.

    Jian Qin

    2007-09-01

    Full Text Available The frequency of the most common sporadic Apert syndrome mutation (C755G in the human fibroblast growth factor receptor 2 gene (FGFR2 is 100-1,000 times higher than expected from average nucleotide substitution rates based on evolutionary studies and the incidence of human genetic diseases. To determine if this increased frequency was due to the nucleotide site having the properties of a mutation hot spot, or some other explanation, we developed a new experimental approach. We examined the spatial distribution of the frequency of the C755G mutation in the germline by dividing four testes from two normal individuals each into several hundred pieces, and, using a highly sensitive PCR assay, we measured the mutation frequency of each piece. We discovered that each testis was characterized by rare foci with mutation frequencies 10(3 to >10(4 times higher than the rest of the testis regions. Using a model based on what is known about human germline development forced us to reject (p < 10(-6 the idea that the C755G mutation arises more frequently because this nucleotide simply has a higher than average mutation rate (hot spot model. This is true regardless of whether mutation is dependent or independent of cell division. An alternate model was examined where positive selection acts on adult self-renewing Ap spermatogonial cells (SrAp carrying this mutation such that, instead of only replacing themselves, they occasionally produce two SrAp cells. This model could not be rejected given our observed data. Unlike the disease site, similar analysis of C-to-G mutations at a control nucleotide site in one testis pair failed to find any foci with high mutation frequencies. The rejection of the hot spot model and lack of rejection of a selection model for the C755G mutation, along with other data, provides strong support for the proposal that positive selection in the testis can act to increase the frequency of premeiotic germ cells carrying a mutation

  11. Human germline hedgehog pathway mutations predispose to fatty liver.

    Guillen-Sacoto, Maria J; Martinez, Ariel F; Abe, Yu; Kruszka, Paul; Weiss, Karin; Everson, Joshua L; Bataller, Ramon; Kleiner, David E; Ward, Jerrold M; Sulik, Kathleen K; Lipinski, Robert J; Solomon, Benjamin D; Muenke, Maximilian

    2017-10-01

    Non-alcoholic fatty liver disease (NAFLD) is the most common form of liver disease. Activation of hedgehog (Hh) signaling has been implicated in the progression of NAFLD and proposed as a therapeutic target; however, the effects of Hh signaling inhibition have not been studied in humans with germline mutations that affect this pathway. Patients with holoprosencephaly (HPE), a disorder associated with germline mutations disrupting Sonic hedgehog (SHH) signaling, were clinically evaluated for NAFLD. A combined mouse model of Hh signaling attenuation (Gli2 heterozygous null: Gli2 +/- ) and diet-induced NAFLD was used to examine aspects of NAFLD and hepatic gene expression profiles, including molecular markers of hepatic fibrosis and inflammation. Patients with HPE had a higher prevalence of liver steatosis compared to the general population, independent of obesity. Exposure of Gli2 +/- mice to fatty liver-inducing diets resulted in increased liver steatosis compared to wild-type mice. Similar to humans, this effect was independent of obesity in the mutant mice and was associated with decreased expression of pro-fibrotic and pro-inflammatory genes, and increased expression of PPARγ, a potent anti-fibrogenic and anti-inflammatory regulator. Interestingly, tumor suppressors p53 and p16INK4 were found to be downregulated in the Gli2 +/- mice exposed to a high-fat diet. Our results indicate that germline mutations disrupting Hh signaling promotes liver steatosis, independent of obesity, with reduced fibrosis. While Hh signaling inhibition has been associated with a better NAFLD prognosis, further studies are required to evaluate the long-term effects of mutations affecting this pathway. Lay summary: Non-alcoholic fatty liver disease (NAFLD) is characterized by excess fat deposition in the liver predominantly due to high calorie intake and a sedentary lifestyle. NAFLD progression is usually accompanied by activation of the Sonic hedgehog (SHH) pathway leading to fibrous

  12. Thermoelastic wave propagation in laminated composites plates

    Verma K. L.

    2012-12-01

    Full Text Available The dispersion of thermoelastic waves propagation in an arbitrary direction in laminated composites plates is studied in the framework of generalized thermoelasticity in this article. Three dimensional field equations of thermoelasticity with relaxation times are considered. Characteristic equation is obtained on employing the continuity of displacements, temperature, stresses and thermal gradient at the layers’ interfaces. Some important particular cases such as of free waves on reducing plates to single layer and the surface waves when thickness tends to infinity are also discussed. Uncoupled and coupled thermoelasticity are the particular cases of the obtained results. Numerical results are also obtained and represented graphically.

  13. Laminitis subclínica en bovinos

    Franco, M. S.; Oliver, O. J.

    2012-01-01

    La laminitis subclínica es una entidad multifactorial que afecta a los bovinos especialmente en el periodo del periparto. Se caracteriza por la coloración amarilla de la suela, hemorragias de la suela, separación de la línea blanca y erosiones de talón. Se considera que es el mayor factor predisponente para la presentación de cojeras de pezuña a causa del debilitamiento del tejido corneo de la misma, lo que comrpromete el bienestar del animal y acarrea perdidas económicas directas e indirecta...

  14. Effects of differently hardened brass foil laminate on the electromechanical property of externally laminated CC tapes

    Bautista, Zhierwinjay; Shin, Hyung Seop [Dept. of Mechanical Design Engineering, Andong National University, Andong (Korea, Republic of); Mean, Byoung Jean; Lee, Jae Hun [SuNAM Co Ltd., Anseong (Korea, Republic of)

    2016-12-15

    The mechanical properties of REBCO coated conductor (CC) wires under uniaxial tension are largely determined by the thick component layers in the architecture, namely, the substrate and the stabilizer or even the reinforcement layer. Depending on device applications of the CC tapes, it is necessary to reinforce thin metallic foils externally to one-side or both sides of the CC tapes. Due to the external reinforcement of brass foils, it was found that this could increase the reversible strain limit from the Cu-stabilized CC tapes. In this study, the effects of differently hardened brass foil laminate on the electromechanical property of CC tapes were investigated under uniaxial tension loading. The tensile strain dependence of the critical current (I{sub c}) was measured at 77 K and self-field. Depending on whether the I{sub c} of CC tapes were measured during loading or after unloading, a reversible strain (or stress) limit could be determined, respectively. The both-sides of the Cu-stabilized CC tapes were laminated with brass foils with different hardness, namely 1/4H, 1H and EH. From the obtained results, it showed that the yield strength of the brass laminated CC tapes with EH brass foil laminate was comparable to the one of the Cu-stabilized CC tape due to its large yield strength even though its large volume fraction. It was found that the brass foil with different hardness was mainly sensitive on the stress dependence of I{sub c}, but not on the strain sensitivity due to the residual strain induced in the laminated CC tapes during unloading.

  15. Wnt6 maintains anterior escort cells as an integral component of the germline stem cell niche.

    Wang, Xiaoxi; Page-McCaw, Andrea

    2018-02-07

    Stem cells reside in a niche, a local environment whose cellular and molecular complexity is still being elucidated. In Drosophila ovaries, germline stem cells depend on cap cells for self-renewing signals and physical attachment. Germline stem cells also contact the anterior escort cells, and here we report that anterior escort cells are absolutely required for germline stem cell maintenance. When escort cells die from impaired Wnt signaling or hid expression, the loss of anterior escort cells causes loss of germline stem cells. Anterior escort cells function as an integral niche component by promoting DE-cadherin anchorage and by transiently expressing the Dpp ligand to promote full-strength BMP signaling in germline stem cells. Anterior escort cells are maintained by Wnt6 ligands produced by cap cells; without Wnt6 signaling, anterior escort cells die leaving vacancies in the niche, leading to loss of germline stem cells. Our data identify anterior escort cells as constituents of the germline stem cell niche, maintained by a cap cell-produced Wnt6 survival signal. © 2018. Published by The Company of Biologists Ltd.

  16. Discordant gene expression signatures and related phenotypic differences in lamin A- and A/C-related Hutchinson-Gilford progeria syndrome (HGPS.

    Martina Plasilova

    Full Text Available Hutchinson-Gilford progeria syndrome (HGPS is a genetic disorder displaying features reminiscent of premature senescence caused by germline mutations in the LMNA gene encoding lamin A and C, essential components of the nuclear lamina. By studying a family with homozygous LMNA mutation (K542N, we showed that HGPS can also be caused by mutations affecting both isoforms, lamin A and C. Here, we aimed to elucidate the molecular mechanisms underlying the pathogenesis in both, lamin A- (sporadic and lamin A and C-related (hereditary HGPS. For this, we performed detailed molecular studies on primary fibroblasts of hetero- and homozygous LMNA K542N mutation carriers, accompanied with clinical examinations related to the molecular findings. By assessing global gene expression we found substantial overlap in altered transcription profiles (13.7%; 90/657 in sporadic and hereditary HGPS, with 83.3% (75/90 concordant and 16.7% (15/90 discordant transcriptional changes. Among the concordant ones we observed down-regulation of TWIST2, whose inactivation in mice and humans leads to loss of subcutaneous fat and dermal appendages, and loss of expression in dermal fibroblasts and periadnexial cells from a LMNA(K542N/K542N patient further confirming its pivotal role in skin development. Among the discordant transcriptional profiles we identified two key mediators of vascular calcification and bone metabolism, ENPP1 and OPG, which offer a molecular explanation for the major phenotypic differences in vascular and bone disease in sporadic and hereditary HGPS. Finally, this study correlates reduced TWIST2 and OPG expression with increased osteocalcin levels, thereby linking altered bone remodeling to energy homeostasis in hereditary HGPS.

  17. A MEMS lamination technology based on sequential multilayer electrodeposition

    Kim, Minsoo; Kim, Jooncheol; Herrault, Florian; Schafer, Richard; Allen, Mark G

    2013-01-01

    A MEMS lamination technology based on sequential multilayer electrodeposition is presented. The process comprises three main steps: (1) automated sequential electrodeposition of permalloy (Ni 80 Fe 20 ) structural and copper sacrificial layers to form multilayer structures of significant total thickness; (2) fabrication of polymeric anchor structures through the thickness of the multilayer structures and (3) selective removal of copper. The resulting structure is a set of air-insulated permalloy laminations, the separation of which is sustained by insulating polymeric anchor structures. Individual laminations have precisely controllable thicknesses ranging from 500 nm to 5 µm, and each lamination layer is electrically isolated from adjacent layers by narrow air gaps of similar scale. In addition to air, interlamination insulators based on polymers are investigated. Interlamination air gaps with very high aspect ratio (>1:100) can be filled with polyvinylalcohol and polydimethylsiloxane. The laminated structures are characterized using scanning electron microscopy and atomic force microscopy to directly examine properties such as the roughness and the thickness uniformity of the layers. In addition, the quality of the electrical insulation between the laminations is evaluated by quantifying the eddy current within the sample as a function of frequency. Fabricated laminations are comprised of uniform, smooth (surface roughness <100 nm) layers with effective electrical insulation for all layer thicknesses and insulator approaches studied. Such highly laminated structures have potential uses ranging from energy conversion to applications where composite materials with highly anisotropic mechanical or thermal properties are required. (paper)

  18. Hole-thru-laminate mounting supports for photovoltaic modules

    Wexler, Jason; Botkin, Jonathan; Culligan, Matthew; Detrick, Adam

    2015-02-17

    A mounting support for a photovoltaic module is described. The mounting support includes a pedestal having a surface adaptable to receive a flat side of a photovoltaic module laminate. A hole is disposed in the pedestal, the hole adaptable to receive a bolt or a pin used to couple the pedestal to the flat side of the photovoltaic module laminate.

  19. Self-heating forecasting for thick laminate specimens in fatigue

    Lahuerta, F.; Westphal, T.; Nijssen, R. P. L.

    2014-12-01

    Thick laminate sections can be found from the tip to the root in most common wind turbine blade designs. Obtaining accurate and reliable design data for thick laminates is subject of investigations, which include experiments on thick laminate coupons. Due to the poor thermal conductivity properties of composites and the material self-heating that occurs during the fatigue loading, high temperature gradients may appear through the laminate thickness. In the case of thick laminates in high load regimes, the core temperature might influence the mechanical properties, leading to premature failures. In the present work a method to forecast the self-heating of thick laminates in fatigue loading is presented. The mechanical loading is related with the laminate self-heating, via the cyclic strain energy and the energy loss ratio. Based on this internal volumetric heat load a thermal model is built and solved to obtain the temperature distribution in the transient state. Based on experimental measurements of the energy loss factor for 10mm thick coupons, the method is described and the resulting predictions are compared with experimental surface temperature measurements on 10 and 30mm UD thick laminate specimens.

  20. 78 FR 23591 - Certain Prepregs, Laminates, and Finished Circuit Boards

    2013-04-19

    ... INTERNATIONAL TRADE COMMISSION [Investigation No. 337-TA-659 (Enforcement)] Certain Prepregs... United States after importation of certain prepregs, laminates, and finished circuit boards that infringe... prepregs and laminates that are the subject of the investigation or that otherwise infringe, induce, and/or...

  1. Lateral testing of glued laminated timber tudor arch

    Douglas R. Rammer; Philip Line

    2016-01-01

    Glued laminated timber Tudor arches have been in wide use in the United States since the 1930s, but detailed knowledge related to seismic design in modern U.S. building codes is lacking. FEMA P-695 (P-695) is a methodology to determine seismic performance factors for a seismic force resisting system. A limited P-695 study for glued laminated timber arch structures...

  2. Bayesian inference model for fatigue life of laminated composites

    Dimitrov, Nikolay Krasimirov; Kiureghian, Armen Der; Berggreen, Christian

    2016-01-01

    A probabilistic model for estimating the fatigue life of laminated composite plates is developed. The model is based on lamina-level input data, making it possible to predict fatigue properties for a wide range of laminate configurations. Model parameters are estimated by Bayesian inference. The ...

  3. Nuclear lamins: laminopathies and their role in premature ageing

    Broers, J.L.V.; Ramaekers, F.C.S.; Bonne, G.; Yaou, R.; Hutchison, C.J.

    2006-01-01

    It has been demonstrated that nuclear lamins are important proteins in maintaining cellular as well as nuclear integrity, and in maintaining chromatin organization in the nucleus. Moreover, there is growing evidence that lamins play a prominent role in transcriptional control. The family of

  4. Optimum design of laminated composite under axial compressive load

    In the present study optimal design of composite laminates, with and without rectangular cut-out, is carried out for maximizing the buckling load. Optimization study is carried out for obtaining the maximum buckling load with design variables as ply thickness, cut-out size and orientation of cut-out with respect to laminate.

  5. Static and dynamic through thickness lamina properties of thick laminates

    Lahuerta, F.; Nijssen, R.P.L.; Van der Meer, F.P.; Sluys, L.J.

    2015-01-01

    Thick laminates are increasingly present in large composites structures such as wind turbine blades. Different factors are suspected to be involved in the decreased static and dynamic performance of thick laminates. These include the effect of self-heating, the scaling effect, and the manufacturing

  6. Laminated lumber may be more profitable than sawn lumber

    P. Koch

    1976-01-01

    By laminating 1/4-in. rotary-cut veneer into structural lumber, manufacturers can expand lumber output by at least 30% without increasing volume logged. The idea merits intensive study. Manufacturing plus raw material costs should total about $142/Mbf; sales price for desirable widths and lengths of the strong laminated product should approach or exceed $200/Mbf.

  7. Common germline polymorphisms associated with breast cancer-specific survival

    Pirie, Ailith; Guo, Qi; Kraft, Peter

    2015-01-01

    in the meta-analysis. Fifty-four of these were evaluated in the full set of 37,954 breast cancer cases with 2,900 events and the two additional variants were evaluated in a reduced sample size of 30,000 samples in order to ensure independence from the previously published studies. Five variants reached...... evaluated in the pooled analysis of over 37,000 breast cancer cases for association with breast cancer-specific survival. Previous associations were evaluated using a one-sided test based on the reported direction of effect. RESULTS: Fifty-six variants from 45 previous publications were evaluated......-specific survival using data from a pooled analysis of eight breast cancer survival genome-wide association studies (GWAS) from the Breast Cancer Association Consortium. METHODS: A literature review was conducted of all previously published associations between common germline variants and three survival outcomes...

  8. Lynch Syndrome Caused by Germline PMS2 Mutations

    Ten Broeke, Sanne W; Brohet, Richard M; Tops, Carli M

    2015-01-01

    PURPOSE: The clinical consequences of PMS2 germline mutations are poorly understood compared with other Lynch-associated mismatch repair gene (MMR) mutations. The aim of this European cohort study was to define the cancer risk faced by PMS2 mutation carriers. METHODS: Data were collected from 98...... PMS2 families ascertained from family cancer clinics that included a total of 2,548 family members and 377 proven mutation carriers. To adjust for potential ascertainment bias, a modified segregation analysis model was used to calculate colorectal cancer (CRC) and endometrial cancer (EC) risks....... Standardized incidence ratios (SIRs) were calculated to estimate risks for other Lynch syndrome-associated cancers. RESULTS: The cumulative risk (CR) of CRC for male mutation carriers by age 70 years was 19%. The CR among female carriers was 11% for CRC and 12% for EC. The mean age of CRC development was 52...

  9. Germline transformation of the Mediterranean fruit fly, Ceratitis capitata

    McCombs, Susan D.

    2000-01-01

    Gene transfer methodology for insects was first developed in Drosophila melanogaster Meigen using a transposon-mediated system based on the P element (Spradling and Rubin 1982, Rubin and Spradling 1982). In addition to the P element, three unrelated transposons have been used successfully in genetic transformation of D. melanogaster: hobo (Blackman et al. 1989), Minos (Loukeris et al. 1992), and mariner (Lidholm et al. 1993). Routine gene transfer in Drosophila created a great deal of optimism amongst researchers who sought to employ transgenic techniques in other arthropods. However, what followed were years of consistently disappointing results in other insect species. For example, the P element system was tried unsuccessfully in several species, but was eventually shown to be non-functional outside the genus Drosophila (O'Brochta and Handler 1988). Ensuing research in non-drosophilids emphasised testing of other Drosophila systems and development of transposons isolated from other species. After nearly 15 years of intensive effort, the first successes have only recently been reported. Three Drosophila-derived transposon-based systems: hobo from D. melanogaster, mariner from Drosophila mauritiana Tsacas and David and Minos from Drosophila hydei Sturtevant have produced germline transformation in Drosophila virilis Sturtevant (Gomez and Handler 1997, Lozovskaya et al. 1996), Aedes aegypti L. (Coates et al. 1998), and Ceratitis capitata (Wied.) (Loukeris et al. 1995), respectively. Germline transformation was accomplished with two transposon-based systems from non-drosophilids, Hermes from Musca domestica L. and piggyBac from Trichoplusia ni Huebner in A. aegypti and C. capitata, respectively

  10. Minimum weight design of composite laminates for multiple loads

    Krikanov, A.A.; Soni, S.R.

    1995-01-01

    A new design method of constructing optimum weight composite laminates for multiple loads is proposed in this paper. A netting analysis approach is used to develop an optimization procedure. Three ply orientations permit development of optimum laminate design without using stress-strain relations. It is proved that stresses in minimum weight laminate reach allowable values in each ply with given load. The optimum ply thickness is defined at maximum value among tensile and compressive loads. Two examples are given to obtain optimum ply orientations, thicknesses and materials. For comparison purposes, calculations of stresses are done in orthotropic material using classical lamination theory. Based upon these calculations, matrix degrades at 30 to 50% of ultimate load. There is no fiber failure and therefore laminates withstand all applied loads in both examples

  11. The mechanical behavior of GLARE laminates for aircraft structures

    Wu, Guocai; Yang, J.-M.

    2005-01-01

    GLARE (glass-reinforced aluminum laminate) is a new class of fiber metal laminates for advanced aerospace structural applications. It consists of thin aluminum sheets bonded together with unidirectional or biaxially reinforced adhesive prepreg of high-strength glass fibers. GLARE laminates offer a unique combination of properties such as outstanding fatigue resistance, high specific static properties, excellent impact resistance, good residual and blunt notch strength, flame resistance and corrosion properties, and ease of manufacture and repair. GLARE laminates can be tailored to suit a wide variety of applications by varying the fiber/resin system, the alloy type and thickness, stacking sequence, fiber orientation, surface pretreatment technique, etc. This article presents a comprehensive overview of the mechanical properties of various GLARE laminates under different loading conditions.

  12. Fatigue Performance of Composite Laminates After Low-velocity Impact

    LIANG Xiao-lin

    2016-12-01

    Full Text Available Compression-compression fatigue tests were carried out on T300/5405 composite laminates after low-velocity impact, compression performance of the laminates with different impact damages was studied together with its fatigue life and damage propagation under different stress levels, then the effects of impact energy, stress level and damage propagation on fatigue life of laminates were discussed. The results indicate that impact damage can greatly reduce the residual strength of laminates; under low fatigue load levels, the higher impact energy is, the shorter the fatigue life of laminates with impact damage will be; damage propagation undergoes two stages during the fatigue test, namely the steady propagation and the rapid propagation, accounting for 80% and 20% of the overall fatigue life, respectively; damage propagation rate decreases with the reduction of stress level.

  13. Up-regulated ephrinB3/EphB3 expression in intractable temporal lobe epilepsy patients and pilocarpine induced experimental epilepsy rat model.

    Huang, Hao; Li, Ruohan; Yuan, Jinxian; Zhou, Xin; Liu, Xi; Ou, Shu; Xu, Tao; Chen, Yangmei

    2016-05-15

    EphB family receptor tyrosine kinases, in cooperation with cell surface-bound ephrinB ligands, play a critical role in maintenance of dendritic spine morphogenesis, axons guidance, synaptogenesis, synaptic reorganization and plasticity in the central nervous system (CNS). However, the expression pattern of ephrinB/EphB in intractable temporal lobe epilepsy (TLE) and the underlying molecular mechanisms during epileptogenesis remain poorly understood. Here we investigated the expression pattern and cellular distribution of ephrinB/EphB in intractable TLE patients and lithium chloride-pilocarpine induced TLE rats using real-time quantitative polymerase chain reaction (RT-qPCR), immunohistochemistry, double-labeled immunofluorescence and Western blot analysis. Compared to control groups, ephrinB3 and EphB3 mRNA expression were significantly up-regulated in intractable TLE patients and TLE rats, while the mRNA expression trend of ephrinB1/2 and EphB1/2/4/6 in intractable TLE patients and TLE rats were inconsistent. Western blot analysis and semi-quantitative immunohistochemistry confirmed that ephrinB3 and EphB3 protein level were up-regulated in intractable TLE patients and TLE rats. At the same time, double-labeled immunofluorescence indicate that ephrinB3 was expressed mainly in the cytoplasm and protrusions of glia and neurons, while EphB3 was expressed mainly in the cytoplasm of neurons. Taken together, up-regulated expression of ephrinB3/EphB3 in intractable TLE patients and experimental TLE rats suggested that ephrinB3/EphB3 might be involved in the pathogenesis of TLE. Copyright © 2016 Elsevier B.V. All rights reserved.

  14. High Pressure Laminates with Antimicrobial Properties

    Sandra Magina

    2016-02-01

    Full Text Available High-pressure laminates (HPLs are durable, resistant to environmental effects and good cost-benefit decorative surface composite materials with special properties tailored to meet market demand. In the present work, polyhexamethylene biguanide (PHMB was incorporated for the first time into melamine-formaldehyde resin (MF matrix on the outer layer of HPLs to provide them antimicrobial properties. Chemical binding of PHMB to resin matrix was detected on the surface of produced HPLs by attenuated total reflection Fourier transform infrared spectroscopy (ATR-FTIR. Antimicrobial evaluation tests were carried out on the ensuing HPLs doped with PHMB against gram-positive Listeria innocua and gram-negative Escherichia coli bacteria. The results revealed that laminates prepared with 1.0 wt % PHMB in MF resin were bacteriostatic (i.e., inhibited the growth of microorganisms, whereas those prepared with 2.4 wt % PHMB in MF resin exhibited bactericidal activity (i.e., inactivated the inoculated microorganisms. The results herein reported disclose a promising strategy for the production of HPLs with antimicrobial activity without affecting basic intrinsic quality parameters of composite material.

  15. Numerical Investigation of Corrugated Wire Mesh Laminate

    Jeongho Choi

    2013-01-01

    Full Text Available The aim of this work is to develop a numerical model of Corrugated Wire Mesh Laminate (CWML capturing all its complexities such as nonlinear material properties, nonlinear geometry and large deformation behaviour, and frictional behaviour. Development of such a model will facilitate numerical simulation of the mechanical behaviour of the wire mesh structure under various types of loading as well as the variation of the CWML configuration parameters to tailor its mechanical properties to suit the intended application. Starting with a single strand truss model consisting of four waves with a bilinear stress-strain model to represent the plastic behaviour of stainless steel, the finite element model is gradually built up to study single-layer structures with 18 strands of corrugated wire meshes consistency and double- and quadruple-layered laminates with alternating crossply orientations. The compressive behaviour of the CWML model is simulated using contact elements to model friction and is compared to the load-deflection behaviour determined experimentally in uniaxial compression tests. The numerical model of the CWML is then employed to conduct the aim of establishing the upper and lower bounds of stiffness and load capacity achievable by such structures.

  16. Responsible innovation in human germline gene editing: Background document to the recommendations of ESHG and ESHRE

    de Wert, Guido; Heindryckx, Björn; Pennings, Guido; Clarke, Angus; Eichenlaub-Ritter, Ursula; van El, Carla G.; Forzano, Francesca; Goddijn, Mariëtte; Howard, Heidi C.; Radojkovic, Dragica; Rial-Sebbag, Emmanuelle; Dondorp, Wybo; Tarlatzis, Basil C.; Cornel, Martina C.

    2018-01-01

    Technological developments in gene editing raise high expectations for clinical applications, including editing of the germline. The European Society of Human Reproduction and Embryology (ESHRE) and the European Society of Human Genetics (ESHG) together developed a Background document and

  17. Germline and somatic mutations in the MTOR gene in focal cortical dysplasia and epilepsy

    Møller, Rikke S; Weckhuysen, Sarah; Chipaux, Mathilde

    2016-01-01

    OBJECTIVE: To assess the prevalence of somatic MTOR mutations in focal cortical dysplasia (FCD) and of germline MTOR mutations in a broad range of epilepsies. METHODS: We collected 20 blood-brain paired samples from patients with FCD and searched for somatic variants using deep-targeted gene panel...... sequencing. Germline mutations in MTOR were assessed in a French research cohort of 93 probands with focal epilepsies and in a diagnostic Danish cohort of 245 patients with a broad range of epilepsies. Data sharing among collaborators allowed us to ascertain additional germline variants in MTOR. RESULTS: We...... detected recurrent somatic variants (p.Ser2215Phe, p.Ser2215Tyr, and p.Leu1460Pro) in the MTOR gene in 37% of participants with FCD II and showed histologic evidence for activation of the mTORC1 signaling cascade in brain tissue. We further identified 5 novel de novo germline missense MTOR variants in 6...

  18. A germline FANCA alteration that is associated with increased sensitivity to DNA damaging agents.

    Wilkes, David C; Sailer, Verena; Xue, Hui; Cheng, Hongwei; Collins, Colin C; Gleave, Martin; Wang, Yuzhuo; Demichelis, Francesca; Beltran, Himisha; Rubin, Mark Andrew; Rickman, David S

    2017-01-01

    Defects in genes involved in DNA damage repair (DDR) pathway are emerging as novel biomarkers and targets for new prostate cancer drug therapies. A previous report revealed an association between an exceptional response to cisplatin treatment and a somatic loss of heterozygosity (LOH) of FANCA in a patient with metastatic prostate cancer who also harbored a germline FANCA variant (S1088F). Although germline FANCA mutations are the most frequent alterations in patients with Fanconi anemia, ger...

  19. Mechanical performance of laminated composites incorporated with nanofibrous membranes

    Liu, L.; Huang, Z.-M.; He, C.L.; Han, X.J.

    2006-01-01

    The effect of non-woven nanofibrous membranes as interlaminar interfaces on the mechanical performance of laminated composites was investigated experimentally. The nanofibrous membranes are porous, thin and lightweight, and exhibit toughness and strength to some extent. They give little increase in weight and thickness when incorporated into a laminate. More important, they can be used as a functional agent carrier for the laminate. The nanofiber membranes used in this paper were prepared by electrospinning of Nylon-6 (PA6), Epoxy 609 (EPO 1691-410) and thermoplastic polyurethane (TPU), with a thickness ranging from 20 to 150 μm. The non-woven fabrics were attached to one side of a glass/epoxy fabric lamina prior to lamination and each fabric was arranged in between two adjacent plies of the laminate. The nanofibrous membranes were characterized through scanning electron microscopy (SEM) and tensile testing, whereas the mechanical properties of the laminate were understood in terms of three-point bending and short-beam shear tests. Results have shown that the nanofibrous membranes in the ply interfaces with a proper thickness did not affect the mechanical performance of the composite laminates significantly

  20. Combined tension and bending testing of tapered composite laminates

    O'Brien, T. Kevin; Murri, Gretchen B.; Hagemeier, Rick; Rogers, Charles

    1994-11-01

    A simple beam element used at Bell Helicopter was incorporated in the Computational Mechanics Testbed (COMET) finite element code at the Langley Research Center (LaRC) to analyze the responce of tappered laminates typical of flexbeams in composite rotor hubs. This beam element incorporated the influence of membrane loads on the flexural response of the tapered laminate configurations modeled and tested in a combined axial tension and bending (ATB) hydraulic load frame designed and built at LaRC. The moments generated from the finite element model were used in a tapered laminated plate theory analysis to estimate axial stresses on the surface of the tapered laminates due to combined bending and tension loads. Surfaces strains were calculated and compared to surface strains measured using strain gages mounted along the laminate length. The strain distributions correlated reasonably well with the analysis. The analysis was then used to examine the surface strain distribution in a non-linear tapered laminate where a similarly good correlation was obtained. Results indicate that simple finite element beam models may be used to identify tapered laminate configurations best suited for simulating the response of a composite flexbeam in a full scale rotor hub.

  1. Effect of nanomodified polyester resin on hybrid sandwich laminates

    Anbusagar, NRR.; Giridharan, P.K.; Palanikumar, K.

    2014-01-01

    Highlights: • Effect of nanomodified polyester resin on hybrid sandwich laminates is evaluated. • The hybrid sandwich laminates are fabricated with varying wt% of nanoclay. • Flexural, impact and moisture absorbtion properties are evaluated for hybrid composites. • Scanning electron microscopy is utilized to analyze the dispersion of clay and fractured surfaces of the nanocomposites. - Abstract: Effect of nanoclay modified polyester resin on flexural, impact, hardness and water absorption properties of untreated woven jute and glass fabric hybrid sandwich laminates have been investigated experimentally. The hybrid sandwich laminates are prepared by hand lay-up manufacturing technique (HL) for investigation. All hybrid sandwich laminates are fabricated with a total of 10 layers, by varying the extreme layers and wt% of nanoclay in polyester resin so as to obtain four different combinations of hybrid sandwich laminates. For comparison of the composite with hybrid composite, jute fiber reinforced composite laminate also fabricated. X-ray diffraction (XRD) results obtained from samples with nanoclay indicated that intergallery spacing of the layered clay increases with matrix. Scanning electron microscopy (SEM) gave a morphological picture of the cross-sections and energy dispersive X-ray spectroscopy (EDS) allowed investigating the elemental composition of matrix in composites. The testing results indicated that the flexural properties are greatly increased at 4% of nanoclay loading while impact, hardness and water absorption properties are increased at 6% of nanoclay loading. A plausible explanation for high increase of properties has also been discussed

  2. Formaldehyde and TVOC emission behavior of laminate flooring by structure of laminate flooring and heating condition.

    An, Jae-Yoon; Kim, Sumin; Kim, Hyun-Joong

    2011-03-15

    Formaldehyde was measured with a desiccator, a 20 L chamber and the FLEC method. The formaldehyde emission rate from laminate was the highest at 32 °C using the desiccator, which then decreased with time. The formaldehyde emission using the 20 L small chamber and FLEC showed a similar tendency. There was a strong correlation between the formaldehyde and total volatile organic compounds (TVOCs) with both types of floorings using the two different methods. The formaldehyde emission rate and TVOC results were higher when tested using the FLEC method than with the 20 L small chamber method. The emission rate was affected by the joint edge length in laminate flooring. Toluene, ethylbenzene and xylene were the main VOCs emitted from laminate flooring, and there were more unidentified VOCs emitted than identified VOCs. The samples heated with a floor heating system emitted more formaldehyde than those heated using an air circulation system due to the temperature difference between the bottom panel and flooring. The TVOC emission level of the samples was higher when an air circulation system was used than when a floor heating system was used due to the high ventilation rate. Copyright © 2010 Elsevier B.V. All rights reserved.

  3. LamLum : a tool for evaluating the financial feasibility of laminated lumber plants

    E.M. (Ted) Bilek; John F. Hunt

    2006-01-01

    A spreadsheet-based computer program called LamLum was created to analyze the economics of value- added laminated lumber manufacturing facilities. Such facilities manufacture laminations, typically from lower grades of structural lumber, then glue these laminations together to make various types of higher value laminated lumber products. This report provides the...

  4. Aesthetic Qualities of Cross Laminated Timber

    Bejder, Anne Kirkegaard

    to its sustainable profile. In parallel to this, new production methods and further refined timber products have been developed. Among these are the engineered timber-based product Cross Laminated Timber (CLT) that show enhanced structural properties compared to unrefined timber. However, the question...... an undefined aesthetic potential that may innovate how we construct and perceive timber architecture, the overall aim of the thesis is to inquire into the architectural and aesthetic qualities of CLT. Through three chapters this thesis examines and discusses 1) the architectural qualities of CLT, 2......) the materiality of CLT, and 3) how one can deal with these qualitative aspects in the design process. This leads to: firstly, the development of an explicit model to help structuring the analysis and evaluation of the materiality of CLT, and secondly, a clarification and articulation of the aesthetic qualities...

  5. Permeability After Impact Testing of Composite Laminates

    Nettles, Alan T.

    2003-01-01

    Since composite laminates are beginning to be identified for use in reusable launch vehicle propulsion systems, an understanding of their permeance is needed. A foreign object impact event can cause a localized area of permeability (leakage) in a polymer matrix composite and it is the aim of this study to assess a method of quantifying permeability-after-impact results. A simple test apparatus is presented and variables that could affect the measured values of permeability-after-impact were assessed. Once it was determined that valid numbers were being measured, a fiber/resin system was impacted at various impact levels and the resulting permeability measured, first with a leak check solution (qualitative) then using the new apparatus (quantitative). The results showed that as the impact level increased, so did the measured leakage. As the pressure to the specimen was increased, the leak rate was seen to increase in a non-linear fashion for almost all of the specimens tested.

  6. Germline progenitors escape the widespread phenomenon of homolog pairing during Drosophila development.

    Eric F Joyce

    Full Text Available Homolog pairing, which plays a critical role in meiosis, poses a potential risk if it occurs in inappropriate tissues or between nonallelic sites, as it can lead to changes in gene expression, chromosome entanglements, and loss-of-heterozygosity due to mitotic recombination. This is particularly true in Drosophila, which supports organismal-wide pairing throughout development. Discovered over a century ago, such extensive pairing has led to the perception that germline pairing in the adult gonad is an extension of the pairing established during embryogenesis and, therefore, differs from the mechanism utilized in most species to initiate pairing specifically in the germline. Here, we show that, contrary to long-standing assumptions, Drosophila meiotic pairing in the gonad is not an extension of pairing established during embryogenesis. Instead, we find that homologous chromosomes are unpaired in primordial germ cells from the moment the germline can be distinguished from the soma in the embryo and remain unpaired even in the germline stem cells of the adult gonad. We further establish that pairing originates immediately after the stem cell stage. This pairing occurs well before the initiation of meiosis and, strikingly, continues through the several mitotic divisions preceding meiosis. These discoveries indicate that the spatial organization of the Drosophila genome differs between the germline and the soma from the earliest moments of development and thus argue that homolog pairing in the germline is an active process as versus a passive continuation of pairing established during embryogenesis.

  7. Study of the Formability of Laminated Lightweight Metallic Materials

    Girjob Claudia

    2017-01-01

    Full Text Available The main objective of this work was to test the formability of laminated materials. Laminated materials are considered a good choice when parts with reduced weight are considered. Thus, a laminated material, aluminum - polypropylene - aluminum (Al-PP-Al, as sheet 1.2 mm and 1.4 mm thickness was used. Before processing the material by means of unconventional plastic deformation, its formability was determined by running the Nakajima test. After obtaining the forming limit curves, the material was machined by means of incremental forming.

  8. Modeling delamination of FRP laminates under low velocity impact

    Jiang, Z.; Wen, H. M.; Ren, S. L.

    2017-09-01

    Fiber reinforced plastic laminates (FRP) have been increasingly used in various engineering such as aeronautics, astronautics, transportation, naval architecture and their impact response and failure are a major concern in academic community. A new numerical model is suggested for fiber reinforced plastic composites. The model considers that FRP laminates has been constituted by unidirectional laminated plates with adhesive layers. A modified adhesive layer damage model that considering strain rate effects is incorporated into the ABAQUS / EXPLICIT finite element program by the user-defined material subroutine VUMAT. It transpires that the present model predicted delamination is in good agreement with the experimental results for low velocity impact.

  9. Laminated Ti-Al composites: Processing, structure and strength

    Du, Yan; Fan, Guohua; Yu, Tianbo

    2016-01-01

    Laminated Ti-Al composite sheets with different layer thickness ratios have been fabricated through hot pressing followed by multi-pass hot rolling at 500 °C.The laminated sheets show strong bonding with intermetallic interface layers of nanoscale thickness between the layers of Ti and Al....... The mechanical properties of the composites with different volume fractions of Al from 10% to 67% show a good combination of strength and ductility. A constraint strain in the hot-rolled laminated structure between the hard and soft phases introduces an elastic-plastic deformation stage, which becomes more...

  10. Interaction with epsin 1 regulates the constitutive clathrin-dependent internalization of ErbB3.

    Szymanska, Monika; Fosdahl, Anne Marthe; Raiborg, Camilla; Dietrich, Markus; Liestøl, Knut; Stang, Espen; Bertelsen, Vibeke

    2016-06-01

    In contrast to other members of the EGF receptor family, ErbB3 is constitutively internalized in a clathrin-dependent manner. Previous studies have shown that ErbB3 does not interact with the coated pit localized adaptor complex 2 (AP-2), and that ErbB3 lacks two AP-2 interacting internalization signals identified in the EGF receptor. Several other clathrin-associated sorting proteins which may recruit cargo into coated pits have, however, been identified, and the study was performed to identify adaptors needed for constitutive internalization of ErbB3. A high-throughput siRNA screen was used to identify adaptor proteins needed for internalization of ErbB3. Upon knock-down of candidate proteins internalization of ErbB3 was identified using an antibody-based internalization assay combined with automatic fluorescence microscopy. Among 29 candidates only knock-down of epsin 1 turned out to inhibit ErbB3. Epsin 1 has ubiquitin interacting motifs (UIMs) and we show that ErbB3 interacts with an epsin 1 deletion mutant containing these UIMs. In support of an ErbB3-epsin 1 UIM dependent interaction, we show that ErbB3 is constitutively ubiquitinated, but that both ubiquitination and the ErbB3-epsin 1 interaction increase upon ligand binding. Altogether the results are consistent with a model whereby both constitutive and ligand-induced internalization of ErbB3 are regulated through interaction with epsin 1. Internalization is an important regulator of growth factor receptor mediated signaling and the current study identify mechanisms regulating plasma membrane turnover of ErbB3. Copyright © 2016 Elsevier B.V. All rights reserved.

  11. Germline transformation of the western corn rootworm, Diabrotica virgifera virgifera.

    Chu, F; Klobasa, W; Wu, P; Pinzi, S; Grubbs, N; Gorski, S; Cardoza, Y; Lorenzen, M D

    2017-08-01

    The western corn rootworm (WCR), a major pest of maize, is notorious for rapidly adapting biochemically, behaviourally and developmentally to a variety of control methods. Despite much effort, the genetic basis of WCR adaptation remains a mystery. Since transformation-based applications such as transposon tagging and enhancer trapping have facilitated genetic dissection of model species such as Drosophila melanogaster, we developed a germline-transformation system for WCR in an effort to gain a greater understanding of the basic biology of this economically important insect. Here we report the use of a fluorescent-marked Minos element to create transgenic WCR. We demonstrate that the transgenic strains express both an eye-specific fluorescent marker and piggyBac transposase. We identified insertion-site junction sequences via inverse PCR and assessed insertion copy number using digital droplet PCR (ddPCR). Interestingly, most WCR identified as transgenic via visual screening for DsRed fluorescence proved to carry multiple Minos insertions when tested via ddPCR. A total of eight unique insertion strains were created by outcrossing the initial transgenic strains to nontransgenic WCR mates. Establishing transgenic technologies for this beetle is the first step towards bringing a wide range of transformation-based tools to bear on understanding WCR biology. © 2017 The Royal Entomological Society.

  12. In vitro propagation of male germline stem cells from piglets.

    Zheng, Yi; Tian, Xiue; Zhang, Yaqing; Qin, Jinzhou; An, Junhui; Zeng, Wenxian

    2013-07-01

    To study the effects of serum and growth factors on propagation of porcine male germline stem cells (MGSCs) in vitro and develop a culture system for these stem cells. Fresh testicular cells from neonatal piglets were obtained by mechanical dissociation and collagenase-trypsin digestion. After differential plating, non-adhering cells were cultured in media supplemented with different concentrations of serum (0, 1 %, 2 %, 5 %, 10 %). After 10 days of primary culture, the cells were maintained in media supplemented with different concentrations of growth factors (basic fibroblast growth factor and epidermal growth factor at 1, 5, 10 ng/ml). The number of MGSC-derived colonies with different sizes was determined in each treatment to assess the effects of serum concentrations and growth factors. The number of MGSC-derived colonies was significantly higher in the presence of 1 % rather than 10 % fetal bovine serum (FBS). Basic fibroblast growth factor (bFGF) at 1, 5 ng/ml and epidermal growth factor (EGF) at 5, 10 ng/ml significantly promoted colony formation. Immunocytochemistry, reverse transcriptase-polymerase chain reaction (RT-PCR) and xenotransplantation assays demonstrated the presence of functional stem cells in cultured cell population. In vitro propagation of porcine MGSCs could be maintained in the presence of 1 % FBS and supplementation of growth factors for 1 month.

  13. Germline-specific H1 variants: the "sexy" linker histones.

    Pérez-Montero, Salvador; Carbonell, Albert; Azorín, Fernando

    2016-03-01

    The eukaryotic genome is packed into chromatin, a nucleoprotein complex mainly formed by the interaction of DNA with the abundant basic histone proteins. The fundamental structural and functional subunit of chromatin is the nucleosome core particle, which is composed by 146 bp of DNA wrapped around an octameric protein complex formed by two copies of each core histone H2A, H2B, H3, and H4. In addition, although not an intrinsic component of the nucleosome core particle, linker histone H1 directly interacts with it in a monomeric form. Histone H1 binds nucleosomes near the exit/entry sites of linker DNA, determines nucleosome repeat length and stabilizes higher-order organization of nucleosomes into the ∼30 nm chromatin fiber. In comparison to core histones, histone H1 is less well conserved through evolution. Furthermore, histone H1 composition in metazoans is generally complex with most species containing multiple variants that play redundant as well as specific functions. In this regard, a characteristic feature is the presence of specific H1 variants that replace somatic H1s in the germline and during early embryogenesis. In this review, we summarize our current knowledge about their structural and functional properties.

  14. Tensile strength of glulam laminations of Nordic spruce

    Hoffmeyer, Preben; Bräuner, Lise; Boström, Lars

    1999-01-01

    Design of glulam according to the European timber code Eurocode 5 is based on the standard document prEN1194 , according to which glulam beam strength is to be established either by full scale testing or by calculation. The calculation must be based on a knowledge of lamination tensile strength....... This knowledge may be obtained either by adopting a general rule that the characteristic tensile strength is sixty percent of the characteristic bending strength, or by performing tensile tests on an adequate number of laminations representative of the whole population. The present paper presents...... an investigation aimed at establishing such an adequate experimental background for the assignment of strength classes for glulam made of visually strength graded laminations from Nordic sawmills. The investigation includes more than 1800 boards (laminations) of Norway spruce (Picea abies) sampled from eight...

  15. Fatigue damage mechanics of notched graphite-epoxy laminates

    Spearing, Mark; Beaumont, Peter W. R.; Ashby, Michael F.

    A modeling approach is presented that recognizes that the residual properties of composite laminates after any form of loading depend on the damage state. Therefore, in the case of cyclic loading, it is necessary to first derive a damage growth law and then relate the residual properties to the accumulated damage. The propagation of fatigue damage in notched laminates is investigated. A power law relationship between damage growth and the strain energy release rate is developed. The material constants used in the model have been determined in independent experiments and are invariant for all the layups investigated. The strain energy release rates are calculated using a simple finite element representation of the damaged specimen. The model is used to predict the effect of tension-tension cyclic loading on laminates of the T300/914C carbon-fiber epoxy system. The extent of damage propagation is successfully predicted in a number of cross-ply laminates.

  16. Climbing ripple structure and associated storm-lamination from a ...

    Pranhita–Godavari Valley, south India, displays well developed climbing ripple lamination and ... sedimentary environments, such as river flood .... Sediment, sequence and facies ..... tic Archaean Witwatersrand Supergroup, South Africa;.

  17. Finite elements modeling of delaminations in composite laminates

    Gaiotti, m.; Rizzo, C.M.; Branner, Kim

    2011-01-01

    of the buckling strength of composite laminates containing delaminations. Namely, non-linear buckling and post-buckling analyses are carried out to predict the critical buckling load of elementary composite laminates affected by rectangular delaminations of different sizes and locations, which are modelled......The application of composite materials in many structures poses to engineers the problem to create reliable and relatively simple methods, able to estimate the strength of multilayer composite structures. Multilayer composites, like other laminated materials, suffer from layer separation, i.......e., delaminations, which may affect the stiffness and stability of structural components. Especially deep delaminations in the mid surface of laminates are expected to reduce the effective flexural stiffness and lead to collapse, often due to buckling behaviour. This paper deals with the numerical modelling...

  18. Pliocene benthonic foraminifera from homogeneous and laminated marls on Crete

    Jonkers, H.A.

    1984-01-01

    In the Pliocene, the paleogeography of central Crete consisted of a number of basins which were filled by predominantly marly sediments. In the sedimentary sequence numerous laminated sapropelic intercalations can be observed. At a higher stratigraphic level diatomaceous laminites appear.

  19. Modal analysis of pre and post impacted nano composite laminates

    R. Velmurugan

    Full Text Available Modal analysis is carried out on pre and post impacted nano composite laminates. The laminates are prepared using 3, 5 and 8 layers of 610gsm glass woven roving mats(WRM with epoxy resin and montmorillonite(MMT clay content is varied from 1% to 5%. Impulse hammer technique is used to find natural frequency and damping factor of laminates. Medium velocity impact tests are conducted by using a gas gun. The vibration responses of natural frequency and damping factor are obtained and are studied for laminates with all edges clamped boundary conditions. Results show considerable improvement in natural frequency and damping factor due to nano clay addition. It is also seen that the nano clay controls the delamination due to impact loading.

  20. Three-dimensional free vibration analysis of thick laminated circular ...

    Dr Oke

    1 ,2 Department of Mechanical Engineering, Maulana Azad National Institute of Technology, Bhopal-462003, INDIA ... In this communication, a numerical analysis regarding free vibration of thick laminated .... ANSYS finite element software.

  1. Exploration of the Germline Genome of the Ciliate Chilodonella uncinata through Single-Cell Omics (Transcriptomics and Genomics

    Xyrus X. Maurer-Alcalá

    2018-01-01

    Full Text Available Separate germline and somatic genomes are found in numerous lineages across the eukaryotic tree of life, often separated into distinct tissues (e.g., in plants, animals, and fungi or distinct nuclei sharing a common cytoplasm (e.g., in ciliates and some foraminifera. In ciliates, germline-limited (i.e., micronuclear-specific DNA is eliminated during the development of a new somatic (i.e., macronuclear genome in a process that is tightly linked to large-scale genome rearrangements, such as deletions and reordering of protein-coding sequences. Most studies of germline genome architecture in ciliates have focused on the model ciliates Oxytricha trifallax, Paramecium tetraurelia, and Tetrahymena thermophila, for which the complete germline genome sequences are known. Outside of these model taxa, only a few dozen germline loci have been characterized from a limited number of cultivable species, which is likely due to difficulties in obtaining sufficient quantities of “purified” germline DNA in these taxa. Combining single-cell transcriptomics and genomics, we have overcome these limitations and provide the first insights into the structure of the germline genome of the ciliate Chilodonella uncinata, a member of the understudied class Phyllopharyngea. Our analyses reveal the following: (i large gene families contain a disproportionate number of genes from scrambled germline loci; (ii germline-soma boundaries in the germline genome are demarcated by substantial shifts in GC content; (iii single-cell omics techniques provide large-scale quality germline genome data with limited effort, at least for ciliates with extensively fragmented somatic genomes. Our approach provides an efficient means to understand better the evolution of genome rearrangements between germline and soma in ciliates.

  2. Subclinical Laminitis in Dairy Cattle: 205 Selected Cases

    BAKIR, Ali BELGE Bahtiyar

    2005-01-01

    The economic importance of lameness in dairy cattle has newly been recognized in Turkey. Lameness incidence in Turkey has been reported to be between 13% and 58%, which is similar to that of other countries where 4% and 55% incidence rates have been reported. The objective of this study was to determine the prevalence of sole lesions associated with subclinical laminitis in the hooves of dairy cattle in Van, Turkey. The risk factors for subclinical laminitis are proposed and discussed. The so...

  3. Dowelled structural connections in laminated bamboo and timber

    Reynolds, Thomas Peter; Sharma, Bhavna; Harries, Kent; Ramage, Michael Hector

    2015-01-01

    Structural sections of laminated bamboo can be connected using methods common in timber engineering, however the different material properties of timber and laminated bamboo suggest that the behaviour of connections in the two materials would not be the same. This study investigates the dowelled connection, in which a connector is passed through a hole in the material, and load is resisted by shear in the connector and embedment into the surrounding material. Steel dowels were used in a conne...

  4. Laminitis in a mature elk hind (Cervus elaphus)

    Gray, Heather E.; Card, Claire; Baptiste, Keith E.

    2001-01-01

    Laminitis should be considered as a differential diagnosis in elk presenting with shifting leg lameness, reluctance to move, recumbency and hoof wall ridging. Eliminating the underlying cause and corrective trimming lead to a good prognosis for recovery.......Laminitis should be considered as a differential diagnosis in elk presenting with shifting leg lameness, reluctance to move, recumbency and hoof wall ridging. Eliminating the underlying cause and corrective trimming lead to a good prognosis for recovery....

  5. Retortable Laminate/Polymeric Food Tubes for Specialized Feeding

    2012-06-01

    Report STP #3010 Results and Accomplishments (June 2010 – June 2012) Report No: FTR 303 CDRL Sequence: A003 June 2012 CORANET CONTRACT #: SP4701-08-D...June 2010 - June 2012 Retortable Laminate/Polymeric Food Tubes for Specialized Feeding - STP # 3010 SP4701-08-D-0004 MANTECH (0708011S) CORANET A003...on commercial off-the-shelf materials and not military unique. A market survey of commercially available laminated tubes revealed that they are all

  6. Molecular analysis on germline mutation caused by low-dose irradiation

    Uchiyama, R.; Fujikawa, K.; Nishimura, M.; Adzuma, H.; Shimada, Y.; Yamauchi, M.

    2003-01-01

    Full text: Genetic heterogeneity and a low frequency of germline mutation at single-copy gene loci have limited the direct measurement of germline mutation in human populations. Two conflicting results have been reported for the effect of ionizing radiation on germline mutation in human populations. A study conducted on the first-generation progeny of the survivors of the atomic bombs at Hiroshima and Nagasaki found no significant increase in germline mutations. On the other hand, a significant increase in germline mutation was reported among the human population in the Belarus area after the Chernobyl accident in 1986. We investigated the germline mutation at the molecular level using experimental mouse strains with different genetic backgrounds to assess the risk of ionizing radiation on human populations. The C3H male parents were exposed to X ray (0, 0.3, 1, and 3Gy) and mated with unexposed C57BL females after two weeks interval, so as to detect the germline mutation occurred at the spermatid stage. Genomic DNA samples were prepared from the both parents and F1s, and the genomic DNA sequences were compared between parents and offspring at the specific genomic gene loci, such as adenine phosphoribosyl transferase (aprt) gene and cytidine triphosphate synthetase (ctps) gene, using the automated DNA sequencer. Also hypervariable Pc-1 (Ms6-hm) minisatellite repeat locus was analyzed by using Southern blot hybridization technique. Our preliminary results indicated that the changes of the restriction DNA fragment length in offspring did not reflect the occurrence of the mutation, such as point mutation, insertion, and deletion, in the genomic gene loci including the intervening sequence (intron)

  7. Ceramic laminates with tailored residual stresses

    Baudín, C.

    2009-12-01

    Full Text Available Severe environments imposed by new technologies demand new materials with better properties and ensured reliability. The intrinsic brittleness of ceramics has forced scientists to look for new materials and processing routes to improve the mechanical behaviour of ceramics in order to allow their use under severe thermomechanical conditions. The laminate approach has allowed the fabrication of a new family of composite materials with strength and reliability superior to those of monolithic ceramics with microstructures similar to those of the constituent layers. The different ceramic laminates developed since the middle 1970´s can be divided in two large groups depending on whether the development of residual stresses between layers is the main design tool. This paper reviews the developments in the control and tailoring of residual stresses in ceramic laminates. The tailoring of the thickness and location of layers in compression can lead to extremely performing structures in terms of strength values and reliability. External layers in compression lead to the strengthening of the structure. When relatively thin and highly compressed layers are located inside the material, threshold strength, crack bifurcation and crack arrest during fracture occur.

    Las severas condiciones de trabajo de las nuevas aplicaciones tecnológicas exigen el uso de materiales con mejores propiedades y alta fiabilidad. La potencialidad de uso de materiales frágiles, como los cerámicos, en estas aplicaciones exige el desarrollo de nuevos materiales y métodos de procesamiento que mejoren su comportamiento mecánico. El concepto de material laminado ha permitido la fabricación de una nueva familia de materiales con tensiones de fractura y fiabilidad superiores a las de materiales monolíticos con microestructuras similares a las de las láminas que conforman el laminado. Los distintos materiales laminados desarrollados desde mediados de los años 70 se pueden

  8. Experimental Assessment of Tensile Failure Characteristic for Advanced Composite Laminates

    Lee, Myoung Keon [Agency for Defense Development, Daejeon (Korea, Republic of); Lee, Jeong Won; Yoon, Dong Hyun; Kim, Jae Hoon [Chungnam Nat’l Univ., Daejeon (Korea, Republic of)

    2017-10-15

    In recent years, major airplane manufacturers have been using the laminate failure theory to estimate the strain of composite structures for airplanes. The laminate failure theory uses the failure strain of the laminate to analyze composite structures. This paper describes a procedure for the experimental assessment of laminate tensile failure characteristics. Regression analysis was used as the experimental assessment method. The regression analysis was performed with the response variable being the laminate failure strain and with the regressor variables being two-ply orientation (0° and ±45°) variables. The composite material in this study is a carbon/epoxy unidirectional (UD) tape that was cured as a pre-preg at 177°C(350°F). A total of 149 tension tests were conducted on specimens from 14 distinct laminates that were laid up at standard angle layers (0°, 45°, -45°, and 90°). The ASTM-D-3039 standard was used as the test method.

  9. Experimental Assessment of Tensile Failure Characteristic for Advanced Composite Laminates

    Lee, Myoung Keon; Lee, Jeong Won; Yoon, Dong Hyun; Kim, Jae Hoon

    2017-01-01

    In recent years, major airplane manufacturers have been using the laminate failure theory to estimate the strain of composite structures for airplanes. The laminate failure theory uses the failure strain of the laminate to analyze composite structures. This paper describes a procedure for the experimental assessment of laminate tensile failure characteristics. Regression analysis was used as the experimental assessment method. The regression analysis was performed with the response variable being the laminate failure strain and with the regressor variables being two-ply orientation (0° and ±45°) variables. The composite material in this study is a carbon/epoxy unidirectional (UD) tape that was cured as a pre-preg at 177°C(350°F). A total of 149 tension tests were conducted on specimens from 14 distinct laminates that were laid up at standard angle layers (0°, 45°, -45°, and 90°). The ASTM-D-3039 standard was used as the test method.

  10. Detection of induced male germline mutation: Correlations and comparisons between traditional germline mutation assays, transgenic rodent assays and expanded simple tandem repeat instability assays

    Singer, Timothy M. [Mutagenesis Section, Environmental and Occupational Toxicology Division, Safe Environments Programme, 0803A, Health Canada, Ottawa, Ont., K1A 0K9 (Canada); Department of Biology, Carleton University, 1125 Colonel By Drive, Ottawa, Ont., K1S 5B6 (Canada); Lambert, Iain B. [Department of Biology, Carleton University, 1125 Colonel By Drive, Ottawa, Ont., K1S 5B6 (Canada); Williams, Andrew [Biostatistics and Epidemiology Division, Safe Environments Programme, 6604B, Health Canada, Ottawa, Ont., K1A 0K9 (Canada); Douglas, George R. [Mutagenesis Section, Environmental and Occupational Toxicology Division, Safe Environments Programme, 0803A, Health Canada, Ottawa, Ont., K1A 0K9 (Canada); Yauk, Carole L. [Mutagenesis Section, Environmental and Occupational Toxicology Division, Safe Environments Programme, 0803A, Health Canada, Ottawa, Ont., K1A 0K9 (Canada)]. E-mail: carole_yauk@hc-sc.gc.ca

    2006-06-25

    Several rodent assays are capable of monitoring germline mutation. These include traditional assays, such as the dominant lethal (DL) assay, the morphological specific locus (SL) test and the heritable translocation (HT) assay, and two assays that have been developed more recently-the expanded simple tandem repeat (ESTR) and transgenic rodent (TGR) mutation assays. In this paper, we have compiled the limited amount of experimental data that are currently available to make conclusions regarding the comparative ability of the more recently developed assays to detect germline mutations induced by chemical and radiological agents. The data suggest that ESTR and TGR assays are generally comparable with SL in detecting germline mutagenicity induced by alkylating agents and radiation, though TGR offered less sensitivity than ESTR in some cases. The DL and HT assays detect clastogenic events and are most susceptible to mutations arising in post-spermatogonial cells, and they may not provide the best comparisons with TGR and ESTR instability. The measurement of induced ESTR instability represents a relatively sensitive method of identifying agents causing germline mutation in rodents, and may also be useful for bio-monitoring exposed individuals in the human population. Any future use of the TGR and ESTR germline mutation assays in a regulatory testing context will entail more robust and extensive characterization of assay performance. This will require substantially more data, including experiments measuring multiple endpoints, a greatly expanded database of chemical agents and a focus on characterizing stage-specific activity of mutagens in these assays, preferably by sampling epididymal sperm exposed at defined pre-meiotic, meiotic and post-meiotic stages of development.

  11. Detection of induced male germline mutation: Correlations and comparisons between traditional germline mutation assays, transgenic rodent assays and expanded simple tandem repeat instability assays

    Singer, Timothy M.; Lambert, Iain B.; Williams, Andrew; Douglas, George R.; Yauk, Carole L.

    2006-01-01

    Several rodent assays are capable of monitoring germline mutation. These include traditional assays, such as the dominant lethal (DL) assay, the morphological specific locus (SL) test and the heritable translocation (HT) assay, and two assays that have been developed more recently-the expanded simple tandem repeat (ESTR) and transgenic rodent (TGR) mutation assays. In this paper, we have compiled the limited amount of experimental data that are currently available to make conclusions regarding the comparative ability of the more recently developed assays to detect germline mutations induced by chemical and radiological agents. The data suggest that ESTR and TGR assays are generally comparable with SL in detecting germline mutagenicity induced by alkylating agents and radiation, though TGR offered less sensitivity than ESTR in some cases. The DL and HT assays detect clastogenic events and are most susceptible to mutations arising in post-spermatogonial cells, and they may not provide the best comparisons with TGR and ESTR instability. The measurement of induced ESTR instability represents a relatively sensitive method of identifying agents causing germline mutation in rodents, and may also be useful for bio-monitoring exposed individuals in the human population. Any future use of the TGR and ESTR germline mutation assays in a regulatory testing context will entail more robust and extensive characterization of assay performance. This will require substantially more data, including experiments measuring multiple endpoints, a greatly expanded database of chemical agents and a focus on characterizing stage-specific activity of mutagens in these assays, preferably by sampling epididymal sperm exposed at defined pre-meiotic, meiotic and post-meiotic stages of development

  12. Laminate for use in instrument dials or hands and method of making laminate

    Westland, J.M.; Crowther, A.

    1981-01-01

    A translucent sheet of PVC has a coating e.g. of black ink or luminous material, with apertures and optionally luminous or non-luminous indicia. Behind the apertures there are tritium-activated luminous indicia or markings which are covered by an opaque white sheet. A self-adhesive protective film may be temporarily applied to the coating. The laminated structure may be used for faces or hands in time-pieces or other instruments. The use of the white sheet and protective film prevents operatives coming into contact with luminous materials. (author)

  13. Novel somatic and germline mutations in intracranial germ cell tumours.

    Wang, Linghua; Yamaguchi, Shigeru; Burstein, Matthew D; Terashima, Keita; Chang, Kyle; Ng, Ho-Keung; Nakamura, Hideo; He, Zongxiao; Doddapaneni, Harshavardhan; Lewis, Lora; Wang, Mark; Suzuki, Tomonari; Nishikawa, Ryo; Natsume, Atsushi; Terasaka, Shunsuke; Dauser, Robert; Whitehead, William; Adekunle, Adesina; Sun, Jiayi; Qiao, Yi; Marth, Gábor; Muzny, Donna M; Gibbs, Richard A; Leal, Suzanne M; Wheeler, David A; Lau, Ching C

    2014-07-10

    Intracranial germ cell tumours (IGCTs) are a group of rare heterogeneous brain tumours that are clinically and histologically similar to the more common gonadal GCTs. IGCTs show great variation in their geographical and gender distribution, histological composition and treatment outcomes. The incidence of IGCTs is historically five- to eightfold greater in Japan and other East Asian countries than in Western countries, with peak incidence near the time of puberty. About half of the tumours are located in the pineal region. The male-to-female incidence ratio is approximately 3-4:1 overall, but is even higher for tumours located in the pineal region. Owing to the scarcity of tumour specimens available for research, little is currently known about this rare disease. Here we report the analysis of 62 cases by next-generation sequencing, single nucleotide polymorphism array and expression array. We find the KIT/RAS signalling pathway frequently mutated in more than 50% of IGCTs, including novel recurrent somatic mutations in KIT, its downstream mediators KRAS and NRAS, and its negative regulator CBL. Novel somatic alterations in the AKT/mTOR pathway included copy number gains of the AKT1 locus at 14q32.33 in 19% of patients, with corresponding upregulation of AKT1 expression. We identified loss-of-function mutations in BCORL1, a transcriptional co-repressor and tumour suppressor. We report significant enrichment of novel and rare germline variants in JMJD1C, which codes for a histone demethylase and is a coactivator of the androgen receptor, among Japanese IGCT patients. This study establishes a molecular foundation for understanding the biology of IGCTs and suggests potentially promising therapeutic strategies focusing on the inhibition of KIT/RAS activation and the AKT1/mTOR pathway.

  14. Novel somatic and germline mutations in intracranial germ cell tumors

    Wang, Linghua; Yamaguchi, Shigeru; Burstein, Matthew D.; Terashima, Keita; Chang, Kyle; Ng, Ho-Keung; Nakamura, Hideo; He, Zongxiao; Doddapaneni, Harshavardhan; Lewis, Lora; Wang, Mark; Suzuki, Tomonari; Nishikawa, Ryo; Natsume, Atsushi; Terasaka, Shunsuke; Dauser, Robert; Whitehead, William; Adekunle, Adesina; Sun, Jiayi; Qiao, Yi; Marth, Gábor; Muzny, Donna M.; Gibbs, Richard A.; Leal, Suzanne M.; Wheeler, David A.; Lau, Ching C.

    2015-01-01

    Intracranial germ cell tumors (IGCTs) are a group of rare heterogeneous brain tumors which are clinically and histologically similar to the more common gonadal GCTs. IGCTs show great variation in their geographic and gender distribution, histological composition and treatment outcomes. The incidence of IGCTs is historically 5–8 fold greater in Japan and other East Asian countries than in Western countries1 with peak incidence near the time of puberty2. About half of the tumors are located in the pineal region. The male-to-female incidence ratio is approximately 3–4:1 overall but even higher for tumors located in the pineal region3. Due to the scarcity of tumor specimens available for research, little is currently known about this rare disease. Here we report the analysis of 62 cases by next generation sequencing, SNP array and expression array. We find the KIT/RAS signaling pathway frequently mutated in over 50% of IGCTs including novel recurrent somatic mutations in KIT, its downstream mediators KRAS and NRAS, and its negative regulator CBL. Novel somatic alterations in the AKT/mTOR pathway included copy number gain of the AKT1 locus at 14q32.33 in 19% of patients, with corresponding upregulation of AKT1 expression. We identified loss-of-function mutations in BCORL1, a transcriptional corepressor and tumor suppressor. We report significant enrichment of novel and rare germline variants in JMJD1C, a histone demethylase and coactivator of the androgen receptor, among Japanese IGCT patients. This study establishes a molecular foundation for understanding the biology of IGCTs and suggests potentially promising therapeutic strategies focusing on the inhibition of KIT/RAS activation and the AKT1/mTOR pathway. PMID:24896186

  15. THE GERMLINE STEM CELL NICHE UNIT IN MAMMALIAN TESTES

    Oatley, Jon M.; Brinster, Ralph L.

    2014-01-01

    This review addresses current understanding of the germline stem cell niche unit in mammalian testes. Spermatogenesis is a classic model of tissue-specific stem cell function relying on self-renewal and differentiation of spermatogonial stem cells (SSCs). These fate decisions are influenced by a niche microenvironment composed of a growth factor milieu that is provided by several testis somatic support cell populations. Investigations over the last two decades have identified key determinants of the SSC niche including cytokines that regulate SSC functions and support cells providing these factors, adhesion molecules that influence SSC homing, and developmental heterogeneity of the niche during postnatal aging. Emerging evidence suggests that Sertoli cells are a key support cell population influencing the formation and function of niches by secreting soluble factors and possibly orchestrating contributions of other support cells. Investigations with mice have shown that niche influence on SSC proliferation differs during early postnatal development and adulthood. Moreover, there is mounting evidence of an age-related decline in niche function, which is likely influenced by systemic factors. Defining the attributes of stem cell niches is key to developing methods to utilize these cells for regenerative medicine. The SSC population and associated niche comprise a valuable model system for study that provides fundamental knowledge about the biology of tissue-specific stem cells and their capacity to sustain homeostasis of regenerating tissue lineages. While the stem cell is essential for maintenance of all self-renewing tissues and has received considerable attention, the role of niche cells is at least as important and may prove to be more receptive to modification in regenerative medicine. PMID:22535892

  16. A structure and second-harmonic generation of crystals Li B3O5

    Burak, Ya.V.

    1997-01-01

    Projections of atoms of nonlinear optical crystals Li B 3 O 5 onto planes perpendicular to directions of the phase matching of type-1 and type-2 for second-harmonic generation (SHG) in a YAG:Nd laser are constructed. Analyses of the interdependence of orientations of (B 3 O 7 ) 5 -complexes and of the effectiveness of SHG are conducted

  17. 26 CFR 48.6416(b)(3)-2 - Further manufacture included.

    2010-04-01

    ... 26 Internal Revenue 16 2010-04-01 2010-04-01 true Further manufacture included. 48.6416(b)(3)-2... of Special Application to Retailers and Manufacturers Taxes § 48.6416(b)(3)-2 Further manufacture... overpayment by reason of any use in further manufacture, or sale as part of a second manufactured article...

  18. Effect of resin system on the mechanical properties and water absorption of kenaf fibre reinforced laminates

    Rassmann, S.; Paskaramoorthy, R.; Reid, R.G.

    2011-01-01

    The objective of this study is to compare the mechanical and water absorption properties of kenaf (Hibiscus cannabinus L.) fibre reinforced laminates made of three different resin systems. The use of different resin systems is considered so that potentially complex and expensive fibre treatments are avoided. The resin systems used include a polyester, a vinyl ester and an epoxy. Laminates of 15%, 22.5% and 30% fibre volume fraction were manufactured by resin transfer moulding. The laminates were tested for strength and modulus under tensile and flexural loading. Additionally, tests were carried out on laminates to determine the impact energy, impact strength and water absorption. The results revealed that properties were affected in markedly different ways by the resin system and the fibre volume fraction. Polyester laminates showed good modulus and impact properties, epoxy laminates displayed good strength values and vinyl ester laminates exhibited good water absorption characteristics. Scanning electron microscope studies show that epoxy laminates fail by fibre fracture, polyester laminates by fibre pull-out and vinyl ester laminates by a combination of the two. A comparison between kenaf and glass laminates revealed that the specific tensile and flexural moduli of both laminates are comparable at the volume fraction of 15%. However, glass laminates have much better specific properties than the kenaf laminates at high fibre volume fractions for all three resins used.

  19. Pan-cancer analysis reveals technical artifacts in TCGA germline variant calls.

    Buckley, Alexandra R; Standish, Kristopher A; Bhutani, Kunal; Ideker, Trey; Lasken, Roger S; Carter, Hannah; Harismendy, Olivier; Schork, Nicholas J

    2017-06-12

    Cancer research to date has largely focused on somatically acquired genetic aberrations. In contrast, the degree to which germline, or inherited, variation contributes to tumorigenesis remains unclear, possibly due to a lack of accessible germline variant data. Here we called germline variants on 9618 cases from The Cancer Genome Atlas (TCGA) database representing 31 cancer types. We identified batch effects affecting loss of function (LOF) variant calls that can be traced back to differences in the way the sequence data were generated both within and across cancer types. Overall, LOF indel calls were more sensitive to technical artifacts than LOF Single Nucleotide Variant (SNV) calls. In particular, whole genome amplification of DNA prior to sequencing led to an artificially increased burden of LOF indel calls, which confounded association analyses relating germline variants to tumor type despite stringent indel filtering strategies. The samples affected by these technical artifacts include all acute myeloid leukemia and practically all ovarian cancer samples. We demonstrate how technical artifacts induced by whole genome amplification of DNA can lead to false positive germline-tumor type associations and suggest TCGA whole genome amplified samples be used with caution. This study draws attention to the need to be sensitive to problems associated with a lack of uniformity in data generation in TCGA data.

  20. A germline FANCA alteration that is associated with increased sensitivity to DNA damaging agents.

    Wilkes, David C; Sailer, Verena; Xue, Hui; Cheng, Hongwei; Collins, Colin C; Gleave, Martin; Wang, Yuzhuo; Demichelis, Francesca; Beltran, Himisha; Rubin, Mark A; Rickman, David S

    2017-09-01

    Defects in genes involved in DNA damage repair (DDR) pathway are emerging as novel biomarkers and targets for new prostate cancer drug therapies. A previous report revealed an association between an exceptional response to cisplatin treatment and a somatic loss of heterozygosity (LOH) of FANCA in a patient with metastatic prostate cancer who also harbored a germline FANCA variant (S1088F). Although germline FANCA mutations are the most frequent alterations in patients with Fanconi anemia, germline alterations are less common in prostate cancer. We hypothesized that the germline S1088F FANCA variant in combination with FANCA LOH was deleterious for FANCA function and contributed to the patient's exceptional response to cisplatin. We show that although it properly localizes to the nucleus, the S1088F FANCA mutant protein disrupts the FANC protein complex resulting in increased sensitivity to DNA damaging agents. Because molecular stratification is emerging as a strategy for treating men with metastatic, castrate-resistant prostate cancer harboring specific DDR gene defects, our findings suggest that more biomarker studies are needed to better define clinically relevant germline and somatic alterations. © 2017 Wilkes et al.; Published by Cold Spring Harbor Laboratory Press.

  1. Flow cytometry sorting of nuclei enables the first global characterization of Paramecium germline DNA and transposable elements.

    Guérin, Frédéric; Arnaiz, Olivier; Boggetto, Nicole; Denby Wilkes, Cyril; Meyer, Eric; Sperling, Linda; Duharcourt, Sandra

    2017-04-26

    DNA elimination is developmentally programmed in a wide variety of eukaryotes, including unicellular ciliates, and leads to the generation of distinct germline and somatic genomes. The ciliate Paramecium tetraurelia harbors two types of nuclei with different functions and genome structures. The transcriptionally inactive micronucleus contains the complete germline genome, while the somatic macronucleus contains a reduced genome streamlined for gene expression. During development of the somatic macronucleus, the germline genome undergoes massive and reproducible DNA elimination events. Availability of both the somatic and germline genomes is essential to examine the genome changes that occur during programmed DNA elimination and ultimately decipher the mechanisms underlying the specific removal of germline-limited sequences. We developed a novel experimental approach that uses flow cell imaging and flow cytometry to sort subpopulations of nuclei to high purity. We sorted vegetative micronuclei and macronuclei during development of P. tetraurelia. We validated the method by flow cell imaging and by high throughput DNA sequencing. Our work establishes the proof of principle that developing somatic macronuclei can be sorted from a complex biological sample to high purity based on their size, shape and DNA content. This method enabled us to sequence, for the first time, the germline DNA from pure micronuclei and to identify novel transposable elements. Sequencing the germline DNA confirms that the Pgm domesticated transposase is required for the excision of all ~45,000 Internal Eliminated Sequences. Comparison of the germline DNA and unrearranged DNA obtained from PGM-silenced cells reveals that the latter does not provide a faithful representation of the germline genome. We developed a flow cytometry-based method to purify P. tetraurelia nuclei to high purity and provided quality control with flow cell imaging and high throughput DNA sequencing. We identified 61

  2. Experimental evidence showing that no mitotically active female germline progenitors exist in postnatal mouse ovaries.

    Zhang, Hua; Zheng, Wenjing; Shen, Yan; Adhikari, Deepak; Ueno, Hiroo; Liu, Kui

    2012-07-31

    It has been generally accepted for more than half a century that, in most mammalian species, oocytes cannot renew themselves in postnatal or adult life, and that the number of oocytes is already fixed in fetal or neonatal ovaries. This assumption, however, has been challenged over the past decade. In this study, we have taken an endogenous genetic approach to this question and generated a multiple fluorescent Rosa26(rbw/+);Ddx4-Cre germline reporter mouse model for in vivo and in vitro tracing of the development of female germline cell lineage. Through live cell imaging and de novo folliculogenesis experiments, we show that the Ddx4-expressing cells from postnatal mouse ovaries did not enter mitosis, nor did they contribute to oocytes during de novo folliculogenesis. Our results provide evidence that supports the traditional view that no postnatal follicular renewal occurs in mammals, and no mitotically active Ddx4-expressing female germline progenitors exist in postnatal mouse ovaries.

  3. Germline RAD51B truncating mutation in a family with cutaneous melanoma

    Wadt, Karin A W; Aoude, Lauren G; Golmard, Lisa

    2015-01-01

    Known melanoma predisposition genes only account for around 40% of high-density melanoma families. Other rare mutations are likely to play a role in melanoma predisposition. RAD51B plays an important role in DNA repair through homologous recombination, and inactivation of RAD51B has been implicated...... in tumorigenesis. Thus RAD51B is a good candidate melanoma susceptibility gene, and previously, a germline splicing mutation in RAD51B has been identified in a family with early-onset breast cancer. In order to find genetic variants associated with melanoma predisposition, whole-exome sequencing was carried out...... on blood samples from a three-case cutaneous melanoma family. We identified a novel germline RAD51B nonsense mutation, and we demonstrate reduced expression of RAD51B in melanoma cells indicating inactivation of RAD51B. This is only the second report of a germline truncating RAD51B mutation. While...

  4. Xeroderma Pigmentosum: Low Prevalence of Germline XPA Mutations in a Brazilian XP Population

    Karina Miranda Santiago

    2015-04-01

    Full Text Available Xeroderma pigmentosum (XP is a rare autosomal recessive disorder characterized by DNA repair defects that cause photophobia, sunlight-induced cancers, and neurodegeneration. Prevalence of germline mutations in the nucleotide excision repair gene XPA vary significantly in different populations. No Brazilian patients have been reported to carry a germline mutation in this gene. In this study, the germline mutational status of XPA was determined in Brazilian patients exhibiting major clinical features of XP syndrome. The study was conducted on 27 unrelated patients from select Brazilian families. A biallelic inactivating transition mutation c.619C>T (p.Arg207Ter was identified in only one patient with a history of neurological impairment and mild skin abnormalities. These findings suggest that XP syndrome is rarely associated with inherited disease-causing XPA mutations in the Brazilian population. Additionally, this report demonstrates the effectiveness of genotype-phenotype correlation as a valuable tool to guide direct genetic screening.

  5. Xeroderma pigmentosum: low prevalence of germline XPA mutations in a Brazilian XP population.

    Santiago, Karina Miranda; França de Nóbrega, Amanda; Rocha, Rafael Malagoli; Rogatto, Silvia Regina; Achatz, Maria Isabel

    2015-04-22

    Xeroderma pigmentosum (XP) is a rare autosomal recessive disorder characterized by DNA repair defects that cause photophobia, sunlight-induced cancers, and neurodegeneration. Prevalence of germline mutations in the nucleotide excision repair gene XPA vary significantly in different populations. No Brazilian patients have been reported to carry a germline mutation in this gene. In this study, the germline mutational status of XPA was determined in Brazilian patients exhibiting major clinical features of XP syndrome. The study was conducted on 27 unrelated patients from select Brazilian families. A biallelic inactivating transition mutation c.619C>T (p.Arg207Ter) was identified in only one patient with a history of neurological impairment and mild skin abnormalities. These findings suggest that XP syndrome is rarely associated with inherited disease-causing XPA mutations in the Brazilian population. Additionally, this report demonstrates the effectiveness of genotype-phenotype correlation as a valuable tool to guide direct genetic screening.

  6. Performance of Diesel Engine Using Diesel B3 Mixed with Crude Palm Oil

    Namliwan, Nattapong; Wongwuttanasatian, Tanakorn

    2014-01-01

    The objective of this study was to test the performance of diesel engine using diesel B3 mixed with crude palm oil in ratios of 95 : 5, 90 : 10, and 85 : 15, respectively, and to compare the results with diesel B3. According to the tests, they showed that the physical properties of the mixed fuel in the ratio of 95 : 5 were closest to those of diesel B3. The performance of the diesel engine that used mixed fuels had 5–17% lower torque and power than that of diesel B3. The specific fuel consumption of mixed fuels was 7–33% higher than using diesel B3. The components of gas emissions by using mixed fuel had 1.6–52% fewer amount of carbon monoxide (CO), carbon dioxide (CO2), sulfur dioxide (SO2), and oxygen (O2) than those of diesel B3. On the other hand, nitric oxide (NO) and nitrogen oxides (NOX) emissions when using mixed fuels were 10–39% higher than diesel B3. By comparing the physical properties, the performance of the engine, and the amount of gas emissions of mixed fuel, we found out that the 95 : 5 ratio by volume was a suitable ratio for agricultural diesel engine (low-speed diesel engine). PMID:24688402

  7. Performance of diesel engine using diesel B3 mixed with crude palm oil.

    Namliwan, Nattapong; Wongwuttanasatian, Tanakorn

    2014-01-01

    The objective of this study was to test the performance of diesel engine using diesel B3 mixed with crude palm oil in ratios of 95 : 5, 90 : 10, and 85 : 15, respectively, and to compare the results with diesel B3. According to the tests, they showed that the physical properties of the mixed fuel in the ratio of 95 : 5 were closest to those of diesel B3. The performance of the diesel engine that used mixed fuels had 5-17% lower torque and power than that of diesel B3. The specific fuel consumption of mixed fuels was 7-33% higher than using diesel B3. The components of gas emissions by using mixed fuel had 1.6-52% fewer amount of carbon monoxide (CO), carbon dioxide (CO2), sulfur dioxide (SO2), and oxygen (O2) than those of diesel B3. On the other hand, nitric oxide (NO) and nitrogen oxides (NO X ) emissions when using mixed fuels were 10-39% higher than diesel B3. By comparing the physical properties, the performance of the engine, and the amount of gas emissions of mixed fuel, we found out that the 95 : 5 ratio by volume was a suitable ratio for agricultural diesel engine (low-speed diesel engine).

  8. CSR-1 and P granules suppress sperm-specific transcription in the C. elegans germline.

    Campbell, Anne C; Updike, Dustin L

    2015-05-15

    Germ granules (P granules) in C. elegans are required for fertility and function to maintain germ cell identity and pluripotency. Sterility in the absence of P granules is often accompanied by the misexpression of soma-specific proteins and the initiation of somatic differentiation in germ cells. To investigate whether this is caused by the accumulation of somatic transcripts, we performed mRNA-seq on dissected germlines with and without P granules. Strikingly, we found that somatic transcripts do not increase in the young adult germline when P granules are impaired. Instead, we found that impairing P granules causes sperm-specific mRNAs to become highly overexpressed. This includes the accumulation of major sperm protein (MSP) transcripts in germ cells, a phenotype that is suppressed by feminization of the germline. A core component of P granules, the endo-siRNA-binding Argonaute protein CSR-1, has recently been ascribed with the ability to license transcripts for germline expression. However, impairing CSR-1 has very little effect on the accumulation of its mRNA targets. Instead, we found that CSR-1 functions with P granules to prevent MSP and sperm-specific mRNAs from being transcribed in the hermaphrodite germline. These findings suggest that P granules protect germline integrity through two different mechanisms, by (1) preventing the inappropriate expression of somatic proteins at the level of translational regulation, and by (2) functioning with CSR-1 to limit the domain of sperm-specific expression at the level of transcription. © 2015. Published by The Company of Biologists Ltd.

  9. Germline competence of mouse ES and iPS cell lines: Chimera technologies and genetic background.

    Carstea, Ana Claudia; Pirity, Melinda K; Dinnyes, Andras

    2009-12-31

    In mice, gene targeting by homologous recombination continues to play an essential role in the understanding of functional genomics. This strategy allows precise location of the site of transgene integration and is most commonly used to ablate gene expression ("knock-out"), or to introduce mutant or modified alleles at the locus of interest ("knock-in"). The efficacy of producing live, transgenic mice challenges our understanding of this complex process, and of the factors which influence germline competence of embryonic stem cell lines. Increasingly, evidence indicates that culture conditions and in vitro manipulation can affect the germline-competence of Embryonic Stem cell (ES cell) lines by accumulation of chromosome abnormalities and/or epigenetic alterations of the ES cell genome. The effectiveness of ES cell derivation is greatly strain-dependent and it may also influence the germline transmission capability. Recent technical improvements in the production of germline chimeras have been focused on means of generating ES cells lines with a higher germline potential. There are a number of options for generating chimeras from ES cells (ES chimera mice); however, each method has its advantages and disadvantages. Recent developments in induced pluripotent stem (iPS) cell technology have opened new avenues for generation of animals from genetically modified somatic cells by means of chimera technologies. The aim of this review is to give a brief account of how the factors mentioned above are influencing the germline transmission capacity and the developmental potential of mouse pluripotent stem cell lines. The most recent methods for generating specifically ES and iPS chimera mice, including the advantages and disadvantages of each method are also discussed.

  10. Vascular Dysfunction in Horses with Endocrinopathic Laminitis.

    Ruth A Morgan

    Full Text Available Endocrinopathic laminitis (EL is a vascular condition of the equine hoof resulting in severe lameness with both welfare and economic implications. EL occurs in association with equine metabolic syndrome and equine Cushing's disease. Vascular dysfunction, most commonly due to endothelial dysfunction, is associated with cardiovascular risk in people with metabolic syndrome and Cushing's syndrome. We tested the hypothesis that horses with EL have vascular, specifically endothelial, dysfunction. Healthy horses (n = 6 and horses with EL (n = 6 destined for euthanasia were recruited. We studied vessels from the hooves (laminar artery, laminar vein and the facial skin (facial skin arteries by small vessel wire myography. The response to vasoconstrictors phenylephrine (10-9-10-5M and 5-hydroxytryptamine (5HT; 10-9-10-5M and the vasodilator acetylcholine (10-9-10-5M was determined. In comparison with healthy controls, acetylcholine-induced relaxation was dramatically reduced in all intact vessels from horses with EL (% relaxation of healthy laminar arteries 323.5 ± 94.1% v EL 90.8 ± 4.4%, P = 0.01, laminar veins 129.4 ± 14.8% v EL 71.2 ± 4.1%, P = 0.005 and facial skin arteries 182.0 ± 40.7% v EL 91.4 ± 4.5%, P = 0.01. In addition, contractile responses to phenylephrine and 5HT were increased in intact laminar veins from horses with EL compared with healthy horses; these differences were endothelium-independent. Sensitivity to phenylephrine was reduced in intact laminar arteries (P = 0.006 and veins (P = 0.009 from horses with EL. Horses with EL exhibit significant vascular dysfunction in laminar vessels and in facial skin arteries. The systemic nature of the abnormalities suggest this dysfunction is associated with the underlying endocrinopathy and not local changes to the hoof.

  11. Steel skin - SMC laminate structures for lightweight automotive manufacturing

    Quagliato, Luca; Jang, Changsoon; Murugesan, Mohanraj; Kim, Naksoo

    2017-09-01

    In the present research work an innovative material, made of steel skin and sheet molding compound core, is presented and is aimed to be utilized for the production of automotive body frames. For a precise description of the laminate structure, the material properties of all the components, including the adhesive utilized as an interlayer, have been carried out, along with the simple tension test of the composite material. The result have shown that the proposed laminate structure has a specific yield strength 114% higher than 6061 T6 aluminum, 34% higher than 7075 T6 aluminum, 186% higher than AISI 304 stainless steel (30HRC) and 42% than SK5 high-strength steel (52HRC), showing its reliability and convenience for the realization of automotive components. After calibrating the material properties of the laminate structure, and utilizing as reference the simple tension results of the laminate structure, the derived material properties have been utilized for the simulation of the mechanical behavior of an automotive B-pillar. The results have been compared with those of a standard B-pillar made of steel, showing that the MS-SMC laminate structure manifests load and impact carry capacity comparable with those of high strength steel, while granting, at least, an 11% weight reduction.

  12. Tunable characteristics of bending resonance frequency in magnetoelectric laminated composites

    Chen Lei; Li Ping; Wen Yu-Mei; Zhu Yong

    2013-01-01

    As the magnetoelectric (ME) effect in piezoelectric/magnetostrictive laminated composites is mediated by mechanical deformation,the ME effect is significantly enhanced in the vicinity of resonance frequency.The bending resonance frequency (fr) of bilayered Terfenol-D/PZT (MP) laminated composites is studied,and our analysis predicts that (i) the bending resonance frequency of an MP laminated composite can be tuned by an applied dc magnetic bias (Hdc) due to the △E effect; (ii) the bending resonance frequency of the MP laminated composite can be controlled by incorporating FeCuNbSiB layers with different thicknesses.The experimental results show that with Hdc increasing from 0Oe (1 Oe=79.5775 A/m)to 700 Oe,the bending resonance frequency can be shifted in a range of 32.68 kHz ≤ fr ≤ 33.96 kHz.In addition,with the thickness of the FeCuNbSiB layer increasing from 0 μm to 90 μm,the bending resonance frequency of the MP laminated composite gradually increases from 33.66 kHz to 39.18 kHz.This study offers a method of adjusting the strength of dc magnetic bias or the thicknesses of the FeCuNbSiB layer to tune the bending resonance frequency for ME composite,which plays a guiding role in the ME composite design for real applications.

  13. Identification of Germline Genetic Mutations in Pancreatic Cancer Patients

    Salo-Mullen, Erin E.; O’Reilly, Eileen; Kelsen, David; Ashraf, Asad M.; Lowery, Maeve; Yu, Kenneth; Reidy, Diane; Epstein, Andrew S.; Lincoln, Anne; Saldia, Amethyst; Jacobs, Lauren M.; Rau-Murthy, Rohini; Zhang, Liying; Kurtz, Robert; Saltz, Leonard; Offit, Kenneth; Robson, Mark; Stadler, Zsofia K.

    2016-01-01

    Background Pancreatic adenocarcinoma (PAC) is part of several cancer predisposition syndromes; however, indications for genetic counseling/testing are not well-defined. We sought to determine mutation prevalence and characteristics that predict for inherited predisposition to PAC. Methods We identified 175 consecutive PAC patients who underwent clinical genetics assessment at Memorial Sloan Kettering between 2011–2014. Clinical data, family history, and germline results were evaluated. Results Among 159 PAC patients who pursued genetic testing, 24 pathogenic mutations were identified (15.1%; 95%CI, 9.5%–20.7%), including BRCA2(n=13), BRCA1(n=4), p16(n=2), PALB2(n=1), and Lynch syndrome(n=4). BRCA1/BRCA2 prevalence was 13.7% in Ashkenazi Jewish(AJ) (n=95) and 7.1% in non-AJ(n=56) patients. In AJ patients with strong, weak, or absent family history of BRCA-associated cancers, mutation prevalence was 16.7%, 15.8%, and 7.4%, respectively. Mean age at diagnosis in all mutation carriers was 58.5y(range 45–75y) compared to 64y(range 27–87y) in non-mutation carriers(P=0.02). Although BRCA2 was the most common mutation identified, no patients with early-onset PAC(≤50y) harbored a BRCA2 mutation and the mean age at diagnosis in BRCA2 carriers was equivalent to non-mutation carriers(P=0.34). Mutation prevalence in early-onset patients(n=21) was 28.6%, including BRCA1(n=2), p16(n=2), MSH2(n=1) and MLH1(n=1). Conclusion Mutations in BRCA2 account for over 50% of PAC patients with an identified susceptibility syndrome. AJ patients had high BRCA1/BRCA2 prevalence regardless of personal/family history, suggesting that ancestry alone indicates a need for genetic evaluation. With the exception of BRCA2-associated PAC, inherited predisposition to PAC is associated with earlier age at PAC diagnosis suggesting that this subset of patients may also represent a population warranting further evaluation. PMID:26440929

  14. 17 CFR 275.203(b)(3)-2 - Methods for counting clients in certain private funds.

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Methods for counting clients....203(b)(3)-2 Methods for counting clients in certain private funds. (a) For purposes of section 203(b)(3) of the Act (15 U.S.C. 80b-3(b)(3)), you must count as clients the shareholders, limited partners...

  15. Data of evolutionary structure change: 1B04B-3BAAA [Confc[Archive

    Full Text Available 1B04B-3BAAA 1B04 3BAA B A MDRQQAERRAAELRELLNRYGYEYYVLDRPSVPDAEYDR...NLKTIRSLPLRLKEPVSLEARGEAFMPKASFLRLNEERKAR--ELFANPRNAAAGSLRQLDPKVAASRQLDLFVYGLADAEALGIASHSEALDYLQALGFKVNPERRR...DGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTV... 353 TYR CA 427 3BAA A 3BAAA...hain>A 3BAAA EREENGQDIFAN

  16. Cloning and Characterization of Sf9 Cell Lamin and the Lamin Conformational Changes during Autographa californica multiple nucleopolyhedrovirus Infection

    Wenqiang Wei

    2016-05-01

    Full Text Available At present, the details of lamina alterations after baculovirus infection remain elusive. In this study, a lamin gene in the Sf9 cell line of Spodoptera frugiperda was cloned. The open reading frame (orf of the Sf9 lamin was 1860 bp and encoded a protein with a molecular weight of 70 kDa. A transfection assay with a red fluorescence protein (rfp-lamin fusion protein indicated that Sf9 lamin was localized in the nuclear rim. Transmission electron microscopy observations indicated that Autographa californica multiple nucleopolyhedrovirus (AcMNPV nucleocapsids may pass through the nuclear envelope. Immunofluorescence assay indicated that the lamina showed a ruffled staining pattern with the formation of invaginations in the Sf9 cells infected with AcMNPV, while it was evenly distributed at the nuclear periphery of mock-infected cells. Western blotting results indicated that the total amount of lamin in the baculovirus-infected Sf9 cells was significantly decreased compared with the mock-infected cells. These results imply that AcMNPV infection induces structural and biochemical rearrangements of lamina of Sf9 cells.

  17. Using lamb waves tomonitor moisture absorption thermally fatigues composite laminates

    Lee, Jae Sun; Cho, Youn Ho [School of Mechanical Engineering, Pusan National University, Busan (Korea, Republic of)

    2016-06-15

    Nondestructive evaluation for material health monitoring is important in aerospace industries. Composite laminates are exposed to heat cyclic loading and humid environment depending on flight conditions. Cyclic heat loading and moisture absorption may lead to material degradation such as matrix breaking, debonding, and delamination. In this paper, the moisture absorption ratio was investigated by measuring the Lamb wave velocity. The composite laminates were manufactured and subjected to different thermal aging cycles and moisture absorption. For various conditions of these cycles, not only changes in weight and also ultrasonic wave velocity were measured, and the Lamb wave velocity at various levels of moisture on a carbon-epoxy plate was investigated. Results from the experiment show a linear correlation between moisture absorption ratio and Lamb wave velocity at different thermal fatigue stages. The presented method can be applied as an alternative solution in the online monitoring of composite laminate moisture levels in commercial flights.

  18. Electrical behavior of laminated composites with intralaminar degradation: A comprehensive micro-meso homogenization procedure

    Selvakumaran, Lakshmi; Lubineau, Gilles

    2014-01-01

    Electrical Resistance Tomography (ERT) is a promising health monitoring technique to assess damage in laminated composites. Yet, the missing link between the various complex degradation mechanisms within the laminate and its global change

  19. Process monitoring of glass reinforced polypropylene laminates using fiber Bragg gratings

    Mulle, Matthieu; Wafai, Husam; Yudhanto, Arief; Lubineau, Gilles; Yaldiz, R.; Schijve, W.; Verghese, N.

    2015-01-01

    Hot-press molding of glass-fiber-reinforced polypropylene (GFPP) laminates was monitored using longitudinally and transversely embedded fiber Bragg gratings (FBGs) at different locations in unidirectional laminates. The optical sensors proved

  20. Random walks on the braid group B3 and magnetic translations in hyperbolic geometry

    Voituriez, Raphaeel

    2002-01-01

    We study random walks on the three-strand braid group B 3 , and in particular compute the drift, or average topological complexity of a random braid, as well as the probability of trivial entanglement. These results involve the study of magnetic random walks on hyperbolic graphs (hyperbolic Harper-Hofstadter problem), what enables to build a faithful representation of B 3 as generalized magnetic translation operators for the problem of a quantum particle on the hyperbolic plane

  1. 17 CFR 275.203(b)(3)-1 - Definition of “client” of an investment adviser.

    2010-04-01

    ... Definition of “client” of an investment adviser. Preliminary Note to § 275.203(b)(3)-1. This section is a... single client for purposes of section 203(b)(3) of the Act. Under paragraph (b)(6) of this section, the... be a single client for purposes of section 203(b)(3) of the Act (15 U.S.C. 80b-3(b)(3)): (1) A...

  2. State Environmental Policy Act (SEPA) Environmental Checklist Form 216-B-3 Expansion Ponds Closure Plan

    1993-12-01

    The 216-B-3 Expansion Ponds Closure Plan (Revision 1) consists of a Part A Dangerous Waste Permit Application and a Resource Conservation and Recovery Act Closure Plan. An explanation of the Part A submitted with this document is provided at the beginning of the Part A Section. The closure plan consists of nine chapters and five appendices. The 216-B-3 Pond System consists of a series of four earthen, unlined, interconnected ponds and the 216-B-3-3 Ditch that receive waste water from various 200 East Area operating facilities. These four ponds, collectively. Waste water (primarily cooling water, steam condensate, and sanitary water) from various 200 East Area facilities is discharged to the 216-B-3-3 Ditch. Water discharged to the 216-8-3-3 Ditch flows directly into the 216-B-3 Pond. In the past, waste water discharges to B Pond and the 216-B-3-3 Ditch contained mixed waste (radioactive waste and dangerous waste). The radioactive portion of mixed waste has been interpreted by the US Department of Energy (DOE) to be regulated under the Atomic Energy Act of 1954; the nonradioactive dangerous portion of mixed waste is regulated under RCRA. Mixed waste also may be considered a hazardous substance under the Comprehensive Environmental Response, Compensation, and Liability Act of 1980 (CERCLA) when considering remediation of waste sites

  3. Analysis of APOBEC3A/3B germline deletion polymorphism in breast, cervical and oral cancers from South India and its impact on miRNA regulation.

    Revathidevi, Sundaramoorthy; Manikandan, Mayakannan; Rao, Arunagiri Kuha Deva Magendhra; Vinothkumar, Vilvanathan; Arunkumar, Ganesan; Rajkumar, Kottayasamy Seenivasagam; Ramani, Rajendran; Rajaraman, Ramamurthy; Ajay, Chandrasekar; Munirajan, Arasambattu Kannan

    2016-09-01

    Breast cancer and cervical cancer are the leading causes of death in women worldwide as well as in India, whilst oral cancer is the top most common cancer among Asian especially in Indian men in terms of both incidence and mortality rate. Genetic factors determining the predisposition to cancer are being explored to identify the signature genetic variations associated with these cancers. Recently, a germline deletion polymorphism in APOBEC3 gene cluster which completely deletes APOBEC3B coding region has been studied for its association with cancer risk. We screened the germline deletion polymorphism in 409 cancer patients (224 breast cancer, 88 cervical cancer and 97 oral cancer samples), 478 controls and 239 cervical cancer tissue DNAs of South Indian origin. The results suggest that the APOBEC3A/3B deletion polymorphism is not significantly associated with cancer risk in our study population (OR 0.739, 95 % CI, p value 0.91457). Considering the viral restriction property of APOBEC3s, we also screened cervical cancer tissue DNAs for the human papilloma virus infection. We observed a gradual increase in the frequency of HPV16 infection from AA/BB cases (66.86 %) to AA/-- cases (71.43) which signifies the impact of this deletion polymorphism in HPV infection. In addition, we performed in silico analysis to understand the effect of this polymorphism on miRNA regulation of the APOBEC3A/3B fusion transcript. Only 8 APOBEC3B targeting miRNAs were observed to regulate the fusion transcript of which miR-34b-3p and miR-138-5p were found to be frequently downregulated in cancers suggesting miRNA-mediated deregulation of APOBEC3A expression in cancer patients harbouring this particular deletion polymorphism.

  4. Feeding practices and potential risk factors for laminitis in dairy cows in Thailand

    Pilachai, R.

    2013-01-01

    Laminitis is considered an important health problem facing the Thai dairy industry. Although the etiology of laminitis is multifactorial, nutrition is considered an important risk factor. Rumen acidosis, lipopolysaccharides (LPS) and histamine may play a role in the development of laminitis in dairy cattle. However, the relevancy of these risk factors in relation to the occurrence of laminitis under practical feeding conditions in Thailand is not clear. In Thailand, dairy rations are generall...

  5. Subclinical laminitis and its association with pO2 and faecal alterations: Isikli, Aydin experience

    Ibrahim Akin; Deniz Alic Ural; Mehmet Gultekin; Kerem Ural

    2015-01-01

    ABSTRACTObjective. The aim of this field trial was to investigate the relationships among subclinical laminitis, hematological, ruminal and faecal alterations. Materials and Methods. To this extent dairy cows presenting subclinical laminitis (n=11) and to those of other healthy cows without laminitis (n=10) were enrolled and assigned into two groups. All animals were receiving the same daily ration formulated to contain 47% cornsilage and 18% hay, mainly. Effects of subclinical laminitis chal...

  6. Analytical and Experimental Characterization of Thick-Section Fiber-Metal Laminates

    2013-06-01

    laminate . The model individually models each layer of the laminate and predicts stiffness degradation as metal layers plastically deform and as prepreg ...eliminating four of the possible ECM laminates . Additionally, since at least four individual layers (two aluminum and two prepreg ) are used in FML an...AFRL-AFOSR-UK-TR-2013-0023 Analytical and Experimental Characterization of Thick- Section Fiber-Metal Laminates Dr. Rene

  7. A transparent, solvent-free laminated top electrode for perovskite solar cells

    Makha, Mohammed; Fernandes, Silvia Let?cia; Jenatsch, Sandra; Offermans, Ton; Schleuniger, J?rg; Tisserant, Jean-Nicolas; V?ron, Anna C.; Hany, Roland

    2016-01-01

    Abstract A simple lamination process of the top electrode for perovskite solar cells is demonstrated. The laminate electrode consists of a transparent and conductive plastic/metal mesh substrate, coated with an adhesive mixture of poly(3,4-ethylenedioxythiophene):poly(styrenesulfonate), PEDOT:PSS, and sorbitol. The laminate electrode showed a high degree of transparency of 85%. Best cell performance was achieved for laminate electrodes prepared with a sorbitol concentration of ~30 wt% per mil...

  8. The fatigue behavior of composite laminates under various mean stresses

    Rotem, A.

    1991-01-01

    A method is developed for predicting the S-N curve of a composite laminate which is subjected to an arbitrary stress ratio, R (minimum stress/maximum stress). The method is based on the measuring of the S-N behavior of two distinct cases, tension-tension and compression-compression fatigue loadings. Using these parameters, expressions are formulated that estimate the fatigue behavior under any stress ratio loading. Experimental results from the testing of graphite/epoxy laminates, with various structures, are compared with the predictions and show good agreement.

  9. Recent developments of discrete material optimization of laminated composite structures

    Lund, Erik; Sørensen, Rene

    2015-01-01

    This work will give a quick summary of recent developments of the Discrete Material Optimization approach for structural optimization of laminated composite structures. This approach can be seen as a multi-material topology optimization approach for selecting the best ply material and number...... of plies in a laminated composite structure. The conceptual combinatorial design problem is relaxed to a continuous problem such that well-established gradient based optimization techniques can be applied, and the optimization problem is solved on basis of interpolation schemes with penalization...

  10. Calculation of deflection for cross laminated timber floor panel

    Kozarić Ljiljana M.

    2016-01-01

    Full Text Available In this paper analytically calculated values of effective flexural stiffness and deflections of five-layer CLT panels height 14 cm due to the payload defined in Eurocode 1 for floors in residential buildings are compared. Effective flexural stiffness was calculated using Gamma method, K-method and Kreuzinger's analogy. Three floor panels with identical height but with different combinations of lamination thicknesses in cross-layers were analyzed. The panels are 4.5 meters long and 1 meter wide. Lamination thicknesses in cross-sections of panels are 33,4 cm+21,9 cm, then 33 cm+22,5 cm and 52,8 cm.

  11. Multi-material topology design of laminates with strength criteria

    Lund, Erik

    2012-01-01

    The objective of this paper is to present a novel approach for multi-material topology optimization of laminated composite structures where strength constraints are taken into account together with other global structural performance measures. The topology design problem considered contains very...... many design variables, and when strength criteria are included in the problem, a very large number of criteria functions must be considered in the optimization problem to be solved. Thus, block aggregation methods are introduced, such that global strength measures are obtained. These formulations...... are illustrated for multi-material laminated design problems where the maximum failure index is minimized while compliance and mass constraints are taken into account....

  12. Criterion of damage beginning: experimental identification for laminate composite

    Thiebaud, F.; Perreux, D.; Varchon, D.; Lebras, J.

    1996-01-01

    The aim of this study is to propose a criterion of damage beginning for laminate composite. The materials is a glass-epoxy laminate [+55 deg.,-55 deg.[ n performed by winding filament process. First of all a description of the damage is performed and allows to define a damage variable. Thanks to the potential of free energy, an associated variable is defined. The damage criterion is written by using this last one. The parameter of the criterion is identified using mechanical and acoustical methods. The result is compared and exhibit a good agreement. (authors). 13 refs., 5 figs

  13. Feeding practices and potential risk factors for laminitis in dairy cows in Thailand

    Pilachai, R.

    2013-01-01

    Laminitis is considered an important health problem facing the Thai dairy industry. Although the etiology of laminitis is multifactorial, nutrition is considered an important risk factor. Rumen acidosis, lipopolysaccharides (LPS) and histamine may play a role in the development of laminitis in dairy

  14. Nuclear lamins and peripheral nuclear antigens during fertilization and embryogenesis in mice and sea urchins

    Schatten, G.; Schatten, H.; Simerly, C.; Maul, G. G.; Chaly, N.

    1985-01-01

    Nuclear structural changes during fertilization and embryogenesis in mice and sea urchins are traced using four antibodies. The oocytes from virgin female mice, morulae and blastocytes from mated females, and gametes from the sea urchin Lytechnius variegatis are studied using mouse monoclonal antibodies to nuclear lamin A/C, monoclonal antibody to P1, human autoimmune antibodies to lamin A/C, and to lamin B. The mouse fertilization data reveal no lamins on the oocyte; however, lamins are present on the pronuclei, and chromosomes are found on the oocytes and pronuclei. It is detected that on the sea urchin sperm the lamins are reduced to acrosomal and centriolar fossae and peripheral antigens are around the sperm nucleus. The mouse sperm bind lamin antibodies regionally and do not contain antigens. Lamins and antigens are observed on both pronuclei and chromosomes during sea urchin fertilization. Mouse embryogenesis reveals that lamin A/C is not recognized at morula and blastocyst stages; however, lamin B stains are retained. In sea urchin embryogenesis lamin recognition is lost at the blastrula, gastrula, and plutei stages. It is noted that nuclear lamins lost during spermatogenesis are restored at fertilization and peripheral antigens are associated with the surface of chromosomes during meiosis and mitosis and with the periphery of the pronuclei and nuclei during interphase.

  15. 77 FR 61025 - Certain Prepregs, Laminates, and Finished Circuit Boards: Notice of Institution of Formal...

    2012-10-05

    ... INTERNATIONAL TRADE COMMISSION [Inv. No. 337-TA-659] Certain Prepregs, Laminates, and Finished..., and the sale within the United States after importation of certain prepregs, laminates, and finished... for sale, and selling for importation into the United States prepregs and laminates that are the...

  16. Abnormal A-type lamin organization in a human lung carcinoma cell line

    Machiels, BM; Broers, JL; Raymond, Y; de Leij, Louis; Kuijpers, HJH; Caberg, NEH; Ramaekers, Frans C. S.

    We have studied the expression of lamins A and C (A-type lamins) in a lung carcinoma cell line using type-specific monoclonal antibodies, Using immunofluorescence and immunoblotting studies it was noted that several irregularities in lamin expression exist in the cell line GLC-A1, derived from an

  17. Risk prediction of ventricular arrhythmias and myocardial function in Lamin A/C mutation positive subjects

    Hasselberg, Nina E; Edvardsen, Thor; Petri, Helle

    2014-01-01

    Mutations in the Lamin A/C gene may cause atrioventricular block, supraventricular arrhythmias, ventricular arrhythmias (VA), and dilated cardiomyopathy. We aimed to explore the predictors and the mechanisms of VA in Lamin A/C mutation-positive subjects.METHODS AND RESULTS: We included 41 Lamin A/C...

  18. On the plastic behaviour of multi directional epoxy-bolted CFRP laminates

    Jensen, Aage; Poulsen, Ervin

    2004-01-01

    The second generation of CFRP laminate has recently been developed. It is a multi directional CFRP laminate, i.e. a laminate with carbon fibres having several directions other than the first generation. The paper describes the laboratory tests carried out in order to develop anchorage devices for...

  19. Genomic hypomethylation in the human germline associates with selective structural mutability in the human genome.

    Jian Li

    Full Text Available The hotspots of structural polymorphisms and structural mutability in the human genome remain to be explained mechanistically. We examine associations of structural mutability with germline DNA methylation and with non-allelic homologous recombination (NAHR mediated by low-copy repeats (LCRs. Combined evidence from four human sperm methylome maps, human genome evolution, structural polymorphisms in the human population, and previous genomic and disease studies consistently points to a strong association of germline hypomethylation and genomic instability. Specifically, methylation deserts, the ~1% fraction of the human genome with the lowest methylation in the germline, show a tenfold enrichment for structural rearrangements that occurred in the human genome since the branching of chimpanzee and are highly enriched for fast-evolving loci that regulate tissue-specific gene expression. Analysis of copy number variants (CNVs from 400 human samples identified using a custom-designed array comparative genomic hybridization (aCGH chip, combined with publicly available structural variation data, indicates that association of structural mutability with germline hypomethylation is comparable in magnitude to the association of structural mutability with LCR-mediated NAHR. Moreover, rare CNVs occurring in the genomes of individuals diagnosed with schizophrenia, bipolar disorder, and developmental delay and de novo CNVs occurring in those diagnosed with autism are significantly more concentrated within hypomethylated regions. These findings suggest a new connection between the epigenome, selective mutability, evolution, and human disease.

  20. Global transcriptional repression in C. elegans germline precursors by regulated sequestration of TFIID component TAF-4

    Guven-Ozkan, Tugba; Nishi, Yuichi; Robertson, Scott M.; Lin, Rueyling

    2008-01-01

    In C. elegans, four asymmetric divisions, beginning with the zygote (P0), generate transcriptionally repressed germline blastomeres (P1–P4) and somatic sisters that become transcriptionally active. The protein PIE-1 represses transcription in the later germline blastomeres, but not in the earlier germline blastomeres P0 and P1. We show here that OMA-1 and OMA-2, previously shown to regulate oocyte maturation, repress transcription in P0 and P1 by binding to and sequestering in the cytoplasm TAF-4, a component critical for assembly of TFIID and the pol II preinitiation complex. OMA-1/2 binding to TAF-4 is developmentally regulated, requiring phosphorylation by the DYRK kinase MBK-2, which is activated at meiosis II following fertilization. OMA-1/2 are normally degraded after the first mitosis, but ectopic expression of wildtype OMA-1 is sufficient to repress transcription in both somatic and later germline blastomeres. We propose that phosphorylation by MBK-2 serves as a developmental switch, converting OMA-1/2 from oocyte to embryo regulators. PMID:18854162

  1. Global transcriptional repression in C. elegans germline precursors by regulated sequestration of TAF-4.

    Guven-Ozkan, Tugba; Nishi, Yuichi; Robertson, Scott M; Lin, Rueyling

    2008-10-03

    In C. elegans, four asymmetric divisions, beginning with the zygote (P0), generate transcriptionally repressed germline blastomeres (P1-P4) and somatic sisters that become transcriptionally active. The protein PIE-1 represses transcription in the later germline blastomeres but not in the earlier germline blastomeres P0 and P1. We show here that OMA-1 and OMA-2, previously shown to regulate oocyte maturation, repress transcription in P0 and P1 by binding to and sequestering in the cytoplasm TAF-4, a component critical for assembly of TFIID and the pol II preinitiation complex. OMA-1/2 binding to TAF-4 is developmentally regulated, requiring phosphorylation by the DYRK kinase MBK-2, which is activated at meiosis II after fertilization. OMA-1/2 are normally degraded after the first mitosis, but ectopic expression of wild-type OMA-1 is sufficient to repress transcription in both somatic and later germline blastomeres. We propose that phosphorylation by MBK-2 serves as a developmental switch, converting OMA-1/2 from oocyte to embryo regulators.

  2. Lynch syndrome caused by germline PMS2 mutations: delineating the cancer risk

    Broeke, S.W. ten; Brohet, R.M.; Tops, C.M.; Klift, H.M. van der; Velthuizen, M.E.; Bernstein, I.; Capella Munar, G.; Garcia, E.; Hoogerbrugge, N.; Letteboer, T.G.; Menko, F.H.; Lindblom, A.; Mensenkamp, A.R.; Moller, P.; Os, T.A. van; Rahner, N.; Redeker, B.J.; Sijmons, R.H.; Spruijt, L.; Suerink, M.; Vos, Y.J.; Wagner, A.; Hes, F.J.; Vasen, H.F.A.; Nielsen, M.; Wijnen, J.T.

    2015-01-01

    PURPOSE: The clinical consequences of PMS2 germline mutations are poorly understood compared with other Lynch-associated mismatch repair gene (MMR) mutations. The aim of this European cohort study was to define the cancer risk faced by PMS2 mutation carriers. METHODS: Data were collected from 98

  3. Lynch Syndrome Caused by Germline PMS2 Mutations: Delineating the Cancer Risk

    ten Broeke, Sanne W.; Brohet, Richard M.; Tops, Carli M.; van der Klift, Heleen M.; Velthuizen, Mary E.; Bernstein, Inge; Capellá Munar, Gabriel; Gomez Garcia, Encarna; Hoogerbrugge, Nicoline; Letteboer, Tom G. W.; Menko, Fred H.; Lindblom, Annika; Mensenkamp, Arjen R.; Moller, Pal; van Os, Theo A.; Rahner, Nils; Redeker, Bert J. W.; Sijmons, Rolf H.; Spruijt, Liesbeth; Suerink, Manon; Vos, Yvonne J.; Wagner, Anja; Hes, Frederik J.; Vasen, Hans F.; Nielsen, Maartje; Wijnen, Juul T.

    2015-01-01

    Purpose The clinical consequences of PMS2 germline mutations are poorly understood compared with other Lynch-associated mismatch repair gene (MMR) mutations. The aim of this European cohort study was to define the cancer risk faced by PMS2 mutation carriers. Methods Data were collected from 98 PMS2

  4. Lynch Syndrome Caused by Germline PMS2 Mutations : Delineating the Cancer Risk

    ten Broeke, Sanne W.; Brohet, Richard M.; Tops, Carli M.; van der Klift, Heleen M.; Velthuizen, Mary E.; Bernstein, Inge; Capella Munar, Gabriel; Garcia, Encarna Gomez; Hoogerbrugge, Nicoline; Letteboer, Tom G. W.; Menko, Fred H.; Lindblom, Annika; Mensenkamp, Arjen R.; Moller, Pal; Van Os, Theo A.; Rahner, Nils; Redeker, Bert J. W.; Sijmons, Rolf H.; Spruijt, Liesbeth; Suerink, Manon; Vos, Yvonne J.; Wagner, Anja; Hes, Frederik J.; Vasen, Hans F.; Nielsen, Maartje; Wijnen, Juul T.

    2015-01-01

    Purpose The clinical consequences of PMS2 germline mutations are poorly understood compared with other Lynch-associated mismatch repair gene (MMR) mutations. The aim of this European cohort study was to define the cancer risk faced by PMS2 mutation carriers. Methods Data were collected from 98 PMS2

  5. Responsible innovation in human germline gene editing: Background document to the recommendations of ESHG and ESHRE.

    De Wert, Guido; Heindryckx, Björn; Pennings, Guido; Clarke, Angus; Eichenlaub-Ritter, Ursula; van El, Carla G; Forzano, Francesca; Goddijn, Mariëtte; Howard, Heidi C; Radojkovic, Dragica; Rial-Sebbag, Emmanuelle; Dondorp, Wybo; Tarlatzis, Basil C; Cornel, Martina C

    2018-04-01

    Technological developments in gene editing raise high expectations for clinical applications, including editing of the germline. The European Society of Human Reproduction and Embryology (ESHRE) and the European Society of Human Genetics (ESHG) together developed a Background document and Recommendations to inform and stimulate ongoing societal debates. This document provides the background to the Recommendations. Germline gene editing is currently not allowed in many countries. This makes clinical applications in these countries impossible now, even if germline gene editing would become safe and effective. What were the arguments behind this legislation, and are they still convincing? If a technique could help to avoid serious genetic disorders, in a safe and effective way, would this be a reason to reconsider earlier standpoints? This Background document summarizes the scientific developments and expectations regarding germline gene editing, legal regulations at the European level, and ethics for three different settings (basic research, preclinical research and clinical applications). In ethical terms, we argue that the deontological objections (e.g., gene editing goes against nature) do not seem convincing while consequentialist objections (e.g., safety for the children thus conceived and following generations) require research, not all of which is allowed in the current legal situation in European countries. Development of this Background document and Recommendations reflects the responsibility to help society understand and debate the full range of possible implications of the new technologies, and to contribute to regulations that are adapted to the dynamics of the field while taking account of ethical considerations and societal concerns.

  6. First report of a de novo germline mutation in the MLH1 gene

    Stulp, Rein P; Vos, Yvonne J; Mol, Bart; Karrenbeld, Arend; de Raad, Monique; van der Mijle, Huub J C; Sijmons, Rolf H

    2006-01-01

    Hereditary non-polyposis colorectal carcinoma (HNPCC) is an autosomal dominant disorder associated with colorectal and endometrial cancer and a range of other tumor types. Germline mutations in the DNA mismatch repair (MMR) genes, particularly MLH1, MSH2, and MSH6, underlie this disorder. The vast

  7. Elucidating the impact of neurofibromatosis-1 germline mutations on neurofibromin function and dopamine-based learning.

    Anastasaki, Corina; Woo, Albert S; Messiaen, Ludwine M; Gutmann, David H

    2015-06-15

    Neurofibromatosis type 1 (NF1) is a common autosomal dominant neurologic condition characterized by significant clinical heterogeneity, ranging from malignant cancers to cognitive deficits. Recent studies have begun to reveal rare genotype-phenotype correlations, suggesting that the specific germline NF1 gene mutation may be one factor underlying disease heterogeneity. The purpose of this study was to define the impact of the germline NF1 gene mutation on brain neurofibromin function relevant to learning. Herein, we employ human NF1-patient primary skin fibroblasts, induced pluripotent stem cells and derivative neural progenitor cells (NPCs) to demonstrate that NF1 germline mutations have dramatic effects on neurofibromin expression. Moreover, while all NF1-patient NPCs exhibit increased RAS activation and reduced cyclic AMP generation, there was a neurofibromin dose-dependent reduction in dopamine (DA) levels. Additionally, we leveraged two complementary Nf1 genetically-engineered mouse strains in which hippocampal-based learning and memory is DA-dependent to establish that neuronal DA levels and signaling as well as mouse spatial learning are controlled in an Nf1 gene dose-dependent manner. Collectively, this is the first demonstration that different germline NF1 gene mutations differentially dictate neurofibromin function in the brain. © The Author 2015. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  8. A germline RET proto-oncogene mutation in multiple members of an ...

    Background: Multiple endocrine neoplasia type 2A (MEN2A) is a rare cancer associated-syndrome, inherited in an autosomal dominant fashion and caused by germline mutation in RET proto-oncogene. Clinical diagnosis depends on the manifestation of two or more certain endocrine tumors in an individual, such as ...

  9. Sex chromosomes and germline transcriptomics explored by single-cell sequencing and RNA-tomography

    Vértesy, Ábel

    2018-01-01

    In our study of germ cell differentiation, we applied two recently developed technologies on the germline of various model organisms: single-cell mRNA sequencing and RNA-tomography. For the first time we could look at gene expression with such a high resolution, and this led us to discover the

  10. Protection of germline gene expression by the C. elegans Argonaute CSR-1.

    Wedeles, Christopher J; Wu, Monica Z; Claycomb, Julie M

    2013-12-23

    In Caenorhabditis elegans, the Piwi-interacting small RNA (piRNA)-mediated germline surveillance system encodes more than 30,000 unique 21-nucleotide piRNAs, which silence a variety of foreign nucleic acids. What mechanisms allow endogenous germline-expressed transcripts to evade silencing by the piRNA pathway? One likely candidate in a protective mechanism is the Argonaute CSR-1, which interacts with 22G-small RNAs that are antisense to nearly all germline-expressed genes. Here, we use an in vivo RNA tethering assay to demonstrate that the recruitment of CSR-1 to a transcript licenses expression of the transcript, protecting it from piRNA-mediated silencing. Licensing occurs mainly at the level of transcription, as we observe changes in pre-mRNA levels consistent with transcriptional activation when CSR-1 is tethered. Furthermore, the recruitment of CSR-1 to a previously silenced locus transcriptionally activates its expression. Together, these results demonstrate a rare positive role for an endogenous Argonaute pathway in heritably licensing and protecting germline transcripts.

  11. A recurrent germline PAX5 mutation confers susceptibility to pre-B cell acute lymphoblastic leukemia

    Shah, S.; Schrader, K.A.; Waanders, E.; Timms, A.E.; Vijai, J.; Miething, C.; Wechsler, J.; Yang, J.; Hayes, J.; Klein, R.J.; Zhang, J.; Wei, L.; Wu, G.; Rusch, M.; Nagahawatte, P.; Ma, J; Chen, S.C.; Song, G.; Cheng, J.; Meyers, P.; Bhojwani, D.; Jhanwar, S.; Maslak, P.; Fleisher, M.; Littman, J.; Offit, L.; Rau-Murthy, R.; Fleischut, M.H.; Corines, M.; Murali, R.; Gao, X.; Manschreck, C.; Kitzing, T.; Murty, V.V.; Raimondi, S.C.; Kuiper, R.P.; Simons, A.; Schiffman, J.D.; Onel, K.; Plon, S.E.; Wheeler, D.A.; Ritter, D.; Ziegler, D.S.; Tucker, K.; Sutton, R.; Chenevix-Trench, G.; Li, J.; Huntsman, D.G.; Hansford, S.; Senz, J.; Walsh, T.; Lee (Helen Dowling Instituut), M. van der; Hahn, C.N.; Roberts, K.G.; King, M.C.; Lo, S.M.; Levine, R.L.; Viale, A.; Socci, N.D.; Nathanson, K.L.; Scott, H.S.; Daly, M.; Lipkin, S.M.; Lowe, S.W.; Downing, J.R.; Altshuler, D.; Sandlund, J.T.; Horwitz, M.S.; Mullighan, C.G.; Offit, K.

    2013-01-01

    Somatic alterations of the lymphoid transcription factor gene PAX5 (also known as BSAP) are a hallmark of B cell precursor acute lymphoblastic leukemia (B-ALL), but inherited mutations of PAX5 have not previously been described. Here we report a new heterozygous germline variant, c.547G>A

  12. Antibody Heavy Chain Variable Domains of Different Germline Gene Origins Diversify through Different Paths

    Ufuk Kirik

    2017-11-01

    Full Text Available B cells produce antibodies, key effector molecules in health and disease. They mature their properties, including their affinity for antigen, through hypermutation events; processes that involve, e.g., base substitution, codon insertion and deletion, often in association with an isotype switch. Investigations of antibody evolution define modes whereby particular antibody responses are able to form, and such studies provide insight important for instance for development of efficient vaccines. Antibody evolution is also used in vitro for the design of antibodies with improved properties. To better understand the basic concepts of antibody evolution, we analyzed the mutational paths, both in terms of amino acid substitution and insertions and deletions, taken by antibodies of the IgG isotype. The analysis focused on the evolution of the heavy chain variable domain of sets of antibodies, each with an origin in 1 of 11 different germline genes representing six human heavy chain germline gene subgroups. Investigated genes were isolated from cells of human bone marrow, a major site of antibody production, and characterized by next-generation sequencing and an in-house bioinformatics pipeline. Apart from substitutions within the complementarity determining regions, multiple framework residues including those in protein cores were targets of extensive diversification. Diversity, both in terms of substitutions, and insertions and deletions, in antibodies is focused to different positions in the sequence in a germline gene-unique manner. Altogether, our findings create a framework for understanding patterns of evolution of antibodies from defined germline genes.

  13. TGF-β superfamily signaling in testis formation and early male germline development.

    Young, Julia C; Wakitani, Shoichi; Loveland, Kate L

    2015-09-01

    The TGF-β ligand superfamily contains at least 40 members, many of which are produced and act within the mammalian testis to facilitate formation of sperm. Their progressive expression at key stages and in specific cell types determines the fertility of adult males, influencing testis development and controlling germline differentiation. BMPs are essential for the interactive instructions between multiple cell types in the early embryo that drive initial specification of gamete precursors. In the nascent foetal testis, several ligands including Nodal, TGF-βs, Activins and BMPs, serve as key masculinizing switches by regulating male germline pluripotency, somatic and germline proliferation, and testicular vascularization and architecture. In postnatal life, local production of these factors determine adult testis size by regulating Sertoli cell multiplication and differentiation, in addition to specifying germline differentiation and multiplication. Because TGF-β superfamily signaling is integral to testis formation, it affects processes that underlie testicular pathologies, including testicular cancer, and its potential to contribute to subfertility is beginning to be understood. Copyright © 2015 Elsevier Ltd. All rights reserved.

  14. ErbB3 mRNA leukocyte levels as a biomarker for major depressive disorder

    Milanesi Elena

    2012-09-01

    Full Text Available Abstract Background In recent years, the identification of peripheral biomarkers that are associated with psychiatric diseases, such as Major Depressive Disorder (MDD, has become relevant because these biomarkers may improve the efficiency of the differential diagnosis process and indicate targets for new antidepressant drugs. Two recent candidate genes, ErbB3 and Fgfr1, are growth factors whose mRNA levels have been found to be altered in the leukocytes of patients that are affected by bipolar disorder in a depressive state. On this basis, the aim of the study was to determine if ErbB3 and Fgfr1 mRNA levels could be a biomarkers of MDD. Methods We measured by Real Time PCR ErbB3 and Fgfr1 mRNA expression levels in leukocytes of MDD patients compared with controls. Successively, to assess whether ErbB3 mRNA levels were influenced by previous antidepressant treatment we stratified our patients sample in two cohorts, comparing drug-naive versus drug-free patients. Moreover, we evaluated the levels of the transcript in MDD patients after 12 weeks of antidepressant treatment, and in prefrontal cortex of rats stressed and treated with an antidepressant drug of the same class. Results These results showed that ErbB3 but not Fgfr1 mRNA levels were reduced in leukocytes of MDD patients compared to healthy subjects. Furthermore, ErbB3 levels were not affected by antidepressant treatment in either human or animal models Conclusions Our data suggest that ErbB3 might be considered as a biomarker for MDD and that its deficit may underlie the pathopsysiology of the disease and is not a consequence of treatment. Moreover the study supports the usefulness of leukocytes as a peripheral system for identifying biomarkers in psychiatric diseases.

  15. Effect of Glu-B3 Allelic Variation on Sodium Dodecyl Sulfate Sedimentation Volume in Common Wheat (Triticum aestivum L.

    Hongqi Si

    2013-01-01

    Full Text Available Sodium dodecyl sulfate (SDS sedimentation volume has long been used to characterize wheat flours and meals with the aim of predicting processing and end-product qualities. In order to survey the influence of low-molecular-weight glutenin subunits (LMW-GSs at Glu-B3 locus on wheat SDS sedimentation volume, a total of 283 wheat (Triticum aestivum L. varieties including landraces and improved and introduced cultivars were analyzed using 10 allele-specific PCR markers at the Glu-B3 locus. The highest allele frequency observed in the tested varieties was Glu-B3i with 21.9% in all varieties, 21.1% in landraces, 25.5% in improved cultivars, and 12% in introduced cultivars. Glu-B3 locus represented 8.6% of the variance in wheat SDS sedimentation volume, and Glu-B3b, Glu-B3g, and Glu-B3h significantly heightened the SDS sedimentation volume, but Glu-B3a, Glu-B3c, and Glu-B3j significantly lowered the SDS sedimentation volume. For the bread-making quality, the most desirable alleles Glu-B3b and Glu-B3g become more and more popular and the least desirable alleles Glu-B3a and Glu-B3c got less and less in modern improved cultivars, suggesting that wheat grain quality in China has been significantly improved through breeding effort.

  16. Process-induced viscoelastic stress in composite laminates

    Stango, R.J.

    1985-01-01

    In recent years, considerable interest has developed in evaluating the stress response of composite laminates which is associated with cooling the material system from the cure temperature to room temperature. This research examines the fundamental nature of time-dependent residual-thermal stresses in composite laminates which are caused by the extreme temperature reduction encountered during the fabrication process. Viscoelastic stress in finite-width, symmetric composite laminates is examined on the basis of a formulation that employs an incremental hereditary integral approach in conjunction with a quasi-three dimensional finite element analysis. A consistent methodology is developed and employed for the characterization of lamina material properties. Special attention is given to the time-dependent stress response at ply-interface locations near the free-edge. In addition, the influence of cooling path on stress history is examined. Recently published material property data for graphite-epoxy lamina is employed in the analysis. Results of the investigation generally indicate that nominal differences between the thermoelastic and viscoelastic solutions are obtained. Slight changes of the final stress state are observed to result when different cooling paths are selected for the temperature history. The methodology employed is demonstrated to result in an accurate, efficient, and consistent approach for the viscoelastic analysis of advanced composite laminates

  17. Laminated structure in internally oxidized Ru-Ta coatings

    Chen, Yung-I, E-mail: yichen@mail.ntou.edu.tw

    2012-12-01

    During the development of refractory alloy coatings for protective purposes at high temperature under oxygen-containing atmospheres, previous studies noted and examined the internal oxidation phenomenon for Mo-Ru and Ru-Ta coatings. The internally oxidized zone shows a laminated structure, consisting of alternating oxygen-rich and deficient layers stacked with a general orientation. Previous studies proposed a forming mechanism. To investigate in detail, Ru-Ta coatings were prepared with various rotating speeds of a substrate-holder. The coatings were annealed at 600 Degree-Sign C in an atmosphere continuously purged with 1% O{sub 2}-99% Ar mixed gas for 30 min. Transmission electron microscopy was used to examine the laminated-layer periods. Auger electron spectroscopy depth profiles certified the periodical variation of the related constituents. X-ray photoelectron spectroscopy proved the valence variation of Ta in the near surface, accompanied by the introduction of oxygen ions. The inward diffusion of oxygen was dominated by lattice diffusion. - Highlights: Black-Right-Pointing-Pointer Laminated Ru-Ta coatings consisted of a cyclical gradient concentration. Black-Right-Pointing-Pointer The as-deposited coatings showed a laminated structure with a period of 4-34 nm. Black-Right-Pointing-Pointer Internal oxidation of Ru-Ta coatings executed after annealing in 1% O{sub 2}-Ar atmosphere. Black-Right-Pointing-Pointer Oxygen inward diffusion was dominated by lattice diffusion.

  18. Design of Multiple Bolted Connections for Laminated Veneer Lumber

    Borjen Yeh; Douglas Rammer; Jeff Linville

    2014-01-01

    The design of multiple bolted connections in accordance with Appendix E of the National Design Specification for Wood Construction (NDS) has incorporated provisions for evaluating localized member failure modes of row and group tear-out when the connections are closely spaced. Originally based on structural glued laminated timber (glulam) members made with all L1...

  19. Bending analysis of laminated composite plates using finite element ...

    user

    theory to analyze the laminated composite plates. They concluded that ...... Aeronautics and Astronautics”, Inc.1801, Chapter 8, pp. 240. Baltacıoğlu A.K .... He is working as Assistant Professor in the Department of Mechanical. Engineering in ...

  20. Characterisation of fibre metal laminates under thermomechanical loadings

    Hagenbeek, M.

    2005-01-01

    Fibre metal laminates, such as Arall or Glare, can offer improved properties compared to monolithic materials. Glare for example shows improved fatigue, residual strength, burn-through, impact and corrosion properties with respect to aluminium 2024, together with a considerable weight reduction and

  1. Chapter 4: Lateral design of cross-laminated timber buildings

    John W. van de Lindt; Douglas Rammer; Marjan Popovski; Phil Line; Shiling Pei; Steven E. Pryor

    2013-01-01

    Cross-laminated timber (CLT) is an innovative wood product that was developed approximately two decades ago in Europe and has since been gaining in popularity. Based on the experience of European researchers and designers, it is believed that CLT can provide the U.S. market the opportunity to build mid- and high-rise wood buildings. This Chapter presents a summary of...

  2. Thermoviscoelastic characterization and prediction of Kevlar/epoxy composite laminates

    Gramoll, K. C.; Dillard, D. A.; Brinson, H. F.

    1990-01-01

    The thermoviscoelastic characterization of Kevlar 49/Fiberite 7714A epoxy composite lamina and the development of a numerical procedure to predict the viscoelastic response of any general laminate constructed from the same material were studied. The four orthotropic material properties, S sub 11, S sub 12, S sub 22, and S sub 66, were characterized by 20 minute static creep tests on unidirectional (0) sub 8, (10) sub 8, and (90) sub 16 lamina specimens. The Time-Temperature Superposition-Principle (TTSP) was used successfully to accelerate the characterization process. A nonlinear constitutive model was developed to describe the stress dependent viscoelastic response for each of the material properties. A numerical procedure to predict long term laminate properties from lamina properties (obtained experimentally) was developed. Numerical instabilities and time constraints associated with viscoelastic numerical techniques were discussed and solved. The numerical procedure was incorporated into a user friendly microcomputer program called Viscoelastic Composite Analysis Program (VCAP), which is available for IBM PC type computers. The program was designed for ease of use. The final phase involved testing actual laminates constructed from the characterized material, Kevlar/epoxy, at various temperatures and load level for 4 to 5 weeks. These results were compared with the VCAP program predictions to verify the testing procedure and to check the numerical procedure used in the program. The actual tests and predictions agreed for all test cases which included 1, 2, 3, and 4 fiber direction laminates.

  3. Damage and Failure of Non-Conventional Composite Laminates

    Lopes, C.S.

    2009-01-01

    For a long time, the application of composite materials was restricted to military aircraft and secondary structures of commercial aircraft. Furthermore, the design possibilities offered by composite laminates were narrowed to quasi-isotropic configurations due to their closer behaviour with

  4. Theoretical modeling and experimental analyses of laminated wood composite poles

    Cheng Piao; Todd F. Shupe; Vijaya Gopu; Chung Y. Hse

    2005-01-01

    Wood laminated composite poles consist of trapezoid-shaped wood strips bonded with synthetic resin. The thick-walled hollow poles had adequate strength and stiffness properties and were a promising substitute for solid wood poles. It was necessary to develop theoretical models to facilitate the manufacture and future installation and maintenance of this novel...

  5. Photodegradation in ballistic laminates: Spectroscopy and lifetime extension

    Renschler, C.L.; Stallard, B.R.; White, C.A.; Garcia, M.J.; Morse, H.E. [Sandia National Labs., Albuquerque, NM (United States). Properties of Organic Materials Dept.

    1996-06-01

    Several years ago, the Materials and Process Sciences Center (Org. 1800) was asked by Dept. 9613 to study the materials aging issues which had led to the loss of ballistic protection by Armored Tractor (AT) windshields and windows. The authors speculated that this loss of impact strength was due to photodegradation of the polycarbonate (PC) inboard ply. They developed a spectroscopic method to identify changes in the outboard surface of the PC, and showed that the changes in the surface which occurred upon natural aging in the field could be reproduced by exposing the laminates to a simulated solar flux. Based on these results, they recommended changes in the adhesive interlayers to filter out the ultraviolet (UV) light causing the aging problem. Working with the laminate vendor, PPG, they re-designed the laminates to implement these changes and block essentially all UV light from the inboard ply. The most recent phase of this work involved accelerated solar aging of laminates made with the new design to verify that photoaging effects have been blocked by the new materials. They report here the results of that study, and recommended follow-on work.

  6. Computational Fatigue Life Analysis of Carbon Fiber Laminate

    Shastry, Shrimukhi G.; Chandrashekara, C. V., Dr.

    2018-02-01

    In the present scenario, many traditional materials are being replaced by composite materials for its light weight and high strength properties. Industries like automotive industry, aerospace industry etc., are some of the examples which uses composite materials for most of its components. Replacing of components which are subjected to static load or impact load are less challenging compared to components which are subjected to dynamic loading. Replacing the components made up of composite materials demands many stages of parametric study. One such parametric study is the fatigue analysis of composite material. This paper focuses on the fatigue life analysis of the composite material by using computational techniques. A composite plate is considered for the study which has a hole at the center. The analysis is carried on (0°/90°/90°/90°/90°)s laminate sequence and (45°/-45°)2s laminate sequence by using a computer script. The life cycles for both the lay-up sequence are compared with each other. It is observed that, for the same material and geometry of the component, cross ply laminates show better fatigue life than that of angled ply laminates.

  7. Self-extinguishment of cross-laminated timber

    Crielaard, R.; van de Kuilen, J.W.G.; Terwel, K.C.; Ravenshorst, G.J.P.; Steenbakkers, P.; Breunesse, A.

    2016-01-01

    Cross-laminated timber, or CLT, is receiving attention for its potential use in tall buildings. As a combustible material, one of the challenges for the construction of these buildings is the fire risk that results from its use in the structure. Unprotected CLT can burn along with the fuel load

  8. Dual Teichmüller and lamination spaces

    Fock, Vladimir V.; Goncharov, Alexander B.

    2007-01-01

    We survey explicit coordinate descriptions for two versions of Teichmüller and lamination spaces for open surfaces, and extend them to the more general set-up of surfaces with distinguished collections of points on the boundary. Main features, such as mapping class group action, Poisson and sympl...

  9. Buckling analysis for anisotropic laminated plates under combined inplane loads

    Viswanathan, A. V.; Tamekuni, M.; Baker, L. L.

    1974-01-01

    The buckling analysis presented considers rectangular flat or curved general laminates subjected to combined inplane normal and shear loads. Linear theory is used in the analysis. All prebuckling deformations and any initial imperfections are ignored. The analysis method can be readily extended to longitudinally stiffened structures subjected to combined inplane normal and shear loads.

  10. Chapter 5: Connections Connections in cross-laminated timber buildings

    Mohammad Mohammad; Bradford Douglas; Douglas Rammer; Steven E. Pryor

    2013-01-01

    The light weight of cross-laminated timber (CLT) products combined with the high level of prefabrication involved, in addition to the need to provide wood-based alternative products and systems to steel land concrete, have significantly contributed to the development of CLT products and systems, especially in mid-rise buildings (5 to 9 stories). While this product is...

  11. Chapter 1: CLT Introduction to cross-laminated timber

    Sylvan Gagnon; E.M.(Ted) Bilek; Lisa Podesto; Pablo Crespell

    2013-01-01

    Cross-laminated timber ( CLT), a new generation of engineered wood product developed initially in Europe, has been gaining increased popularity in residential and non-residential applications in several countries. Many impressive low- and mid-rise buildings built around the world using CLT showcase the many advantages this product has to offer to the construction...

  12. Laser cutting of laminated sheet material: a modeling exercise

    de Graaf, R.F.; Meijer, J.

    1997-01-01

    Laser cutting has been investigated for a number of aluminum-synthetic laminates, newly developed materials for the aeronautic and automotive industry. The materials consist of alternating aluminum and synthetic layers. It is shown that these materials can be cut at rates comparable to those of

  13. Laser cutting of metal laminates: analysis and experimental validation

    de Graaf, R.F.; Meijer, J.

    2000-01-01

    Laser cutting has been investigated for a number of aluminum–synthetic laminates, newly developed materials for the aeronautic and automotive industry. The materials consist of alternating aluminum and synthetic layers. It is shown that these materials can be cut at the same speed as homogeneous

  14. Visco-piezo-elastic parameter estimation in laminated plate structures

    Araujo, A. L.; Mota Soares, C. M.; Herskovits, J.

    2009-01-01

    A parameter estimation technique is presented in this article, for identification of elastic, piezoelectric and viscoelastic properties of active laminated composite plates with surface-bonded piezoelectric patches. The inverse method presented uses experimental data in the form of a set of measu...

  15. Damage in woven CFRP laminates subjected to low velocity impacts

    Ullah, H; Abdel-Wahab, A A; Harland, A R; Silberschmidt, V V

    2012-01-01

    Carbon fabric-reinforced polymer (CFRP) composites used in sports products can be exposed to different in-service conditions such as large dynamic bending deformations caused by impact loading. Composite materials subjected to such loads demonstrate various damage modes such as matrix cracking, delamination and, ultimately, fabric fracture. Damage evolution in these materials affects both their in-service properties and performance that can deteriorate with time. These processes need adequate means of analysis and investigation, the major approaches being experimental characterisation and non-destructive examination of internal damage in composite laminates. This research deals with a deformation behaviour and damage in woven composite laminates due to low-velocity dynamic out-of-plane bending. Experimental tests are carried out to characterise the behaviour of such laminates under large-deflection dynamic bending in un-notched specimens in Izod tests using a Resil Impactor. A series of low-velocity impact tests is carried out at various levels of impact energy to assess the energy absorbed and force-time response of CFRP laminates. X-ray micro computed tomography (micro-CT) is used to investigate material damage modes in the impacted specimens. X-ray tomographs revealed that through-thickness matrix cracking, inter-ply delamination and intra-ply delamination, such as tow debonding and fabric fracture, were the prominent damage modes.

  16. Fracture behaviour of alumina and zirconia thin layered laminate

    Chlup, Zdeněk; Hadraba, Hynek; Slabáková, L.; Drdlík, D.; Dlouhý, Ivo

    2012-01-01

    Roč. 32, č. 9 (2012), s. 2057-2061 ISSN 0955-2219 R&D Projects: GA ČR GD106/09/H035 Institutional research plan: CEZ:AV0Z20410507 Institutional support: RVO:68081723 Keywords : Ceramics * Laminates * Crack propagation Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 2.360, year: 2012

  17. Development of High Performance CFRP/Metal Active Laminates

    Asanuma, Hiroshi; Haga, Osamu; Imori, Masataka

    This paper describes development of high performance CFRP/metal active laminates mainly by investigating the kind and thickness of the metal. Various types of the laminates were made by hot-pressing of an aluminum, aluminum alloys, a stainless steel and a titanium for the metal layer as a high CTE material, a unidirectional CFRP prepreg as a low CTE/electric resistance heating material, a unidirectional KFRP prepreg as a low CTE/insulating material. The aluminum and its alloy type laminates have almost the same and the highest room temperature curvatures and they linearly change with increasing temperature up to their fabrication temperature. The curvature of the stainless steel type jumps from one to another around its fabrication temperature, whereas the titanium type causes a double curvature and its change becomes complicated. The output force of the stainless steel type attains the highest of the three under the same thickness. The aluminum type successfully increased its output force by increasing its thickness and using its alloys. The electric resistance of the CFRP layer can be used to monitor the temperature, that is, the curvature of the active laminate because the curvature is a function of temperature.

  18. The extrinsic influence of carbon fibre reinforced plastic laminates to ...

    The extrinsic influence of carbon fibre reinforced plastic laminates to strengthen steel structures ... The intrinsic advantages of strengthening the steel-based structures by the use of fibre reinforced plastic (FRP) material have ... Sadhana | News.

  19. Residual stresses in non-symmetrical carbon-epoxy laminates

    Wijskamp, Sebastiaan; Akkerman, Remko; Lamers, E.A.D.; Martin, M.J.; Hahn, H.T.

    2003-01-01

    The curvature of unsymmetrical [0/90] laminates moulded from AS4/8552 uni-directional tape has been measured. A linear thermoelastic approach has been applied to predict the related residual stress state before demoulding, giving an estimate of the stress induced by polymerisation strain. The

  20. Repair of white oak glued-laminated beams

    Lawrence A. Soltis; Robert J. Ross

    1999-01-01

    Connections between steel side plates and white oak glued-laminated beams subjected to tension perpendicular-to-grain stresses were tested to failure. The beams were then repaired with five different configurations using two sizes of lag screws, with and without steel reinforcing plates. The repaired beams were re-tested to failure. Results indicate that in all...

  1. Effect of Bifidobacterium breve B-3 on skin photoaging induced by chronic UV irradiation in mice.

    Satoh, T; Murata, M; Iwabuchi, N; Odamaki, T; Wakabayashi, H; Yamauchi, K; Abe, F; Xiao, J Z

    2015-01-01

    Probiotics have been shown to have a preventative effect on skin photoaging induced by short term UV irradiation, however, the underlying mechanisms and the effect of probiotics on skin photoaging induced by chronic UV irradiation remain unclear. In this study, we investigated the effect of Bifidobacterium breve B-3 on skin photoaging induced by chronic UV irradiation in hairless mice. Mice were irradiated with UVB three times weekly and orally administered B. breve B-3 (2×10(9) cfu/mouse /day) for 7 weeks. Nonirradiated mice and UVB-irradiated mice without probiotic treatment were used as controls. B. breve B-3 significantly suppressed the changes of transepidermal water loss, skin hydration, epidermal thickening and attenuated the damage to the tight junction structure and basement membrane induced by chronic UVB irradiation. Administration of B. breve B-3 tended to suppress the UV-induced interleukin-1β production in skin (P=0.09). These results suggest that B. breve B-3 could potentially be used to prevent photoaging induced by chronic UV irradiation.

  2. Lamination of organic solar cells and organic light emitting devices: Models and experiments

    Oyewole, O. K.; Yu, D.; Du, J.; Asare, J.; Fashina, A.; Anye, V. C.; Zebaze Kana, M. G.; Soboyejo, W. O.

    2015-01-01

    In this paper, a combined experimental, computational, and analytical approach is used to provide new insights into the lamination of organic solar cells and light emitting devices at macro- and micro-scales. First, the effects of applied lamination force (on contact between the laminated layers) are studied. The crack driving forces associated with the interfacial cracks (at the bi-material interfaces) are estimated along with the critical interfacial crack driving forces associated with the separation of thin films, after layer transfer. The conditions for successful lamination are predicted using a combination of experiments and computational models. Guidelines are developed for the lamination of low-cost organic electronic structures

  3. Concurrent material-fabrication optimization of metal-matrix laminates under thermo-mechanical loading

    Saravanos, D. A.; Morel, M. R.; Chamis, C. C.

    1991-01-01

    A methodology is developed to tailor fabrication and material parameters of metal-matrix laminates for maximum loading capacity under thermomechanical loads. The stresses during the thermomechanical response are minimized subject to failure constrains and bounds on the laminate properties. The thermomechanical response of the laminate is simulated using nonlinear composite mechanics. Evaluations of the method on a graphite/copper symmetric cross-ply laminate were performed. The cross-ply laminate required different optimum fabrication procedures than a unidirectional composite. Also, the consideration of the thermomechanical cycle had a significant effect on the predicted optimal process.

  4. The LMNA mutation p.Arg321Ter associated with dilated cardiomyopathy leads to reduced expression and a skewed ratio of lamin A and lamin C proteins

    Al-Saaidi, Rasha [Research Unit for Molecular Medicine, Aarhus University and Aarhus University Hospital, Aarhus (Denmark); Rasmussen, Torsten B. [Department of Cardiology, Aarhus University Hospital, Aarhus (Denmark); Palmfeldt, Johan [Research Unit for Molecular Medicine, Aarhus University and Aarhus University Hospital, Aarhus (Denmark); Nissen, Peter H. [Department of Clinical Biochemistry, Aarhus University Hospital, Aarhus (Denmark); Beqqali, Abdelaziz [Heart Failure Research Center, Academic Medical Center, Amsterdam (Netherlands); Hansen, Jakob [Department of Forensic Medicine, Bioanalytical Unit, University of Aarhus (Denmark); Pinto, Yigal M. [Heart Failure Research Center, Academic Medical Center, Amsterdam (Netherlands); Boesen, Thomas [Department of Molecular Biology and Genetics, University of Aarhus (Denmark); Mogensen, Jens [Department of Cardiology, Odense University Hospital, Odense (Denmark); Bross, Peter, E-mail: peter.bross@ki.au.dk [Research Unit for Molecular Medicine, Aarhus University and Aarhus University Hospital, Aarhus (Denmark)

    2013-11-15

    Dilated cardiomyopathy (DCM) is a disease of the heart muscle characterized by cardiac chamber enlargement and reduced systolic function of the left ventricle. Mutations in the LMNA gene represent the most frequent known genetic cause of DCM associated with disease of the conduction systems. The LMNA gene generates two major transcripts encoding the nuclear lamina major components lamin A and lamin C by alternative splicing. Both haploinsuffiency and dominant negative effects have been proposed as disease mechanism for premature termination codon (PTC) mutations in LMNA. These mechanisms however are still not clearly established. In this study, we used a representative LMNA nonsense mutation, p.Arg321Ter, to shed light on the molecular disease mechanisms. Cultured fibroblasts from three DCM patients carrying this mutation were analyzed. Quantitative reverse transcriptase PCR and sequencing of these PCR products indicated that transcripts from the mutant allele were degraded by the nonsense-mediated mRNA decay (NMD) mechanism. The fact that no truncated mutant protein was detectable in western blot (WB) analysis strengthens the notion that the mutant transcript is efficiently degraded. Furthermore, WB analysis showed that the expression of lamin C protein was reduced by the expected approximately 50%. Clearly decreased lamin A and lamin C levels were also observed by immunofluorescence microscopy analysis. However, results from both WB and nano-liquid chromatography/mass spectrometry demonstrated that the levels of lamin A protein were more reduced suggesting an effect on expression of lamin A from the wild type allele. PCR analysis of the ratio of lamin A to lamin C transcripts showed unchanged relative amounts of lamin A transcript suggesting that the effect on the wild type allele was operative at the protein level. Immunofluorescence microscopy analysis showed no abnormal nuclear morphology of patient fibroblast cells. Based on these data, we propose that

  5. Influences of lamin A levels on induction of pluripotent stem cells

    Bingfeng Zuo

    2012-09-01

    Lamin A is an inner nuclear membrane protein that maintains nuclear structure integrity, is involved in transcription, DNA damage response and genomic stability, and also links to cell differentiation, senescence, premature aging and associated diseases. Induced pluripotent stem (iPS cells have been successfully generated from various types of cells and used to model human diseases. It remains unclear whether levels of lamin A influence reprogramming of somatic cells to pluripotent states during iPS induction. Consistently, lamin A is expressed more in differentiated than in relatively undifferentiated somatic cells, and increases in expression levels with age. Somatic cells with various expression levels of lamin A differ in their dynamics and efficiency during iPS cell induction. Cells with higher levels of lamin A show slower reprogramming and decreased efficiency to iPS cells. Furthermore, depletion of lamin A by transient shRNA accelerates iPS cell induction from fibroblasts. Reduced levels of lamin A are associated with increased expression of pluripotent genes Oct4 and Nanog, and telomerase genes Tert and Terc. On the contrary, overexpression of lamin A retards somatic cell reprogramming to iPS-like colony formation. Our data suggest that levels of lamin A influence reprogramming of somatic cells to pluripotent stem cells and that artificial silencing of lamin A facilitates iPS cell induction. These findings may have implications in enhancing rejuvenation of senescent or older cells by iPS technology and manipulating lamin A levels.

  6. Lamination and end plate design studies of SSC Low Energy Booster magnet prototypes

    Li, N.

    1993-01-01

    The LEB machine includes six kinds of laminated magnets and 4 kinds of laminations. The main quadrupole magnet and low field and high field corrector quadrupoles use the same lamination shape. The chromaticity sextupole, corrector dipole, and main dipole have different lamination designs. To test the physical design and production procedure for the magnets, it is necessary to build 2 or 3 prototypes for each kind of magnet. The ZVI plant in Moscow, manufactured all 4 kinds of lamination punching dies for the LEB magnets. Each die takes 3 to 5 months to fabricate. SSCL manufactured laser cut laminated magnet prototypes in the SSC shop at the same time. Since the LEB cycles at 10 Hz, the high frequency current and laminated end plate design causes a delamination problem on the magnet end. This problem is of concern and will be addressed

  7. Lesions of uncertain malignant potential in the breast (B3): what do we know?

    Purushothaman, H.N.; Lekanidi, K.; Shousha, S.; Wilson, R.

    2016-01-01

    Breast lesions classified as of uncertain malignant potential (B3) on biopsy form a diverse group of abnormalities, which pose a diagnostic and management challenge. In this paper, we discuss the imaging and pathology features as well as the management of the most controversial B3 lesions, consisting of papillary lesions, complex sclerosing lesions/radial scars, lobular intraepithelial neoplasia, and atypical epithelial proliferation of ductal type. As there is an association with malignancy at the time of diagnosis, as well as an increase in the risk of subsequent development of cancer, a multidisciplinary discussion is almost always required to tailor treatment.

  8. Lithium tri borate (LiB3O5) embedded polymer electret for mechanical sensing application

    Murugan, S.; Praveen, E.; Prasad, M. V. N.; Jayakumar, K.

    2017-05-01

    Lithium tri borate (LiB3O5) particles were synthesized by precipitation assisted high temperature solid state reaction. The particles were embedded in chitosan polymer and used as an electret. This electret was characterized for the suitability as a sensing element in vibration accelerometer. It is observed that LiB3O5 embedded electret exhibiting piezoelectric property. The electret is also giving an isolation of > 999 MΩ at 100 Vdc, 250 Vdc, 500 Vdc and 1kVdc confirms compatible for intrinsically safe sensing alternative in vibration accelerometer.

  9. Short syntheses of enantiopure calystegine B-2, B-3, and B-4

    Skaanderup, Philip Robert; Madsen, Robert

    2001-01-01

    Calystegine B-2 B-3, and B-4 have been prepared in 5 steps from the benzyl protected methyl 6-iodoglycopyranosides of glucose, galactose and mannose, respectively, by using a zinc-mediated domino reaction followed by ring-closing olefin metathesis as the key steps.......Calystegine B-2 B-3, and B-4 have been prepared in 5 steps from the benzyl protected methyl 6-iodoglycopyranosides of glucose, galactose and mannose, respectively, by using a zinc-mediated domino reaction followed by ring-closing olefin metathesis as the key steps....

  10. MOLECULAR DYNAMICS STUDY OF INTERACTIONS OF POLYMYXIN B3 AND ITS ALA-MUTANTS WITH LIPOPOLYSACCHARIDE

    Lisnyak Yu. V.

    2015-12-01

    Full Text Available Introduction. Emergence of nosocomial bacterial pathogens (especially Gram-negative bacteria with multiple resistance against almost all available antibiotics is a growing medical problem. No novel drugs targeting multidrug-resistant Gram-negative bacteria have been developed in recent years. In this context, there has been greatly renewed interest to cyclic lipodecapeptides polymyxins. Polymyxins exhibit rapid bactericidal activity, they are specific and highly potent against Gramnegative bacteria, but have potential nephrotoxic side effects. So polymyxins are attractive lead compounds to develop analogues with improved microbiological, pharmacological and toxicological properties. A detailed knowledge of the molecular mechanisms of polymyxin interactions with its cell targets is a prerequisite for the purposeful improvement of its therapeutic properties. The primary cell target of a polymyxin is a lipopolysaccharide (LPS in the outer membrane of Gram-negative bacteria. The binding site of polymyxin on LPS has been supposed to be Kdo2-lipid A fragment. Methods. For all molecular modeling and molecular dynamics simulation experiments the YASARA suite of programs was used. Complex of antimicrobial peptide polymyxin В3 (PmB3 with Kdo2-lipid A portion of E. coli lipopolysaccharide was constructed by rigid docking with flexible side chains of the peptide. By alanine scanning of polymyxin В3 bound to LPS followed by simulated annealing minimization of the complexes in explicit water environment, the molecular aspects of PmB3-LPS binding have been studied by 20 ns molecular dynamics simulations at 298 K and pH 7.0. The AMBER03 force field was used with a 1.05 nm force cutoff. To treat long range electrostatic interactions the Particle Mesh Ewald algorithm was used. Results. Ala-mutations of polymyxin’s residues Dab1, Dab3, Dab5, Dab8 and Dab9 in the PmB3-LPS complex caused sustained structural changes resulting in the notable loss in stability of

  11. 17 CFR 240.10b-3 - Employment of manipulative and deceptive devices by brokers or dealers.

    2010-04-01

    ... deceptive devices by brokers or dealers. 240.10b-3 Section 240.10b-3 Commodity and Securities Exchanges... Contrivances § 240.10b-3 Employment of manipulative and deceptive devices by brokers or dealers. (a) It shall be unlawful for any broker or dealer, directly or indirectly, by the use of any means or...

  12. Whole-genome sequencing of spermatocytic tumors provides insights into the mutational processes operating in the male germline

    Giannoulatou, Eleni; Maher, Geoffrey J; Ding, Zhihao

    2017-01-01

    Adult male germline stem cells (spermatogonia) proliferate by mitosis and, after puberty, generate spermatocytes that undertake meiosis to produce haploid spermatozoa. Germ cells are under evolutionary constraint to curtail mutations and maintain genome integrity. Despite constant turnover...

  13. Epigenetic modulation of cancer-germline antigen gene expression in tumorigenic human mesenchymal stem cells: implications for cancer therapy

    Gjerstorff, Morten; Burns, Jorge S; Nielsen, Ole

    2009-01-01

    Cancer-germline antigens are promising targets for cancer immunotherapy, but whether such therapies will also eliminate the primary tumor stem cell population remains undetermined. We previously showed that long-term cultures of telomerized adult human bone marrow mesenchymal stem cells can...... spontaneously evolve into tumor-initiating, mesenchymal stem cells (hMSC-TERT20), which have characteristics of clinical sarcoma cells. In this study, we used the hMSC-TERT20 tumor stem cell model to investigate the potential of cancer-germline antigens to serve as tumor stem cell targets. We found...... of cancer-germline antigens in hMSC-TERT20 cells, while their expression levels in primary human mesenchymal stem cells remained unaffected. The expression pattern of cancer-germline antigens in tumorigenic mesenchymal stem cells and sarcomas, plus their susceptibility to enhancement by epigenetic...

  14. Germline single nucleotide polymorphisms associated with response of urothelial carcinoma to platinum-based therapy: the role of the host.

    Gallagher, D J

    2013-09-01

    Variations in urothelial carcinoma (UC) response to platinum chemotherapy are common and frequently attributed to genetic and epigenetic variations of somatic DNA. We hypothesized that variations in germline DNA may contribute to UC chemosensitivity.

  15. First International Consensus Conference on lesions of uncertain malignant potential in the breast (B3 lesions).

    Rageth, Christoph J; O'Flynn, Elizabeth Am; Comstock, Christopher; Kurtz, Claudia; Kubik, Rahel; Madjar, Helmut; Lepori, Domenico; Kampmann, Gert; Mundinger, Alexander; Baege, Astrid; Decker, Thomas; Hosch, Stefanie; Tausch, Christoph; Delaloye, Jean-François; Morris, Elisabeth; Varga, Zsuzsanna

    2016-09-01

    The purpose of this study is to obtain a consensus for the therapy of B3 lesions. The first International Consensus Conference on lesions of uncertain malignant potential in the breast (B3 lesions) including atypical ductal hyperplasia (ADH), flat epithelial atypia (FEA), classical lobular neoplasia (LN), papillary lesions (PL), benign phyllodes tumors (PT), and radial scars (RS) took place in January 2016 in Zurich, Switzerland organized by the International Breast Ultrasound School and the Swiss Minimally Invasive Breast Biopsy group-a subgroup of the Swiss Society of Senology. Consensus recommendations for the management and follow-up surveillance of these B3 lesions were developed and areas of research priorities were identified. The consensus recommendation for FEA, LN, PL, and RS diagnosed on core needle biopsy or vacuum-assisted biopsy (VAB) is to therapeutically excise the lesion seen on imaging by VAB and no longer by open surgery, with follow-up surveillance imaging for 5 years. The consensus recommendation for ADH and PT is, with some exceptions, therapeutic first-line open surgical excision. Minimally invasive management of selected B3 lesions with therapeutic VAB is acceptable as an alternative to first-line surgical excision.

  16. Probable transmission of coxsackie B3 virus from human to chimpanzee, Denmark

    Nielsen, Sandra Cathrine Abel; Mourier, Tobias; Baandrup, Ulrik

    2012-01-01

    In 2010, a chimpanzee died at Copenhagen Zoo following an outbreak of respiratory disease among chimpanzees in the zoo. Identification of coxsackie B3 virus, a common human pathogen, as the causative agent, and its severe manifestation, raise questions about pathogenicity and transmissibility among...

  17. New patient pathway using vacuum-assisted biopsy reduces diagnostic surgery for B3 lesions

    Rajan, S.; Shaaban, A.M.; Dall, B.J.G.; Sharma, N.

    2012-01-01

    Aim: To assess the clinical impact of a new patient management pathway incorporating vacuum-assisted biopsy for lesions of uncertain malignant potential (B3). Materials and methods: A retrospective analysis was undertaken of all B3 lesions on core biopsy in the pathology database from April 2008 to April 2010. Outcome measures assessed included final histological diagnosis, frequency of diagnostic surgical biopsy, and impact on management. Results: In the old pathway, there were 95 B3 lesions, of which 14% (13/95) were planned for vacuum-assisted biopsy and 86% (82/95) for surgical biopsy. In the new pathway, there were 94 B3 lesions, of which 68% (64/94) were planned for vacuum-assisted biopsy and 32% (30/94) for surgical biopsy. Following further sampling with vacuum-assisted biopsy, only 13% of patients required diagnostic surgical biopsy and in 25% of cases, a preoperative diagnosis of carcinoma was reached allowing patients to proceed to therapeutic surgery. Conclusion: The new pathway has reduced the number of benign diagnostic surgical biopsies performed and increased the preoperative diagnosis of breast cancer.

  18. 17 CFR 270.24b-3 - Sales literature deemed filed.

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Sales literature deemed filed... (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.24b-3 Sales literature deemed filed. Any advertisement, pamphlet, circular, form letter or other sales literature addressed to or intended...

  19. KCC isoforms in a human lens epithelial cell line (B3) and lens tissue extracts.

    Misri, Sandeep; Chimote, Ameet A; Adragna, Norma C; Warwar, Ronald; Brown, Thomas L; Lauf, Peter K

    2006-11-01

    We recently reported potassium-chloride cotransporter activity in human lens epithelial B3 (HLE-B3) cells. The purpose of the present study was to demonstrate in these cells as well as in human lens tissue the potassium-chloride cotransport (KCC) isoforms by reverse transcriptase-polymerase chain reaction (RT-PCR), Western blotting and immunofluorescence microscopy. Of the four KCC genes known to encode the respective proteins and their spliced variants, RT-PCR with both rat and human primers revealed the predicted cDNA fragments of KCC1, KCC3a, KCC3b, and KCC4 but not KCC2 in both HLE-B3 cells and in human lens tissue extracts from cataractous patients. Polyclonal rabbit (rb) anti-rat (rt) and anti-human (hm) antibodies against rtKCC1 and hmKCC3, respectively, and a commercially available rb-anti-mouse (ms) KCC4 antibody were used. Rb anti-rtKCC1-ECL3 [against epitopes within the large extracellular loop 3 (ECL3)] revealed a 150kDa band in HLE-B3 cells consistent with the known molecular weight of KCC1. Rb anti-hmKCC3-ECL3 yielded three bands of 150, 122 and 105kDa, evidence for the presence of KCC3a, KCC3b and possibly KCC3c isoforms. The 122 and 112kDa bands were also demonstrated by rb anti-hmKCC3-CTD [the C-terminal domain (CTD)]. Rb anti-msKCC4 antibody only showed a 100kDa band in HLE-B3 cells. In the human lens tissues, a 115kDa protein was detected with rb anti-rtKCC1-ECL3 and a 100kDa band with rb anti-msKCC4, however, no bands with rb anti-hmKCC3-ECL3 or rb anti-hmKCC3-CTD. Fluorescence microscopy revealed immunocytochemical cytoplasmic and membrane labeling of HLE-B3 cells with anti-KCC1, -KCC3 (laser confocal microscopy) and -KCC4 antibodies and a Cy3-tagged secondary antibody. Hence HLE-B3 cells expressed proteins of the KCC1, KCC3a, b, and KCC4 isoforms, whereas surgically removed cataractous lens tissue expressed only those of KCC1 and KCC4.

  20. Preparation of Chitin-PLA laminated composite for implantable application

    Romana Nasrin

    2017-12-01

    Full Text Available The present study explores the possibilities of using locally available inexpensive waste prawn shell derived chitin reinforced and bioabsorbable polylactic acid (PLA laminated composites to develop new materials with excellent mechanical and thermal properties for implantable application such as in bone or dental implant. Chitin at different concentration (1–20% of PLA reinforced PLA films (CTP were fabricated by solvent casting process and laminated chitin-PLA composites (LCTP were prepared by laminating PLA film (obtained by hot press method with CTP also by hot press method at 160 °C. The effect of variation of chitin concentration on the resulting laminated composite's behavior was investigated. The detailed physico-mechanical, surface morphology and thermal were assessed with different characterization technique such as FT-IR, XRD, SEM and TGA. The FTIR spectra showed the characteristic peaks for chitin and PLA in the composites. SEM images showed an excellent dispersion of chitin in the films and composites. Thermogravimetric analysis (TGA showed that the complete degradation of chitin, PLA film, 5% chitin reinforced PLA film (CTP2 and LCTP are 98%, 95%, 87% and 98% respectively at temperature of 500 °C. The tensile strength of the LCTP was found 25.09 MPa which is significantly higher than pure PLA film (18.55 MPa and CTP2 film (8.83 MPa. After lamination of pure PLA and CTP2 film, the composite (LCTP yielded 0.265–1.061% water absorption from 30 min to 24 h immerse in water that is much lower than PLA and CTP. The increased mechanical properties of the laminated films with the increase of chitin content indicated good dispersion of chitin into PLA and strong interfacial actions between the polymer and chitin. The improvement of mechanical properties and the results of antimicrobial and cytotoxicity of the composites also evaluated and revealed the composite would be a suitable candidate for implant application in biomedical

  1. Preparation of Chitin-PLA laminated composite for implantable application.

    Nasrin, Romana; Biswas, Shanta; Rashid, Taslim Ur; Afrin, Sanjida; Jahan, Rumana Akhter; Haque, Papia; Rahman, Mohammed Mizanur

    2017-12-01

    The present study explores the possibilities of using locally available inexpensive waste prawn shell derived chitin reinforced and bioabsorbable polylactic acid (PLA) laminated composites to develop new materials with excellent mechanical and thermal properties for implantable application such as in bone or dental implant. Chitin at different concentration (1-20% of PLA) reinforced PLA films (CTP) were fabricated by solvent casting process and laminated chitin-PLA composites (LCTP) were prepared by laminating PLA film (obtained by hot press method) with CTP also by hot press method at 160 °C. The effect of variation of chitin concentration on the resulting laminated composite's behavior was investigated. The detailed physico-mechanical, surface morphology and thermal were assessed with different characterization technique such as FT-IR, XRD, SEM and TGA. The FTIR spectra showed the characteristic peaks for chitin and PLA in the composites. SEM images showed an excellent dispersion of chitin in the films and composites. Thermogravimetric analysis (TGA) showed that the complete degradation of chitin, PLA film, 5% chitin reinforced PLA film (CTP2) and LCTP are 98%, 95%, 87% and 98% respectively at temperature of 500 °C. The tensile strength of the LCTP was found 25.09 MPa which is significantly higher than pure PLA film (18.55 MPa) and CTP2 film (8.83 MPa). After lamination of pure PLA and CTP2 film, the composite (LCTP) yielded 0.265-1.061% water absorption from 30 min to 24 h immerse in water that is much lower than PLA and CTP. The increased mechanical properties of the laminated films with the increase of chitin content indicated good dispersion of chitin into PLA and strong interfacial actions between the polymer and chitin. The improvement of mechanical properties and the results of antimicrobial and cytotoxicity of the composites also evaluated and revealed the composite would be a suitable candidate for implant application in biomedical sector.

  2. Evaluasi Fungsi Insinerator Dalam Memusnahkan Limbah B3 Di Rumah Sakit NI Dr.Ramelan Surabaya

    Jahn Leonard Saragih

    2013-09-01

    Full Text Available Pengelolaan limbah padat B3 di Rumah Sakit TNI Angkatan Laut Dr. Ramelan sangat penting diperhatikan karena dapat berdampak buruk apabila tidak dikelola dengan baik. Oleh sebab itu diperlukan adanya penelitian untuk mengidentifikasi jumlah timbulan dan penanganan limbah padat B3, mengevaluasi manajemen, penyimpanan sementara serta mengevaluasi proses insinerasi. Evaluasi fungsi incinerator di Rumah Sakit TNI Angkatan Laut Dr. Ramelan dilakukan dengan meneliti jumlah timbulan limbah B3, kapasitas pembakaran insinerator, suhu pembakaran insinerator, densitas limbah dan abu pembakaran, dan tes TCLP residu pembakaran incinerator Rumah Sakit TNI Angkatan Laut Dr. Ramelan. Dalam penelitian ini, Rumkital Dr. Ramelan memusnahkan limbah dengan incinerator. Limbah B3 yang dihasilkan Rumkital Dr. Ramelan dimusnakan dengan satu incinerator dengan type KAMINE TYPE BDR-INC 10. Limbah yang dimusnahkan di Rumkital Dr. Ramelan berasal dari Rumkital Dr. Ramelan dan Lantamal Perak. Setelah dilakukan penelitian langsung selama 14 hari berturut-turut, didapatkan bahwa rata-rata timbulan limbah B3 di Rumkital Dr. Ramelan adalah 89.98 Kg/hari dan dengan densitas rata-rata limbah ialah 166,67 kg/m3. Tinggat removal dari pembakaran limbah dengan incinerator di Rumah Sakit TNI Angkatan Laut Dr. Ramelan ialah 82,63%. Pengelolaan abu sisa incinerator Rumkital Dr. Ramelan belum sesuai dengan peraturan yang berlaku dan dari penelitian yang dilakukan yaitu pengujian kandungan abu incinerator, solidifikasi abu incinerator dengan perbandingan semen:abu adalah 1:3 dan uji TCLP, didapatkan bahwa limbah abu sisa insinerator Rumah Sakit TNI Angkatan Laut Dr. Ramelan Surabaya, dapat ditimbun pada landfill kategori I sesuai dengan Keputusan Kepala Bapedal No.4 Tahun 1995.

  3. Window frame or ''superferric'' magnet design for low B(<3T) heavy ion storage ring study

    Danby, G.; DeVito, B.; Jackson, J.; Keohane, G.; Lee, Y.; Phillips, R.; Plate, S.; Repata, L.; Skaritka, J.; Smith, L.

    1985-01-01

    Double magnets share common laminations without magnetic coupling. Single layer coils of rectangular conductor are dry wound on extruded bore tubes. Magnet construction requires no molding or prestress. Absence of superconducting (SC) magnetization fields in the aperture results in very large dynamic range. The coil is wound continuously across the modplane to give unusually large dynamic aperture. Above approx.2.2 T saturation is corrected by simple sextupole windings with no inductive coupling to the dipole. Ultrastable design requires no internal quench protection. A quadrupole pair of novel design gives excellent field quality to B > 2 T without corrections, with no SC magnetization. Experience shows magnets are accurate enough for the assembly to take place at its final location. No training is required. Test procedures (measurements with search coils or with the beam) and cooldown properties are discussed. 2 refs., 8 figs., 1 tab

  4. Paternal Age Explains a Major Portion of De Novo Germline Mutation Rate Variability in Healthy Individuals.

    Simon L Girard

    Full Text Available De novo mutations (DNM are an important source of rare variants and are increasingly being linked to the development of many diseases. Recently, the paternal age effect has been the focus of a number of studies that attempt to explain the observation that increasing paternal age increases the risk for a number of diseases. Using disease-free familial quartets we show that there is a strong positive correlation between paternal age and germline DNM in healthy subjects. We also observed that germline CNVs do not follow the same trend, suggesting a different mechanism. Finally, we observed that DNM were not evenly distributed across the genome, which adds support to the existence of DNM hotspots.

  5. Germline Transgenic Methods for Tracking Cells and Testing Gene Function during Regeneration in the Axolotl

    Khattak, Shahryar; Schuez, Maritta; Richter, Tobias; Knapp, Dunja; Haigo, Saori L.; Sandoval-Guzmán, Tatiana; Hradlikova, Kristyna; Duemmler, Annett; Kerney, Ryan; Tanaka, Elly M.

    2013-01-01

    The salamander is the only tetrapod that regenerates complex body structures throughout life. Deciphering the underlying molecular processes of regeneration is fundamental for regenerative medicine and developmental biology, but the model organism had limited tools for molecular analysis. We describe a comprehensive set of germline transgenic strains in the laboratory-bred salamander Ambystoma mexicanum (axolotl) that open up the cellular and molecular genetic dissection of regeneration. We demonstrate tissue-dependent control of gene expression in nerve, Schwann cells, oligodendrocytes, muscle, epidermis, and cartilage. Furthermore, we demonstrate the use of tamoxifen-induced Cre/loxP-mediated recombination to indelibly mark different cell types. Finally, we inducibly overexpress the cell-cycle inhibitor p16INK4a, which negatively regulates spinal cord regeneration. These tissue-specific germline axolotl lines and tightly inducible Cre drivers and LoxP reporter lines render this classical regeneration model molecularly accessible. PMID:24052945

  6. Germline mutation rates in mice following in utero exposure to diesel exhaust particles by maternal inhalation

    Ritz, Caitlin; Ruminski, Wojciech; Hougaard, Karin S.

    2011-01-01

    (PAPs) from industrial environments cause DNA damage and mutations in the sperm of adult male mice. Effects on the female and male germline during critical stages of development (in utero) are unknown. In mice, previous studies have shown that expanded simple tandem repeat (ESTR) loci exhibit high rates......The induction of inherited DNA sequence mutations arising in the germline (i.e., sperm or egg) of mice exposed in utero to diesel exhaust particles (DEPs) via maternal inhalation compared to unexposed controls was investigated in this study. Previous work has shown that particulate air pollutants...... of spontaneous mutation, making this endpoint a valuable tool for studying inherited mutation and genomic instability. In the present study, pregnant C57Bl/6 mice were exposed to 19mg/m3 DEP from gestational day 7 through 19, alongside air exposed controls. Male and female F1 offspring were raised to maturity...

  7. Induction of atherosclerosis in mice and hamsters without germline genetic engineering

    Bjørklund, Martin Mæng; Hollensen, Anne Kruse; Hagensen, Mette Kallestrup

    2014-01-01

    RATIONALE: Atherosclerosis can be achieved in animals by germline genetic engineering, leading to hypercholesterolemia, but such models are constrained to few species and strains, and they are difficult to combine with other powerful techniques involving genetic manipulation or variation. OBJECTIVE......: To develop a method for induction of atherosclerosis without germline genetic engineering. METHODS AND RESULTS: Recombinant adeno-associated viral vectors were engineered to encode gain-of-function proprotein convertase subtilisin/kexin type 9 mutants, and mice were given a single intravenous vector...... injection followed by high-fat diet feeding. Plasma proprotein convertase subtilisin/kexin type 9 and total cholesterol increased rapidly and were maintained at high levels, and after 12 weeks, mice had atherosclerotic lesions in the aorta. Histology of the aortic root showed progression of lesions...

  8. Maternal Metabolic Syndrome Programs Mitochondrial Dysfunction via Germline Changes across Three Generations

    Jessica L. Saben

    2016-06-01

    Full Text Available Maternal obesity impairs offspring health, but the responsible mechanisms are not fully established. To address this question, we fed female mice a high-fat/high-sugar diet from before conception until weaning and then followed the outcomes in the next three generations of offspring, all fed a control diet. We observed that female offspring born to obese mothers had impaired peripheral insulin signaling that was associated with mitochondrial dysfunction and altered mitochondrial dynamic and complex proteins in skeletal muscle. This mitochondrial phenotype persisted through the female germline and was passed down to the second and third generations. Our results indicate that maternal programming of metabolic disease can be passed through the female germline and that the transfer of aberrant oocyte mitochondria to subsequent generations may contribute to the increased risk for developing insulin resistance.

  9. Synchronous Onset of Breast and Pancreatic Cancers: Results of Germline and Somatic Genetic Analysis

    Michael Castro

    2016-07-01

    Full Text Available Background: Synchronous cancers have occasionally been detected at initial diagnosis among patients with breast and ovarian cancer. However, simultaneous coexistence and diagnosis of breast and pancreas cancer has not previously been reported. Case Report: Paternal transmission of a germline BRCA2 mutation to a patient who was diagnosed at age 40 with locally advanced breast and pancreas cancer is presented. Somatic genomic analysis of both cancers with next-generation DNA sequencing confirmed the germline result and reported a variety of variants of unknown significance alterations, of which two were present in both the breast and pancreas cancers. Discussion: The possibility that genomic alterations could have been responsible for modulating the phenotypic or clinical expression of this rare presentation is considered. The authors call attention to the practice of privatizing the clinicogenetic information gained from genetic testing and call for health policy that will facilitate sharing in order to advance the outcomes of patients diagnosed with hereditary cancers.

  10. Exposure to the BPA-Substitute Bisphenol S Causes Unique Alterations of Germline Function.

    Yichang Chen

    2016-07-01

    Full Text Available Concerns about the safety of Bisphenol A, a chemical found in plastics, receipts, food packaging and more, have led to its replacement with substitutes now found in a multitude of consumer products. However, several popular BPA-free alternatives, such as Bisphenol S, share a high degree of structural similarity with BPA, suggesting that these substitutes may disrupt similar developmental and reproductive pathways. We compared the effects of BPA and BPS on germline and reproductive functions using the genetic model system Caenorhabditis elegans. We found that, similarly to BPA, BPS caused severe reproductive defects including germline apoptosis and embryonic lethality. However, meiotic recombination, targeted gene expression, whole transcriptome and ontology analyses as well as ToxCast data mining all indicate that these effects are partly achieved via mechanisms distinct from BPAs. These findings therefore raise new concerns about the safety of BPA alternatives and the risk associated with human exposure to mixtures.

  11. The protein kinase MBK-1 contributes to lifespan extension in daf-2 mutant and germline-deficient Caenorhabditis elegans.

    Mack, Hildegard I D; Zhang, Peichuan; Fonslow, Bryan R; Yates, John R

    2017-05-25

    In Caenorhabditis elegans , reduction of insulin/IGF-1 like signaling and loss of germline stem cells both increase lifespan by activating the conserved transcription factor DAF-16 (FOXO). While the mechanisms that regulate DAF-16 nuclear localization in response to insulin/IGF-1 like signaling are well characterized, the molecular pathways that act in parallel to regulate DAF-16 transcriptional activity, and the pathways that couple DAF-16 activity to germline status, are not fully understood at present. Here, we report that inactivation of MBK-1, the C. elegans ortholog of the human FOXO1-kinase DYRK1A substantially shortens the prolonged lifespan of daf-2 and glp-1 mutant animals while decreasing wild-type lifespan to a lesser extent. On the other hand, lifespan-reduction by mutation of the MBK-1-related kinase HPK-1 was not preferential for long-lived mutants. Interestingly, mbk-1 loss still allowed for DAF-16 nuclear accumulation but reduced expression of certain DAF-16 target genes in germline-less, but not in daf-2 mutant animals. These findings indicate that mbk-1 and daf-16 functionally interact in the germline- but not in the daf-2 pathway. Together, our data suggest mbk-1 as a novel regulator of C. elegans longevity upon both, germline ablation and DAF-2 inhibition, and provide evidence for mbk-1 regulating DAF-16 activity in germline-deficient animals.

  12. Hygrothermal effects on the tensile strength of carbon/epoxy laminates with molded edges

    Cândido Geraldo Maurício

    2000-01-01

    Full Text Available The interlaminar stresses are confined to a region near the free edge. Therefore, the laminate stacking sequence and the free edge finishing are some of the factors that affect the strength of the laminate and limit its life. The use of molded edges eliminates the need for trimming and machining the laminates edges thus improving productivity. However, this fabrication technique may have a detrimental effect on the laminate strength for certain stacking sequences. This effect in the presence of moisture has not been characterized. This work presents the results of a comparative study of the resistance to delamination of laminates with machined edges and molded edges. Additionally, two environmental conditions were considered: dry laminates and laminates saturated with moisture. The tensile strength of the laminates were measured and micrographs were used to analyze the microstructure of the laminates near the free edges. It is concluded that the mechanical properties of advanced composites depend on the environmental conditions and the fabrication techniques used to produce the laminates. Therefore, it is necessary to account for these factors when experimentally determining the design allowables.

  13. Hygrothermal Effect on Mechanical and Fatigue Properties of laminated Lower Limb Socket and Bacteria Growth

    Fadhel Abbas Abdullah

    2016-12-01

    Full Text Available In this work, hygrothermal effect on the mechanical and fatigue properties of prosthetic socket lamination and its effect on the bacteria growth were studied. Two laminations composite materials were used in manufacturing prosthetic socket by using vacuum device. The reinforced materials of these laminations were perlon and carbon nanopowder (CNP while the matrix material was polyurethane resin. Tests performed in this work were the moisture absorption properties test to calculate percent moisture content according to ASTM 5229, tensile and fatigue tests with and without the hygrothermal effect to find the mechanical and fatigue properties, and the bacteria growth test under the hygrothermal effect to calculate the number of bacteria on the laminations. The results showed that the lamination (10 perlon+1 wt % CNP has mechanical properties than lamination (10 perlon with and without hygrothermal effect. The mechanical and fatigue properties for the two laminations were decreasing with increasing temperature and moisture.. Adding carbon nanopowder to the lamination (10 perlon increased ultimate stress, modulus of elastic, and endurance limit by (1.36, 2.35, and2.72 time respectively. Finally, the results showed that the Staphylococcus aureus growth increases with increasing temperature and moisture on the two laminations used in manufacturing prosthetic socket, and adding carbon nanopowder also increased the Staphylococcus aureus growth on the lamination.

  14. Clinical Assessment and Diagnosis of Germline Predisposition to Hematopoietic Malignancies: The University of Chicago Experience

    Ami V. Desai

    2017-12-01

    Full Text Available With the increasing use of clinical genomics to guide cancer treatment and management, there is a rise in the identification of germline cancer predisposition syndromes and a critical need for patients with germline findings to be referred for surveillance and care. The University of Chicago Hematopoietic Malignancies Cancer Risk Team has established a unique approach to patient care for individuals with hereditary hematologic malignancies through close communication and coordination between our pediatric and adult programs. Dedicated program members, including physicians, nurses, genetic counselors, and clinical research assistants, screen individuals for cancer predisposition at initial diagnosis through survivorship, in addition to testing individuals with an established family history of a cancer predisposition syndrome. Sample procurement, such as a skin biopsy at the time of bone marrow aspirate/biopsy in individuals with a positive screen, has facilitated timely identification of clinical germline findings or has served as a pipeline for translational research. Our integrated translational research program has led to the identification of novel syndromes in collaboration with other investigators, which have been incorporated iteratively into our clinical pipeline. Individuals are referred for clinical assessment based on personal and family history, identification of variants in susceptibility genes via molecular tumor testing, and during evaluation for matched related allogeneic stem cell transplantation. Upon referral, genetic counseling incorporates education with mindfulness of the psychosocial issues surrounding germline testing at different ages. The training and role of genetic counselors continues to grow, with the discovery of new predisposition syndromes, in the age of improved molecular diagnostics and new models for service delivery, such as telemedicine. With the identification of new syndromes that may predispose individuals

  15. C. elegans AMPKs promote survival and arrest germline development during nutrient stress

    Masamitsu Fukuyama

    2012-08-01

    Mechanisms controlling development, growth, and metabolism are coordinated in response to changes in environmental conditions, enhancing the likelihood of survival to reproductive maturity. Much remains to be learned about the molecular basis underlying environmental influences on these processes. C. elegans larvae enter a developmentally dormant state called L1 diapause when hatched into nutrient-poor conditions. The nematode pten homologue daf-18 is essential for maintenance of survival and germline stem cell quiescence during this period (Fukuyama et al., 2006; Sigmond et al., 2008, but the details of the signaling network(s in which it functions remain to be elucidated. Here, we report that animals lacking both aak-1 and aak-2, which encode the two catalytic α subunits of AMP-activated protein kinase (AMPK, show reduced viability and failure to maintain mitotic quiescence in germline stem cells during L1 diapause. Furthermore, failure to arrest germline proliferation has a long term consequence; aak double mutants that have experienced L1 diapause develop into sterile adults when returned to food, whereas their continuously fed siblings are fertile. Both aak and daf-18 appear to maintain germline quiescence by inhibiting activity of the common downstream target, TORC1 (TOR Complex 1. In contrast, rescue of the lethality phenotype indicates that aak-2 acts not only in the intestine, as does daf-18, but also in neurons, likely promoting survival by preventing energy deprivation during L1 diapause. These results not only provide evidence that AMPK contributes to survival during L1 diapause in a manner distinct from that by which it controls dauer diapause, but they also suggest that AMPK suppresses TORC1 activity to maintain stem cell quiescence.

  16. Isolation and characterization of string-forming female germline stem cells from ovaries of neonatal mice.

    Liu, Jing; Shang, Dantong; Xiao, Yao; Zhong, Pei; Cheng, Hanhua; Zhou, Rongjia

    2017-09-29

    Germline stem cells are essential in the generation of both male and female gametes. In mammals, the male testis produces sperm throughout the entire lifetime, facilitated by testicular germline stem cells. Oocyte renewal ceases in postnatal or adult life in mammalian females, suggesting that germline stem cells are absent from the mammalian ovary. However, studies in mice, rats, and humans have recently provided evidence for ovarian female germline stem cells (FGSCs). A better understanding of the role of FGSCs in ovaries could help improve fertility treatments. Here, we developed a rapid and efficient method for isolating FGSCs from ovaries of neonatal mice. Notably, our FGSC isolation method could efficiently isolate on average 15 cell "strings" per ovary from mice at 1-3 days postpartum. FGSCs isolated from neonatal mice displayed the string-forming cell configuration at mitosis ( i.e. a "stringing" FGSC (sFGSC) phenotype) and a disperse phenotype in postnatal mice. We also found that sFGSCs undergo vigorous mitosis especially at 1-3 days postpartum. After cell division, the sFGSC membranes tended to be connected to form sFGSCs. Moreover, F-actin filaments exhibited a cell-cortex distribution in sFGSCs, and E-cadherin converged in cell-cell connection regions, resulting in the string-forming morphology. Our new method provides a platform for isolating FGSCs from the neonatal ovary, and our findings indicate that FGCSs exhibit string-forming features in neonatal mice. The sFGSCs represent a valuable resource for analysis of ovary function and an in vitro model for future clinical use to address ovarian dysfunction. © 2017 by The American Society for Biochemistry and Molecular Biology, Inc.

  17. In Genes We Trust: Germline Engineering, Eugenics, and the Future of the Human Genome.

    Powell, Russell

    2015-12-01

    Liberal proponents of genetic engineering maintain that developing human germline modification technologies is morally desirable because it will result in a net improvement in human health and well-being. Skeptics of germline modification, in contrast, fear evolutionary harms that could flow from intervening in the human germline, and worry that such programs, even if well intentioned, could lead to a recapitulation of the scientifically and morally discredited projects of the old eugenics. Some bioconservatives have appealed as well to the value of retaining our "given" human biological nature as a reason for restraining the development and use of human genetic modification technologies even where they would tend to increase well-being. In this article, I argue that germline intervention will be necessary merely to sustain the levels of genetic health that we presently enjoy for future generations-a goal that should appeal to bioliberals and bioconservatives alike. This is due to the population-genetic consequences of relaxed selection pressures in human populations caused by the increasing efficacy and availability of conventional medicine. This heterodox conclusion, which I present as a problem of intergenerational justice, has been overlooked in medicine and bioethics due to certain misconceptions about human evolution, which I attempt to rectify, as well as the sordid history of Darwinian approaches to medicine and social policy, which I distinguish from the present argument. © The Author 2015. Published by Oxford University Press, on behalf of the Journal of Medicine and Philosophy Inc. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  18. Germline mutations in 40 cancer susceptibility genes among Chinese patients with high hereditary risk breast cancer.

    Li, Junyan; Jing, Ruilin; Wei, Hongyi; Wang, Minghao; Qi, Xiaowei; Liu, Haoxi; Liu, Jian; Ou, Jianghua; Jiang, Weihua; Tian, Fuguo; Sheng, Yuan; Li, Hengyu; Xu, Hong; Zhang, Ruishan; Guan, Aihua; Liu, Ke; Jiang, Hongchuan; Ren, Yu; He, Jianjun; Huang, Weiwei; Liao, Ning; Cai, Xiangjun; Ming, Jia; Ling, Rui; Xu, Yan; Hu, Chunyan; Zhang, Jianguo; Guo, Baoliang; Ouyang, Lizhi; Shuai, Ping; Liu, Zhenzhen; Zhong, Ling; Zeng, Zhen; Zhang, Ting; Xuan, Zhaoling; Tan, Xuanni; Liang, Junbin; Pan, Qinwen; Chen, Li; Zhang, Fan; Fan, Linjun; Zhang, Yi; Yang, Xinhua; Li, Jingbo; Chen, Chongjian; Jiang, Jun

    2018-05-12

    Multigene panel testing of breast cancer predisposition genes have been extensively conducted in Europe and America, which is relatively rare in Asia however. In this study, we assessed the frequency of germline mutations in 40 cancer predisposition genes, including BRCA1 and BRCA2, among a large cohort of Chinese patients with high hereditary risk of BC. From 2015 to 2016, consecutive BC patients from 26 centers of China with high hereditary risk were recruited (n=937). Clinical information was collected and next-generation sequencing (NGS) was performed using blood samples of participants to identify germline mutations. In total, we acquired 223 patients with putative germline mutations, including 159 in BRCA1/2, 61 in 15 other BC susceptibility genes and 3 in both BRCA1/2 and non-BRCA1/2 gene. Major mutant non-BRCA1/2 genes were TP53 (n=18), PALB2 (n=11), CHEK2 (n=6), ATM (n=6), and BARD1 (n=5). No factors predicted pathologic mutations in non-BRCA1/2 genes when treated as a whole. TP53 mutations were associated with HER-2 positive BC and younger age at diagnosis; and CHEK2 and PALB2 mutations were enriched in patients with luminal BC. Among high hereditary risk Chinese BC patients, 23.8% contained germline mutations, including 6.8% in non-BRCA1/2 genes. TP53 and PALB2 had a relatively high mutation rates (1.9% and 1.2%). Although no factors predicted for detrimental mutations in non-BRCA1/2 genes, some clinical features were associated with mutations of several particular genes. This article is protected by copyright. All rights reserved. © 2018 UICC.

  19. A regulatory network of Drosophila germline stem cell self-renewal

    Yan, Dong; Neumüller, Ralph A.; Buckner, Michael; Ayers, Kathleen; Li, Hua; Hu, Yanhui; Yang-Zhou, Donghui; Pan, Lei; Wang, Xiaoxi; Kelley, Colleen; Vinayagam, Arunachalam; Binari, Richard; Randklev, Sakara; Perkins, Lizabeth A.; Xie, Ting

    2014-01-01

    Stem cells possess the capacity to generate two cells of distinct fate upon division; one cell retaining stem cell identity and the other cell destined to differentiate. These cell fates are established by cell-type-specific genetic networks. To comprehensively identify components of these networks, we performed a large-scale RNAi screen in Drosophila female germline stem cells (GSCs) covering ~25% of the genome. The screen identified 366 genes that affect GSC maintenance, differentiation or ...

  20. Germline Mutations in Cancer Predisposition Genes are Frequent in Sporadic Sarcomas

    Chan, Sock Hoai; Lim, Weng Khong; Ishak, Nur Diana Binte; Li, Shao-Tzu; Goh, Wei Lin; Tan, Gek San; Lim, Kiat Hon; Teo, Melissa; Young, Cedric Ng Chuan; Malik, Simeen; Tan, Mann Hong; Teh, Jonathan Yi Hui; Chin, Francis Kuok Choon; Kesavan, Sittampalam; Selvarajan, Sathiyamoorthy

    2017-01-01

    Associations of sarcoma with inherited cancer syndromes implicate genetic predisposition in sarcoma development. However, due to the apparently sporadic nature of sarcomas, little attention has been paid to the role genetic susceptibility in sporadic sarcoma. To address this, we performed targeted-genomic sequencing to investigate the prevalence of germline mutations in known cancer-associated genes within an Asian cohort of sporadic sarcoma patients younger than 50 years old. We observed 13....

  1. Behavior of fiber reinforced metal laminates at high strain rate

    Newaz, Golam; Sasso, Marco; Amodio, Dario; Mancini, Edoardo

    2018-05-01

    Carbon Fiber Reinforced Aluminum Laminate (CARALL) is a good system for energy absorption through plastic deformation in aluminum and micro-cracking in the composite layers. Moreover, CARALL FMLs also provide excellent impact resistance due to the presence of aluminum layer. The focus of this research is to characterize the CARALL behavior under dynamic conditions. High strain rate tests on sheet laminate samples have been carried out by means of direct Split Hopkinson Tension Bar. The sample geometry and the clamping system were optimized by FEM simulations. The clamping system has been designed and optimized in order reduce impedance disturbance due to the fasteners and to avoid the excessive plastic strain outside the gauge region of the samples.

  2. Development of failure criterion for Kevlar-epoxy fabric laminates

    Tennyson, R. C.; Elliott, W. G.

    1984-01-01

    The development of the tensor polynomial failure criterion for composite laminate analysis is discussed. In particular, emphasis is given to the fabrication and testing of Kevlar-49 fabric (Style 285)/Narmco 5208 Epoxy. The quadratic-failure criterion with F(12)=0 provides accurate estimates of failure stresses for the Kevlar/Epoxy investigated. The cubic failure criterion was re-cast into an operationally easier form, providing the engineer with design curves that can be applied to laminates fabricated from unidirectional prepregs. In the form presented no interaction strength tests are required, although recourse to the quadratic model and the principal strength parameters is necessary. However, insufficient test data exists at present to generalize this approach for all undirectional prepregs and its use must be restricted to the generic materials investigated to-date.

  3. Bovine pododermatitis aseptica diffusa (laminitis) aetiology, pathogenesis, treatment and control.

    Mgasa, M N

    1987-01-01

    Pododermatitis aseptica diffusa (laminitis) is a major cause of lameness and discomfort to cattle with resultant economic losses. The disease is a result of multifactorial aetiology most of which is not clearly understood. Feeding readily fermentable carbohydrates to unaccustomed cattle predisposes to the disease. Histamine, lactic acid and endotoxins are believed to be involved. Systemic acidosis, histaminosis and endotoxaemia are thought to produce the pathophysiological characteristics of laminitis. The diagnosis is primarily based on the observation of symmetrical and bilateral lesions in hooves and characteristic lameness affecting all feet. Gross lesions include concavity of the dorsal wall, discolorations in the sole and rotation of the pedal bone. Degenerative changes and arteriosclerosis are constant histological findings in the corium, with chronic thrombi and chronic granulation tissue. The disease may be treated conservatively and by application of cyclo-oxygenase inhibiting non-steroidal anti-inflammatory drugs and prevented or controlled by proper feeding and management practices.

  4. A low frequency vibration energy harvester using magnetoelectric laminate composite

    Ju, Suna; Chae, Song Hee; Choi, Yunhee; Lee, Seungjun; Ji, Chang-Hyeon; Lee, Hyang Woon

    2013-01-01

    In this paper, we present a vibration energy harvester using magnetoelectric laminate composite and a springless spherical permanent magnet as a proof mass. The harvester utilizes a freely movable spherical permanent magnet to transform external vibration into a time varying magnetic field applied to the magnetoelectric transducer. The laminate composite consists of a Ni–Mn–Ga-based MSMA (magnetic shape memory alloy) element and a PZT (lead zirconate titanate) plate. A proof-of-concept harvester has been fabricated and characterized at various input accelerations and frequencies. A maximum open circuit voltage of 1.18 V has been obtained in response to a 3g vibration at 17 Hz with the fabricated device. Moreover, a maximum output voltage of 10.24 V and output power of 4.1 μW have been achieved on a 950 Ω load, when the fabricated energy harvester was mounted on a smartphone and shaken by hand. (paper)

  5. Influence of bruxism on survival of porcelain laminate veneers.

    Granell-Ruíz, Maria; Agustín-Panadero, Rubén; Fons-Font, Antonio; Román-Rodríguez, Juan-Luis; Solá-Ruíz, María-Fernanda

    2014-09-01

    This study aims to determine whether bruxism and the use of occlusal splints affect the survival of porcelain laminate veneers in patients treated with this technique. Restorations were made in 70 patients, including 30 patients with some type of parafunctional habit. A total of 323 veneers were placed, 170 in patients with bruxism activity, and the remaining 153 in patients without it. A clinical examination determined the presence or absence of ceramic failure (cracks, fractures and debonding) of the restorations; these incidents were analyzed for association with bruxism and the use of splints. Analysis of the ceramic failures showed that of the 13 fractures and 29 debonding that were present in our study, 8 fractures and 22 debonding were related to the presence of bruxism. Porcelain laminate veneers are a predictable treatment option that provides excellent results, recognizing a higher risk of failure in patients with bruxism activity. The use of occlusal splints reduces the risk of fractures.

  6. An experimental investigation of glare and restructured fiber metal laminates

    Benedict, Adelina Vanessa

    Fiber Metal Laminates (FMLs) are a group of materials fabricated by bonding glass/epoxy layers within metal layers. This class of materials can provide good mechanical properties, as well as weight savings. An FML known as Glass Laminate Aluminum Reinforced Epoxy (GLARE) was studied. An experimental investigation comprising of microscopy and tensile testing was carried out using different grades of GLARE. Microscopy revealed the construction details of GLARE, while tensile testing provided means of measuring and analyzing its stress-strain responses. Next, different metal surface pretreatment methods were explored. These included sandblasting, Phosphoric Acid Anodizing (PAA), and AC-130 Sol-Gel treatment. Woven S-2 glass, an epoxy adhesive, and aluminum alloy sheet metal were used to fabricate restructured FMLs using time and cost effective procedures. Additional microscopy and tensile testing allowed for comparisons with GLARE and aircraft grade aluminum alloys. The restructured FMLs showed similar behaviors to GLARE with potential significant improvements in fabrication efficiency.

  7. Hygrothermal influence on delamination behavior of graphite/epoxy laminates

    Garg, A.; Ishai, O.

    1985-01-01

    The hygrothermal effect on the fracture behavior of graphite-epoxy laminates was investigated to develop a methodology for damage tolerance predictions in advanced composite materials. Several T300/934 laminates were tested using a number of specimen configurations to evaluate the effects of temperature and humidity on delamination fracture toughness under mode 1 and mode 2 loading. It is indicated that moisture has a slightly beneficial influence on fracture toughness or critical strain energy release rate during mode 1 delamination, but has a slightly deleterious effect on mode 2 delamination, and mode 1 transverse cracking. The failed specimens are examined by SEM and topographical differences due to fracture modes are identified. It is concluded that the effect of moisture on fracture topography can not be distinguished.

  8. Modelling low velocity impact induced damage in composite laminates

    Shi, Yu; Soutis, Constantinos

    2017-12-01

    The paper presents recent progress on modelling low velocity impact induced damage in fibre reinforced composite laminates. It is important to understand the mechanisms of barely visible impact damage (BVID) and how it affects structural performance. To reduce labour intensive testing, the development of finite element (FE) techniques for simulating impact damage becomes essential and recent effort by the composites research community is reviewed in this work. The FE predicted damage initiation and propagation can be validated by Non Destructive Techniques (NDT) that gives confidence to the developed numerical damage models. A reliable damage simulation can assist the design process to optimise laminate configurations, reduce weight and improve performance of components and structures used in aircraft construction.

  9. Germline PMS2 mutation screened by mismatch repair protein immunohistochemistry of colorectal cancer in Japan.

    Sugano, Kokichi; Nakajima, Takeshi; Sekine, Shigeki; Taniguchi, Hirokazu; Saito, Shinya; Takahashi, Masahiro; Ushiama, Mineko; Sakamoto, Hiromi; Yoshida, Teruhiko

    2016-11-01

    Germline PMS2 gene mutations were detected by RT-PCR/direct sequencing of total RNA extracted from puromycin-treated peripheral blood lymphocytes (PBL) and multiplex ligation-dependent probe amplification (MLPA) analyses of Japanese patients with colorectal cancer (CRC) fulfilling either the revised Bethesda Guidelines or being an age at disease onset of younger than 70 years, and screened by mismatch repair protein immunohistochemistry of formalin-fixed paraffin embedded sections. Of the 501 subjects examined, 7 (1.40%) showed the downregulated expression of the PMS2 protein alone and were referred to the genetic counseling clinic. Germline PMS2 mutations were detected in 6 (85.7%), including 3 nonsense and 1 frameshift mutations by RT-PCR/direct sequencing and 2 genomic deletions by MLPA. No mutations were identified in the other MMR genes (i.e. MSH2, MLH1 and MSH6). The prevalence of the downregulated expression of the PMS2 protein alone was 1.40% among the subjects examined and IHC results predicted the presence of PMS2 germline mutations. RT-PCR from puromycin-treated PBL and MLPA may be employed as the first screening step to detect PMS2 mutations without pseudogene interference, followed by the long-range PCR/nested PCR validation using genomic DNA. © 2016 The Authors. Cancer Science published by John Wiley & Sons Australia, Ltd on behalf of Japanese Cancer Association.

  10. The Fanconi anemia DNA damage repair pathway in the spotlight for germline predisposition to colorectal cancer.

    Esteban-Jurado, Clara; Franch-Expósito, Sebastià; Muñoz, Jenifer; Ocaña, Teresa; Carballal, Sabela; López-Cerón, Maria; Cuatrecasas, Miriam; Vila-Casadesús, Maria; Lozano, Juan José; Serra, Enric; Beltran, Sergi; Brea-Fernández, Alejandro; Ruiz-Ponte, Clara; Castells, Antoni; Bujanda, Luis; Garre, Pilar; Caldés, Trinidad; Cubiella, Joaquín; Balaguer, Francesc; Castellví-Bel, Sergi

    2016-10-01

    Colorectal cancer (CRC) is one of the most common neoplasms in the world. Fanconi anemia (FA) is a very rare genetic disease causing bone marrow failure, congenital growth abnormalities and cancer predisposition. The comprehensive FA DNA damage repair pathway requires the collaboration of 53 proteins and it is necessary to restore genome integrity by efficiently repairing damaged DNA. A link between FA genes in breast and ovarian cancer germline predisposition has been previously suggested. We selected 74 CRC patients from 40 unrelated Spanish families with strong CRC aggregation compatible with an autosomal dominant pattern of inheritance and without mutations in known hereditary CRC genes and performed germline DNA whole-exome sequencing with the aim of finding new candidate germline predisposition variants. After sequencing and data analysis, variant prioritization selected only those very rare alterations, producing a putative loss of function and located in genes with a role compatible with cancer. We detected an enrichment for variants in FA DNA damage repair pathway genes in our familial CRC cohort as 6 families carried heterozygous, rare, potentially pathogenic variants located in BRCA2/FANCD1, BRIP1/FANCJ, FANCC, FANCE and REV3L/POLZ. In conclusion, the FA DNA damage repair pathway may play an important role in the inherited predisposition to CRC.

  11. Oyster vasa-like gene as a marker of the germline cell development in Crassostrea gigas

    Fabioux, C.; Huvet, A.; Lelong, C.; Robert, R.; Pouvreau, S.; Daniel, J.Y.; Minguant, C.; Le Pennec, M.

    2004-01-01

    The oyster vasa-like gene was previously demonstrated to be specifically expressed in germline cells of adult oysters Crassostrea gigas. In the present study, this gene was used as a molecular marker to establish the developmental pattern of germline cells during oyster ontogenesis, using whole-mount in situ hybridization and real-time PCR. The Oyvlg transcripts appeared to be localized to the vegetal pole of unfertilized oocytes and maternally transmitted to embryos. At early development, these maternal transcripts were observed to segregate into a single blastomere, from the CD macromere of 2-cell stage to the 4d mesentoblast of blastula. From late blastula stage, the mesentoblast divided into two cell clumps that migrated to both sides of the larvae body and that would correspond to primordial germ cells (PGCs). Based on these results, we postulate that the germline of C. gigas is specified at early development by maternal cytoplasmic determinants including Oyvlg mRNAs, in putative PGCs that would differentiate into germinal stem cells in juvenile oysters

  12. Neurotransmitter Transporter-Like: a male germline-specific SLC6 transporter required for Drosophila spermiogenesis.

    Nabanita Chatterjee

    2011-01-01

    Full Text Available The SLC6 class of membrane transporters, known primarily as neurotransmitter transporters, is increasingly appreciated for its roles in nutritional uptake of amino acids and other developmentally specific functions. A Drosophila SLC6 gene, Neurotransmitter transporter-like (Ntl, is expressed only in the male germline. Mobilization of a transposon inserted near the 3' end of the Ntl coding region yields male-sterile mutants defining a single complementation group. Germline transformation with Ntl cDNAs under control of male germline-specific control elements restores Ntl/Ntl homozygotes to normal fertility, indicating that Ntl is required only in the germ cells. In mutant males, sperm morphogenesis appears normal, with elongated, individualized and coiled spermiogenic cysts accumulating at the base of the testes. However, no sperm are transferred to the seminal vesicle. The level of polyglycylation of Ntl mutant sperm tubulin appears to be significantly lower than that of wild type controls. Glycine transporters are the most closely related SLC6 transporters to Ntl, suggesting that Ntl functions as a glycine transporter in developing sperm, where augmentation of the cytosolic pool of glycine may be required for the polyglycylation of the massive amounts of tubulin in the fly's giant sperm. The male-sterile phenotype of Ntl mutants may provide a powerful genetic system for studying the function of an SLC6 transporter family in a model organism.

  13. Fitness loss and germline mutations in barn swallows breeding in Chernobyl

    Ellegren, Hans; Lindgren, Gabriella; Primmer, C.R. [Swedish Univ. of Agricultural Sciences, Animal Breeding and Genetics Dept., Uppsala (Sweden); Moeller, A.P. [Universite Pierre et Marie Curie. Lab. d`Ecologie, Paris, 75 (France)

    1997-10-09

    The severe nuclear accident at Chernobyl in 1986 resulted in the worst reported accidental exposure of radioactive material to free-living organisms. Short-term effects on human populations inhabiting polluted areas include increased incidence of thyroid cancer, infant leukaemia, and congenital malformations in newborns. Two recent studies have reported, although with some controversy, that germline mutation rates were increased in humans and voles living close to Chernobyl, but little is known about the viability of the organisms affected. Here we report an increased frequency of partial albinism, a morphological aberration associated with a loss of fitness, among barn swallows, Hirundo rustica, breeding close to Chernobyl. Heretability estimates indicate that mutations causing albinism were at least partly of germline origin. Furthermore, evidence for an increased germline mutation rate was obtained from segregation analysis at two hypervariable microsatellite loci, indicating that mutation events in barn swallows from Chernobyl were two- to tenfold higher than in birds from control areas in Ukraine and Italy. (author).

  14. Fitness loss and germline mutations in barn swallows breeding in Chernobyl

    Ellegren, Hans; Lindgren, Gabriella; Primmer, C.R.; Moeller, A.P.

    1997-01-01

    The severe nuclear accident at Chernobyl in 1986 resulted in the worst reported accidental exposure of radioactive material to free-living organisms. Short-term effects on human populations inhabiting polluted areas include increased incidence of thyroid cancer, infant leukaemia, and congenital malformations in newborns. Two recent studies have reported, although with some controversy, that germline mutation rates were increased in humans and voles living close to Chernobyl, but little is known about the viability of the organisms affected. Here we report an increased frequency of partial albinism, a morphological aberration associated with a loss of fitness, among barn swallows, Hirundo rustica, breeding close to Chernobyl. Heretability estimates indicate that mutations causing albinism were at least partly of germline origin. Furthermore, evidence for an increased germline mutation rate was obtained from segregation analysis at two hypervariable microsatellite loci, indicating that mutation events in barn swallows from Chernobyl were two- to tenfold higher than in birds from control areas in Ukraine and Italy. (author)

  15. A Mononucleotide Markers Panel to Identify hMLH1/hMSH2 Germline Mutations

    M. Pedroni

    2007-01-01

    Full Text Available Hereditary NonPolyposis Colorectal Cancer (Lynch syndrome is an autosomal dominant disease caused by germline mutations in a class of genes deputed to maintain genomic integrity during cell replication, mutations result in a generalized genomic instability, particularly evident at microsatellite loci (Microsatellite Instability, MSI. MSI is present in 85–90% of colorectal cancers that occur in Lynch Syndrome. To standardize the molecular diagnosis of MSI, a panel of 5 microsatellite markers was proposed (known as the “Bethesda panel”. Aim of our study is to evaluate if MSI testing with two mononucleotide markers, such as BAT25 and BAT26, was sufficient to identify patients with hMLH1/hMSH2 germline mutations. We tested 105 tumours for MSI using both the Bethesda markers and the two mononucleotide markers BAT25 and BAT26. Moreover, immunohistochemical evaluation of MLH1 and MSH2 proteins was executed on the tumours with at least one unstable microsatellite, whereas germline hMLH1/hMSH2 mutations were searched for all cases showing two or more unstable microsatellites.

  16. The Canonical E2Fs Are Required for Germline Development in Arabidopsis

    Xiaozhen Yao

    2018-05-01

    Full Text Available A number of cell fate determinations, including cell division, cell differentiation, and programmed cell death, intensely occur during plant germline development. How these cell fate determinations are regulated remains largely unclear. The transcription factor E2F is a core cell cycle regulator. Here we show that the Arabidopsis canonical E2Fs, including E2Fa, E2Fb, and E2Fc, play a redundant role in plant germline development. The e2fa e2fb e2fc (e2fabc triple mutant is sterile, although its vegetative development appears normal. On the one hand, the e2fabc microspores undergo cell death during pollen mitosis. Microspores start to die at the bicellular stage. By the tricellular stage, the majority of the e2fabc microspores are degenerated. On the other hand, a wild type ovule often has one megaspore mother cell (MMC, whereas the majority of e2fabc ovules have two to three MMCs. The subsequent female gametogenesis of e2fabc mutant is aborted and the vacuole is severely impaired in the embryo sac. Analysis of transmission efficiency showed that the canonical E2Fs from both male and female gametophyte are essential for plant gametogenesis. Our study reveals that the canonical E2Fs are required for plant germline development, especially the pollen mitosis and the archesporial cell (AC-MMC transition.

  17. Germline minisatellite mutations in workers occupationally exposed to radiation at the Sellafield nuclear facility

    Tawn, E Janet; Curwen, Gillian B; Rees, Gwen S; Jonas, Patricia

    2015-01-01

    Germline minisatellite mutation rates were investigated in male workers occupationally exposed to radiation at the Sellafield nuclear facility. DNA samples from 160 families with 255 offspring were analysed for mutations at eight hypervariable minisatellite loci (B6.7, CEB1, CEB15, CEB25, CEB36, MS1, MS31, MS32) by Southern hybridisation. No significant difference was observed between the paternal mutation rate of 5.0% (37 mutations in 736 alleles) for control fathers with a mean preconceptional testicular dose of 9 mSv and that of 5.8% (66 in 1137 alleles) for exposed fathers with a mean preconceptional testicular dose of 194 mSv. Subgrouping the exposed fathers into two dose groups with means of 111 mSv and 274 mSv revealed paternal mutation rates of 6.0% (32 mutations in 536 alleles) and 5.7% (34 mutations in 601 alleles), respectively, neither of which was significantly different in comparisons with the rate for the control fathers. Maternal mutation rates of 1.6% (12 mutations in 742 alleles) for the partners of control fathers and 1.7% (19 mutations in 1133 alleles) for partners of exposed fathers were not significantly different. This study provides evidence that paternal preconceptional occupational radiation exposure does not increase the germline minisatellite mutation rate and therefore refutes suggestions that such exposure could result in a destabilisation of the germline that can be passed on to future generations. (paper)

  18. The Landscape of Somatic Genetic Alterations in Breast Cancers From ATM Germline Mutation Carriers.

    Weigelt, Britta; Bi, Rui; Kumar, Rahul; Blecua, Pedro; Mandelker, Diana L; Geyer, Felipe C; Pareja, Fresia; James, Paul A; Couch, Fergus J; Eccles, Diana M; Blows, Fiona; Pharoah, Paul; Li, Anqi; Selenica, Pier; Lim, Raymond S; Jayakumaran, Gowtham; Waddell, Nic; Shen, Ronglai; Norton, Larry; Wen, Hannah Y; Powell, Simon N; Riaz, Nadeem; Robson, Mark E; Reis-Filho, Jorge S; Chenevix-Trench, Georgia

    2018-02-28

    Pathogenic germline variants in ataxia-telangiectasia mutated (ATM), a gene that plays a role in DNA damage response and cell cycle checkpoints, confer an increased breast cancer (BC) risk. Here, we investigated the phenotypic characteristics and landscape of somatic genetic alterations in 24 BCs from ATM germline mutation carriers by whole-exome and targeted sequencing. ATM-associated BCs were consistently hormone receptor positive and largely displayed minimal immune infiltrate. Although 79.2% of these tumors exhibited loss of heterozygosity of the ATM wild-type allele, none displayed high activity of mutational signature 3 associated with defective homologous recombination DNA (HRD) repair. No TP53 mutations were found in the ATM-associated BCs. Analysis of an independent data set confirmed that germline ATM variants and TP53 somatic mutations are mutually exclusive. Our findings indicate that ATM-associated BCs often harbor bi-allelic inactivation of ATM, are phenotypically distinct from BRCA1/2-associated BCs, lack HRD-related mutational signatures, and that TP53 and ATM genetic alterations are likely epistatic.

  19. Proven germline mosaicism in a father of two children with CHARGE syndrome.

    Pauli, S; Pieper, L; Häberle, J; Grzmil, P; Burfeind, P; Steckel, M; Lenz, U; Michelmann, H W

    2009-05-01

    CHARGE syndrome is an autosomal dominant malformation syndrome caused by mutations in the CHD7 gene. The majority of cases are sporadic and only few familial cases have been reported. In these families, mosaicism in one parent, as well as parent- to-child transmission of a CHD7 mutation, has been described. In some further cases, germline mosaicism has been suggested. Here, we report the first case in which germline mosaicism could be demonstrated in a father of two affected children with CHARGE syndrome. The truncating mutation c.7302dupA in exon 34 of the CHD7 gene was found in both affected children but was not detected in parental lymphocytes. However, in DNA extracted from the father's spermatozoa, the c.7302dupA mutation could be identified. Furthermore, mutation analysis of DNA isolated from 59 single spermatozoa revealed that the c.7302dupA mutation occurs in 16 spermatozoa, confirming germline mosaicism in the father of the affected children. This result has a high impact for genetic counselling of the family and for their recurrence risk in further pregnancies.

  20. Somatic and Germline Diversification of a Putative Immunoreceptor within One Phylum: Dscam in Arthropods.

    Brites, Daniela; Du Pasquier, Louis

    2015-01-01

    Arthropod Dscam, the homologue of the human Down Syndrome cell adhesion molecule, is a receptor used by the nervous and immune systems. Unlike in vertebrates, evolutionary pressure has selected and maintained a vast Dscam diversity of isoforms, known to specifying neuronal identity during the nervous system differentiation. This chapter examines the different modes of Dscam diversification in the context of arthropods' evolution and that of their immune system, where its role is controversial. In the single Dscam gene of insects and crustaceans, mutually exclusive alternative splicing affects three clusters of duplicated exons encoding the variable parts of the receptor. The Dscam gene produces over 10,000 isoforms. In the more basal arthropods such as centipedes, Dscam diversity results from a combination of many germline genes (over 80) with, in about half of those, the possibility of alternative splicing affecting only one exon cluster. In the even more basal arthropods, such as chelicerates, no splicing possibility is detected, but there exist dozens of germline Dscam genes. Compared to controlling the expression of multiple germline genes, the somatic mutually alternative splicing within a single gene may offer a simplified way of expressing a large Dscam repertoire. Expressed by hemocytes, Dscam is considered a phagocytic receptor but is also encountered in solution. More information is necessary about its binding to pathogens, its role in phagocytosis, its possible role in specifying hemocyte identity, its kinetics of expression, and the regulation of its RNA splicing to understand how its diversity is linked to immunity.

  1. Hermes (Rbpms is a Critical Component of RNP Complexes that Sequester Germline RNAs during Oogenesis

    Tristan Aguero

    2016-01-01

    Full Text Available The germ cell lineage in Xenopus is specified by the inheritance of germ plasm that assembles within the mitochondrial cloud or Balbiani body in stage I oocytes. Specific RNAs, such as nanos1, localize to the germ plasm. nanos1 has the essential germline function of blocking somatic gene expression and thus preventing Primordial Germ Cell (PGC loss and sterility. Hermes/Rbpms protein and nanos RNA co-localize within germinal granules, diagnostic electron dense particles found within the germ plasm. Previous work indicates that nanos accumulates within the germ plasm through a diffusion/entrapment mechanism. Here we show that Hermes/Rbpms interacts with nanos through sequence specific RNA localization signals found in the nanos-3′UTR. Importantly, Hermes/Rbpms specifically binds nanos, but not Vg1 RNA in the nucleus of stage I oocytes. In vitro binding data show that Hermes/Rbpms requires additional factors that are present in stage I oocytes in order to bind nanos1. One such factor may be hnRNP I, identified in a yeast-2-hybrid screen as directly interacting with Hermes/Rbpms. We suggest that Hermes/Rbpms functions as part of a RNP complex in the nucleus that facilitates selection of germline RNAs for germ plasm localization. We propose that Hermes/Rbpms is required for nanos RNA to form within the germinal granules and in this way, participates in the germline specific translational repression and sequestration of nanos RNA.

  2. Hermes (Rbpms) is a Critical Component of RNP Complexes that Sequester Germline RNAs during Oogenesis.

    Aguero, Tristan; Zhou, Yi; Kloc, Malgorzata; Chang, Patrick; Houliston, Evelyn; King, Mary Lou

    2016-03-01

    The germ cell lineage in Xenopus is specified by the inheritance of germ plasm that assembles within the mitochondrial cloud or Balbiani body in stage I oocytes. Specific RNAs, such as nanos1 , localize to the germ plasm. nanos1 has the essential germline function of blocking somatic gene expression and thus preventing Primordial Germ Cell (PGC) loss and sterility. Hermes/Rbpms protein and nanos RNA co-localize within germinal granules, diagnostic electron dense particles found within the germ plasm. Previous work indicates that nanos accumulates within the germ plasm through a diffusion/entrapment mechanism. Here we show that Hermes/Rbpms interacts with nanos through sequence specific RNA localization signals found in the nanos -3'UTR. Importantly, Hermes/Rbpms specifically binds nanos , but not Vg1 RNA in the nucleus of stage I oocytes. In vitro binding data show that Hermes/Rbpms requires additional factors that are present in stage I oocytes in order to bind nanos1 . One such factor may be hnRNP I, identified in a yeast-2-hybrid screen as directly interacting with Hermes/Rbpms. We suggest that Hermes/Rbpms functions as part of a RNP complex in the nucleus that facilitates selection of germline RNAs for germ plasm localization. We propose that Hermes/Rbpms is required for nanos RNA to form within the germinal granules and in this way, participates in the germline specific translational repression and sequestration of nanos RNA .

  3. Production of germline transgenic prairie voles (Microtus ochrogaster) using lentiviral vectors.

    Donaldson, Zoe R; Yang, Shang-Hsun; Chan, Anthony W S; Young, Larry J

    2009-12-01

    The study of alternative model organisms has yielded tremendous insights into the regulation of behavioral and physiological traits not displayed by more widely used animal models, such as laboratory rats and mice. In particular, comparative approaches often exploit species ideally suited for investigating specific phenomenon. For instance, comparative studies of socially monogamous prairie voles and polygamous meadow voles have been instrumental toward gaining an understanding of the genetic and neurobiological basis of social bonding. However, laboratory studies of less commonly used organisms, such as prairie voles, have been limited by a lack of genetic tools, including the ability to manipulate the genome. Here, we show that lentiviral vector-mediated transgenesis is a rapid and efficient approach for creating germline transgenics in alternative laboratory rodents. Injection of a green fluorescent protein (GFP)-expressing lentiviral vector into the perivitelline space of 23 single-cell embryos yielded three live offspring (13 %), one of which (33%) contained germline integration of a GFP transgene driven by the human ubiquitin-C promoter. In comparison, transfer of 23 uninjected embryos yielded six live offspring (26%). Green fluorescent protein is present in all tissues examined and is expressed widely in the brain. The GFP transgene is heritable and stably expressed until at least the F(2) generation. This technology has the potential to allow investigation of specific gene candidates in prairie voles and provides a general protocol to pursue germline transgenic manipulation in many different rodent species.

  4. Fatigue damage mechanism and strength of woven laminates

    Xiao, J.; Bathias, C.

    1993-01-01

    The apparent secant stiffness changes with the cyclic number for both unnotched and notched woven laminated specimens (two orthotropic and one quasi-isotropic) during tensile fatigue test at a fixed ratio of maximum fatigue load to UTS were observed. The observable damage initiation and evolution as a function of the cyclic number were directly measured at the notched specimen surface with a video-camera system. The fatigue strengths of the unnotched and notched specimens were determined. The results show that the normalized apparent secant stiffness change curves as a function of cyclic numbers can be divided into three stages. For the first and the second stages in notched specimens and for total life of unnotched specimens, the damage has not been evidently observed and certainly verified with the traditional experimental methods such as radiography and microscopy although many acoustic emission signals can be obtained. The last stage for the notched specimens (N/Nf>0.4, the secant stiffness decreases fast) corresponds to the initiation and evolution of the observable damages. The fatigue strength of these woven composite laminates is dominated by the third stage during which the observable damage develops along the specimen ligament until fracture. During the third stage, a critical dimension at the specimen ligament and a life threshold can be found beyond which a final catastrophic fracture will immediately occur. The quasi-isotropic laminate is of a fatigue strength lower than the two orthotropic laminates of which the fatigue strengths are approaching to each other. The fatigue life is also influenced by the stacking sequences. (orig.)

  5. On the stabilization of viscoelastic laminated beams with interfacial slip

    Mustafa, Muhammad I.

    2018-04-01

    In this paper, we consider a viscoelastic laminated beam model. This structure is given by two identical uniform layers on top of each other, taking into account that an adhesive of small thickness is bonding the two surfaces and produces an interfacial slip. We use viscoelastic damping with general assumptions on the relaxation function and establish explicit energy decay result from which we can recover the optimal exponential and polynomial rates. Our result generalizes the earlier related results in the literature.

  6. Development and Application of Optimization Techniques for Composite Laminates.

    1983-09-01

    Institute of Technolgy Air University in Partial Fulfillment of the Requirements for the Degree of Master of Science by Gerald V. Flanagan, S.B. Lt. USAF...global minima [9]. An informal definition of convexity is that any two points in the space can be connected by a straight line which does not pass out of...question. A quick look at gradient information suggests that too few angles (2 for example) will make the laminate sensitive to small changes in

  7. Capacitive short circuit detection in transformer core laminations

    Schulz, Carl A.; Duchesne, Stephane; Roger, Daniel; Vincent, Jean-Noel

    2008-01-01

    A capacitive measurement procedure is proposed that serves to detect burr-induced short circuits in transformer core laminations. The tests are conducted on stacks of transformer steel sheets as used for transformer core production and yield a short-circuit probability indicative of the additional eddy current losses to be expected. Applied during the assembly of transformer cores, the measurements can help to decide whether the burr treatment process is working efficiently or has to be readjusted

  8. Estimation of piezoelastic and viscoelastic properties in laminated structures

    Araujo, A. L.; Soares, C. M. Mota; Herskovits, J.

    2009-01-01

    An inverse method for material parameter estimation of elastic, piezoelectric and viscoelastic laminated plate structures is presented. The method uses a gradient based optimization technique in order to solve the inverse problem, through minimization of an error functional which expresses...... the difference between experimental free vibration data and corresponding numerical data produced by a finite element model. The complex modulus approach is used to model the viscoelastic material behavior, assuming hysteretic type damping. Applications that illustrate the influence of adhesive material...

  9. Structural Laminate Aluminum-Glass-Fiber Materials 1441-Sial

    Shestov, V. V.; Antipov, V. V.; Senatorova, O. G.; Sidel'nikov, V. V.

    2014-01-01

    The structure, composition and set of properties of specimens and components, and some parameters of the process of production of a promising FML class of metallic polymers based on sheets of high-modulus ( E 79 GPa) alloy 1441 with reduced density ( d 2.6 g/cm3) and an optimized glued prepreg reinforced with fibers of high-strength high-modulus VMPglass are described. Results of fire and fatigue tests of a promising 1441-SIAL structural laminate are presented.

  10. A failure scenario of ceramic laminates with strong interfaces

    Náhlík, Luboš; Štegnerová, Kateřina; Máša, Bohuslav; Hutař, Pavel

    2016-01-01

    Roč. 167, NOV (2016), s. 56-67 ISSN 0013-7944 R&D Projects: GA ČR GA15-09347S; GA MŠk LM2015069 Institutional support: RVO:68081723 Keywords : Damage mechanism * Ceramic laminates * Residual stresses * Strain energy density factor * Crack propagation direction Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 2.151, year: 2016 http://www.sciencedirect.com/science/article/pii/S0013794416301783

  11. 3D Guided Wave Motion Analysis on Laminated Composites

    Tian, Zhenhua; Leckey, Cara; Yu, Lingyu

    2013-01-01

    Ultrasonic guided waves have proved useful for structural health monitoring (SHM) and nondestructive evaluation (NDE) due to their ability to propagate long distances with less energy loss compared to bulk waves and due to their sensitivity to small defects in the structure. Analysis of actively transmitted ultrasonic signals has long been used to detect and assess damage. However, there remain many challenging tasks for guided wave based SHM due to the complexity involved with propagating guided waves, especially in the case of composite materials. The multimodal nature of the ultrasonic guided waves complicates the related damage analysis. This paper presents results from parallel 3D elastodynamic finite integration technique (EFIT) simulations used to acquire 3D wave motion in the subject laminated carbon fiber reinforced polymer composites. The acquired 3D wave motion is then analyzed by frequency-wavenumber analysis to study the wave propagation and interaction in the composite laminate. The frequency-wavenumber analysis enables the study of individual modes and visualization of mode conversion. Delamination damage has been incorporated into the EFIT model to generate "damaged" data. The potential for damage detection in laminated composites is discussed in the end.

  12. Connections: Superplasticity, Damascus Steels, Laminated Steels, and Carbon Dating

    Wadsworth, Jeffrey

    2016-12-01

    In this paper, a description is given of the connections that evolved from the initial development of a family of superplastic plain carbon steels that came to be known as Ultra-High Carbon Steels (UHCS). It was observed that their very high carbon contents were similar, if not identical, to those of Damascus steels. There followed a series of attempts to rediscover how the famous patterns found on Damascus steels blades were formed. At the same time, in order to improve the toughness at room temperature of the newly-developed UHCS, laminated composites were made of alternating layers of UHCS and mild steel (and subsequently other steels and other metals). This led to a study of ancient laminated composites, the motives for their manufacture, and the plausibility of some of the claims relating to the number of layers in the final blades. One apparently ancient laminated composite, recovered in 1837 from the great pyramid of Giza which was constructed in about 2750 B.C., stimulated a carbon dating study of ancient steels. The modern interest in "Bladesmithing" has connections back to many of these ancient weapons.

  13. β-Catenin is critical for cerebellar foliation and lamination.

    Jing Wen

    Full Text Available The cerebellum has a conserved foliation pattern and a well-organized layered structure. The process of foliation and lamination begins around birth. β-catenin is a downstream molecule of Wnt signaling pathway, which plays a critical role in tissue organization. Lack of β-catenin at early embryonic stages leads to either prenatal or neonatal death, therefore it has been difficult to resolve its role in cerebellar foliation and lamination. Here we used GFAP-Cre to ablate β-catenin in neuronal cells of the cerebellum after embryonic day 12.5, and found an unexpected role of β-catenin in determination of the foliation pattern. In the mutant mice, the positions of fissure formation were changed, and the meninges were improperly incorporated into fissures. At later stages, some lobules were formed by Purkinje cells remaining in deep regions of the cerebellum and the laminar structure was dramatically altered. Our results suggest that β-catenin is critical for cerebellar foliation and lamination. We also found a non cell-autonomous role of β-catenin in some developmental properties of major cerebellar cell types during specific stages.

  14. Minimality of invariant laminations for partially hyperbolic attractors

    Nobili, Felipe

    2015-01-01

    Let f : M → M be a C 1 -diffeomorphism over a compact boundaryless Riemannian manifold M, and Λ a compact f-invariant subset of M admitting a partially hyperbolic spliting T f Λ = E s  ⊕ E c  ⊕ E u over the tangent bundle T f Λ. It's known from the Hirsch–Pugh–Shub theory that Λ admits two invariant laminations associated to the extremal bundles E s and E u . These laminations are families of dynamically defined immersed submanifolds of the M tangent, respectively, to the bundles E s and E u at every point in Λ. In this work, we prove that at least one of the invariant laminations of a transitive partially hyperbolic attractor with a one-dimensional center bundle is minimal: the orbit of every leaf intersects Λ densely. This result extends those in Bonatti et al (2002 J. Inst. Math. Jussieu 1 513–41) and Hertz et al (2007 Fields Institute Communications vol 51 (Providence, RI: American Mathematical Society) pp 103–9) about minimal foliations for robustly transitive diffeomorphisms. (paper)

  15. Structural Analysis of Composite Laminates using Analytical and Numerical Techniques

    Sanghi Divya

    2016-01-01

    Full Text Available A laminated composite material consists of different layers of matrix and fibres. Its properties can vary a lot with each layer’s or ply’s orientation, material property and the number of layers itself. The present paper focuses on a novel approach of incorporating an analytical method to arrive at a preliminary ply layup order of a composite laminate, which acts as a feeder data for the further detailed analysis done on FEA tools. The equations used in our MATLAB are based on analytical study code and supply results that are remarkably close to the final optimized layup found through extensive FEA analysis with a high probabilistic degree. This reduces significant computing time and saves considerable FEA processing to obtain efficient results quickly. The result output by our method also provides the user with the conditions that predicts the successive failure sequence of the composite plies, a result option which is not even available in popular FEM tools. The predicted results are further verified by testing the laminates in the laboratory and the results are found in good agreement.

  16. Studies in Cup Drawing Behavior of Polymer Laminated Sheet Metal

    Elnagmi, M.; Jain, M.; Bruhis, M.; Nielsen, K.

    2011-08-01

    Axisymmetric deep drawing behavior of a polymer laminated sheet metal (PLSM) is investigated using an axisymmetric cup drawing test. PLSMs are of interest as a replacement for painted finishes for automotive applications as they have the potential to achieve good quality long lasting and aesthetically appealing surfaces on stamped parts. However, there is limited understanding of PLSMs in automotive deep drawing situations to produce complex 3-D parts. The tests are carried out using well-controlled, laboratory-based, dual-action, servo-hydraulic forming presses under blank-holder force and punch displacement control conditions. An optical strain mapping system is used to measure the surface strains (and to construct 3D strain maps) from the film side of the deformed samples for a range of forming conditions. Deep drawing characteristics such as punch load versus punch displacement traces, strain distribution along the cup profile, flange wrinkling and fracture characteristics are experimentally assessed for stainless steel-plastic film laminated sheet materials. Also the effect of lamination pressure on wrinkling and delamination is investigated for a decorative pressure sensitive adhesive film affixed to the stainless steel sheet.

  17. Parametric study on patch repaired CFRP laminates using FEA

    Kashfuddoja, M.; Ramji, M. [Indian Institute of Technology. Engineering Optics Lab. Dept. of Mechanical Engineering, Hyderabad (India)

    2012-07-01

    Carbon fibre reinforced plastic (CFRP) composite laminates have become popular for structural applications as they are lighter, stronger and tougher. Composite structures are also susceptible to damage while in service. For improved service life, the damage needs to be repaired so that repair structure integrity is enhanced. Various parameters like patch size and shape, it's layup sequence and adhesive thickness would influence the performance of the repaired structure. In present work, a parametric study is carried out using finite element analysis (FEA) to investigate the influence of various parameters involved in composite repair. The panel is made of carbon / epoxy composite laminate with stacking sequence of (0/{+-}45/900)s and is subjected to tensile load. Damaged CFRP laminates is repaired by symmetrical patch adhesively bonded over the damaged area. Circular patch of different stacking sequence and size is considered. Influence of adhesive material and it's thickness on repair efficiency is also investigated. The influence of various repair parameters on peel stress is also analysed. (Author)

  18. Curing of Thick Thermoset Composite Laminates: Multiphysics Modeling and Experiments

    Anandan, S.; Dhaliwal, G. S.; Huo, Z.; Chandrashekhara, K.; Apetre, N.; Iyyer, N.

    2017-11-01

    Fiber reinforced polymer composites are used in high-performance aerospace applications as they are resistant to fatigue, corrosion free and possess high specific strength. The mechanical properties of these composite components depend on the degree of cure and residual stresses developed during the curing process. While these parameters are difficult to determine experimentally in large and complex parts, they can be simulated using numerical models in a cost-effective manner. These simulations can be used to develop cure cycles and change processing parameters to obtain high-quality parts. In the current work, a numerical model was built in Comsol MultiPhysics to simulate the cure behavior of a carbon/epoxy prepreg system (IM7/Cycom 5320-1). A thermal spike was observed in thick laminates when the recommended cure cycle was used. The cure cycle was modified to reduce the thermal spike and maintain the degree of cure at the laminate center. A parametric study was performed to evaluate the effect of air flow in the oven, post cure cycles and cure temperatures on the thermal spike and the resultant degree of cure in the laminate.

  19. Fatigue crack growth in fiber-metal laminates

    Ma, YuE; Xia, ZhongChun; Xiong, XiaoFeng

    2014-01-01

    Fiber-metal laminates (FMLs) consist of three layers of aluminum alloy 2024-T3 and two layers of glass/epoxy prepreg, and it (it means FMLs) is laminated by Al alloy and fiber alternatively. Fatigue crack growth rates in notched fiber-metal laminates under constant amplitude fatigue loading were studied experimentally and numerically and were compared with them in monolithic 2024-T3 Al alloy plates. It is shown that the fatigue life of FMLs is about 17 times longer than monolithic 2024-T3 Al alloy plate; and crack growth rates in FMLs panels remain constant mostly even when the crack is long, unlike in the monolithic 2024-T3 Al alloy plates. The formula to calculate bridge stress profiles of FMLs was derived based on the fracture theory. A program by Matlab was developed to calculate the distribution of bridge stress in FMLs, and then fatigue growth lives were obtained. Finite element models of FMLs were built and meshed finely to analyze the stress distributions. Both results were compared with the experimental results. They agree well with each other.

  20. Damage in woven CFRP laminates under impact loading

    Ullah, H.; Harland, A. R.; Silberschmidt, V. V.

    2012-08-01

    Carbon fibre-reinforced polymer (CFRP) composites used in sports products can be exposed to different in-service conditions such as large dynamic bending deformations caused by impact loading. Composite materials subjected to such loads demonstrate various damage modes such as matrix cracking, delamination and, ultimately, fabric fracture. Damage evolution affects both in-service properties and performance of CFRP that can deteriorate with time. These failure modes need adequate means of analysis and investigation, the major approaches being experimental characterisation and numerical simulations. This research deals with a deformation behaviour and damage in composite laminates due to dynamic bending. Experimental tests are carried out to characterise the behaviour of a woven CFRP material under large-deflection dynamic bending in impact tests carried out to obtain the force-time and absorbed energy profiles for CFRP laminates. Damage in the impacted laminates is analysed using optical microscopy. Numerical simulations are performed to study the deformation behaviour and damage in CFRP for cases of large-deflection bending based on three-dimensional finite-element models implemented in the commercial code Abaqus/Explicit. Multiple layers of bilinear cohesive-zone elements are employed to model the initiation and progression of inter-ply delamination observed in the microscopy studies. The obtained results of simulations show good agreement with experimental data.

  1. The shock response of float-glass laminates

    Bourne, N.K.

    2005-01-01

    Interfaces within glass targets give rise to variations in the mode of failure of material components. The wide use of such laminates merits further investigation of the failure mechanism. It is already known that when shocked above a threshold of 4 GPa, glass fails under compression behind a propagating front following the compression front. Work is presented which indicates how this failure process is altered by bonding together two plates to introduce an interface, rather than leaving a monolithic target. After crossing an internal interface, the failure wave propagates only after a delay in soda-lime glass and the failed strength of the material is increased at the inner interface compared with that at the impact face. Addition of a second interface illustrates these effects. Recent work has shown that failure of more than two plates bonded together during impact shapes the pulse transmitted through materials. Indeed it has been suggested that glass sheets bonded together show some of the features of polycrystalline brittle materials. In this work, the stress has been monitored at different stations in the laminate to ascertain the effect of varying the number of tiles within the laminate. It is found that the pulse rises to ca. 4 GPa quickly and then is ramped more gradually as the number of glass sheets is increased

  2. BSRF-3B3 Medium Energy X-ray Beamline and Its Application for XAFS Research

    Ma Chenyan; Cui Mingqi; Zhou Kejin; Zhao Yidong; Tian Yulian; Wu Ziyu; Zheng Lei; Zhu Jie; Zhao Jia; Chen Kai; Sun Lijuan

    2007-01-01

    A new medium X-ray beamline 3B3 covering energy from 1.2 keV up to 6.0 keV was built at Beijing Synchrotron Radiation Facility (BSRF) in 2005. With perfect capability of high monochromaticity, good focus and low harmonics, it could be applied to study metrology, optic component characteristics and medium X-ray absorption spectroscopy (XAS). A simple XAFS apparatus has been set up and some measurements such as S, P, Cl, Ca, Al, Mg K-edge X-ray absorption fine structure (XAFS) in their compounds have also been carried out. The results show that it is feasible to do XAFS research at 3B3 beamline under present condition. The fabrication of a more delicate medium XAFS spectrometer is underway including transmission, fluorescence and electronic yield modes

  3. Modeling amorphous Si3B3N7: Structure and elastic properties

    Hannemann, A.; Schoen, J.C.; Jansen, M.; Putz, H.; Lengauer, T.

    2004-01-01

    We investigate the structure and elastic properties of the amorphous high-temperature ceramic a-Si 3 B 3 N 7 . Several different structural models are generated and their properties such as the radial and angular distribution functions, the degree of local order, the density, the bulk modulus and the phonon spectrum, are calculated and compared with the experiment. The best structural agreement between model and experimental observations is found for models exhibiting a certain degree of local ( 3 B 3 N 7 has not been synthesized by cooling from the melt but via the polymerization and subsequent pyrolysis of molecular precursors. Furthermore, we suggest that, due to the synthesis process, stable nanoscale cavities (diameter 3 )

  4. Detection of mismatch repair gene germline mutation carrier among Chinese population with colorectal cancer

    Jin, Hei-Ying; Zhao, Ronghua; Liu, Xiufang; Li, Vicky Ka Ming; Ding, Yijiang; Yang, Bolin; Geng, Jianxiang; Lai, Rensheng; Ding, Shuqing; Ni, Min

    2008-01-01

    Hereditary nonpolyposis colorectal cancer (HNPCC) is an autosomal dominant syndrome. The National Cancer Institute (NCI) has recommended the Revised Bethesda guidelines for screening HNPCC. There has been a great deal of research on the value of these tests in other countries. However, literature about the Chinese population is scarce. Our objective is to detect and study microsatellite instability (MSI) and mismatch repair (MMR) gene germline mutation carriers among a Chinese population with colorectal cancer. In 146 prospectively recruited consecutive patients with clinically proven colorectal cancer, MSI carriers were identified by analysis of tumor tissue using multiplex fluorescence polymerase chain reaction (PCR) using the NCI recommended panel and classified into microsatellite instability-low (MSI-L), microsatellite instability-high (MSI-H) and microsatellite stable (MSS) groups. Immunohistochemical staining for MSH2, MSH6 and MLH1 on tissue microarrays (TMAs) was performed, and methylation of the MLH1 promoter was analyzed by quantitative methylation specific PCR (MSP). Germline mutation analysis of blood samples was performed for MSH2, MSH6 and MLH1 genes. Thirty-four out of the 146 colorectal cancers (CRCs, 23.2%) were MSI, including 19 MSI-H CRCs and 15 MSI-L CRCS. Negative staining for MSH2 was found in 8 CRCs, negative staining for MSH6 was found in 6 CRCs. One MSI-H CRC was negative for both MSH6 and MSH2. Seventeen CRCs stained negatively for MLH1. MLH1 promoter methylation was determined in 34 MSI CRCs. Hypermethylation of the MLH1 promoter occurred in 14 (73.7%) out of 19 MSI-H CRCs and 5 (33.3%) out of 15 MSI-L CRCs. Among the 34 MSI carriers and one MSS CRC with MLH1 negative staining, 8 had a MMR gene germline mutation, which accounted for 23.5% of all MSI colorectal cancers and 5.5% of all the colorectal cancers. Five patients harbored MSH2 germline mutations, and three patients harbored MSH6 germline mutations. None of the patients had an MLH

  5. Predictions of Poisson's ratio in cross-ply laminates containing matrix cracks and delaminations

    Harris, Charles E.; Allen, David H.; Nottorf, Eric W.

    1989-01-01

    A damage-dependent constitutive model for laminated composites has been developed for the combined damage modes of matrix cracks and delaminations. The model is based on the concept of continuum damage mechanics and uses second-order tensor valued internal state variables to represent each mode of damage. The internal state variables are defined as the local volume average of the relative crack face displacements. Since the local volume for delaminations is specified at the laminate level, the constitutive model takes the form of laminate analysis equations modified by the internal state variables. Model implementation is demonstrated for the laminate engineering modulus E(x) and Poisson's ratio nu(xy) of quasi-isotropic and cross-ply laminates. The model predictions are in close agreement to experimental results obtained for graphite/epoxy laminates.

  6. Lamin A/C-dependent interaction with 53BP1 promotes cellular responses to DNA damage

    Gibbs-Seymour, Ian; Markiewicz, Ewa; Bekker-Jensen, Simon

    2015-01-01

    Lamins A/C have been implicated in DNA damage response pathways. We show that the DNA repair protein 53BP1 is a lamin A/C binding protein. In undamaged human dermal fibroblasts (HDF), 53BP1 is a nucleoskeleton protein. 53BP1 binds to lamins A/C via its Tudor domain, and this is abrogated by DNA...... damage. Lamins A/C regulate 53BP1 levels and consequently lamin A/C-null HDF display a 53BP1 null-like phenotype. Our data favour a model in which lamins A/C maintain a nucleoplasmic pool of 53BP1 in order to facilitate its rapid recruitment to sites of DNA damage and could explain why an absence...

  7. Thymoma (World Health Organization type B3) with neuroendocrine differentiation in multiple endocrine neoplasia type 1

    Tomita, Masaki; Ichiki, Nobuhiko; Ayabe, Takanori; Tanaka, Hiroyuki; Kataoka, Hiroaki; Nakamura, Kunihide

    2017-01-01

    Abstract Thymic epithelial tumors occur in 1?5% of patients with multiple endocrine neoplasia type 1 (MEN 1). Majority of these thymic epithelial tumors are thymic carcinoids and patients with thymoma in MEN 1 is rare. Furthermore, thymoma with neuroendocrine differentiation was also rarely reported. Herein, we report a 68-year-old man having type B3 thymoma with neuroendocrine differentiation in MEN 1 and to the best of our knowledge this is the first such case ever reported.

  8. Measles outbreak linked to European B3 outbreaks, Wales, United Kingdom, 2017.

    Currie, Jonny; Davies, Llion; McCarthy, Joanne; Perry, Malorie; Moore, Catherine; Cottrell, Simon; Bowley, Mererid; Williams, Chris; Shankar, Ananda Giri; Stiff, Rhianwen

    2017-10-01

    The United Kingdom achieved interrupted endemic measles transmission for 36 months in 2016. Despite this, ongoing challenges from sporadic measles cases typically imported from abroad remain. We summarise a B3 measles genotype outbreak in south-east Wales occurring between May and September 2017, linked with other European outbreaks, and lessons learnt. Seventeen confirmed cases and one probable case occurred principally in education and healthcare-settings. Six confirmed cases attended healthcare settings when infectious, without being isolated.

  9. Vibrational thermodynamics of Fe90Zr7B3 nanocrystalline alloy from nuclear inelastic scattering

    Stankov, S.; Miglierini, M.; Chumakov, A. I.

    2010-01-01

    Recently we determined the iron-partial density of vibrational states (DOS) of nanocrystalline Fe(90)Zr(7)B(3) (Nanoperm), synthesized by crystallization of an amorphous precursor, for various stages of nanocrystallization separating the DOS of the nanograins from that of the interfaces [S. Stank......, vibrational entropy, and lattice specific heat as the material transforms from amorphous, through nanocrystalline, to fully crystallized state. The reported results shed new light on the previously observed anomalies in the vibrational thermodynamics of nanocrystalline materials....

  10. checkCIF/PLATON report Datablock: b3_0m

    As a result the full set of tests cannot be run. No syntax errors found. CIF dictionary Interpreting this report. Datablock: b3_0m. Bond precision: C-C = 0.0207 A. Wavelength=0.71073. Cell: a=11.0782(11) b=6.6521(7) c=12.1645(12) alpha=90 beta=101.798(4) gamma=90. Temperature: 296 K. Calculated. Reported. Volume.

  11. Theoretical study of B3-to-B1 phase transition in ZnS

    Li, Qiang; Zhang, Rui; Lv, Tianquan; Cao, Qilong

    2016-01-01

    The pressure-induced phase transformation from B3 to B1 structures in ZnS using first-principle projector-augmented wave method is studied. To understand the nature and driving force behind the transition, the interesting properties in both phases, including enthalpy, phonon dispersion curves and elastic constants, are systematically investigated. The results show that the calculated transition pressure is within the range of 16.33 GPa to 19.04 GPa, which is in good agreement with the available experimental and theoretical data. The transition process can be viewed as the appearance and disappearance of very slight lattice distortion accompanied by the movement of Zn and S atoms along the [111] crystallographic axis. The physical driving force of the B3–B1 phase transition is confirmed to be a coupling effect between the mechanical instability of B3 phase under pressure and the softening acoustic phonon mode resulting from the pressure-induced lattice deformation. For B1 phase, it is further predicted that a new phase transition takes place at about 59.9 GPa. - Highlights: • The phase transformation from B3 to B1 structures in ZnS is studied using first-principle method. • The predicted transition pressure is within the range of 16.33 to 19.04 GPa. • The transition process can be viewed as the appearance and disappearance of very slight lattice distortion. • Physical driving force of the transition is a coupling effect between the mechanical instability and softening phonon. • For B1 phase, it is further predicted that a new phase transition takes place at about 59.9 GPa.

  12. Expression of OATP1B3 determines uptake of Gd-EOB-DTPA in hepatocellular carcinoma

    Narita, Masato; Hatano, Etsuro; Arizono, Shigeki; Miyagawa-Hayashino, Aya; Isoda, Hiroyoshi; Kitamura, Koji; Yasuchika, Kentaro; Nitta, Takashi; Uemoto, Shinji

    2009-01-01

    Background: Gadolinium-ethoxybenzyl-diethylenetriamine pentaacetic acid (Gd-EOB-DTPA) is an MRI contrast agent with perfusion and hepatoselective properties. The purpose of the study was to examine uptake of Gd-EOB-DTPA in the hepatobiliary phase in hepatocellular carcinoma (HCC). Methods: A retrospective analysis of 22 patients with HCC who underwent preoperative Gd-EOB-DTPA-enhanced MRI was performed. Enhancement ratios (ERs) and expression levels of the organic anion transporter (OATP) 1B3...

  13. Developmental expression of "germline"- and "sex determination"-related genes in the ctenophore Mnemiopsis leidyi.

    Reitzel, Adam M; Pang, Kevin; Martindale, Mark Q

    2016-01-01

    An essential developmental pathway in sexually reproducing animals is the specification of germ cells and the differentiation of mature gametes, sperm and oocytes. The "germline" genes vasa, nanos and piwi are commonly identified in primordial germ cells, suggesting a molecular signature for the germline throughout animals. However, these genes are also expressed in a diverse set of somatic stem cells throughout the animal kingdom leaving open significant questions for whether they are required for germline specification. Similarly, members of the Dmrt gene family are essential components regulating sex determination and differentiation in bilaterian animals, but the functions of these transcription factors, including potential roles in sex determination, in early diverging animals remain unknown. The phylogenetic position of ctenophores and the genome sequence of the lobate Mnemiopsis leidyi motivated us to determine the compliment of these gene families in this species and determine expression patterns during development. Our phylogenetic analyses of the vasa, piwi and nanos gene families show that Mnemiopsis has multiple genes in each family with multiple lineage-specific paralogs. Expression domains of Mnemiopsis nanos, vasa and piwi, during embryogenesis from fertilization to the cydippid stage, were diverse, with little overlapping expression and no or little expression in what we think are the germ cells or gametogenic regions. piwi paralogs in Mnemiopsis had distinct expression domains in the ectoderm during development. We observed overlapping expression domains in the apical organ and tentacle apparatus of the cydippid for a subset of "germline genes," which are areas of high cell proliferation, suggesting that these genes are involved with "stem cell" specification and maintenance. Similarly, the five Dmrt genes show diverse non-overlapping expression domains, with no clear evidence for expression in future gametogenic regions of the adult. We also

  14. Field performance of timber bridges. 9, Big Erick`s stress-laminated deck bridge

    J. A. Kainz; J. P. Wacker; M. Nelson

    The Big Erickas bridge was constructed during September 1992 in Baraga County, Michigan. The bridge is 72 ft long, 16 ft wide, and consists of three simple spans: two stress-laminated deck approach spans and a stress-laminated box center span. The bridge is unique in that it is one of the first known stress-laminated timber bridge applications to use Eastern Hemlock...

  15. Field performance of timber bridges. 13, Mohawk Canal stress-laminated bridge

    P. D. Hilbrich Lee; X. Lauderdale

    The Mohawk Canal bridge was constructed in August 1994, just outside Roll, Arizona. It is a simple-span, double-lane, stress-laminated deck superstructure, approximately 6.4 m (21 ft) long and 10.4 m (34 ft) wide and constructed with Combination 16F-V3 Douglas Fir glued-laminated timber beam laminations. The performance of the bridge was monitored continuously for 2...

  16. Instantaneous mechanical fastening of quasi-isotropic CFRP laminates by a self-piercing rivet

    上田, 政人; 三宅, 崇太郎; 長谷川, 寛幸; 平野, 義鎭; Ueda, Masahito; Miyake, Sotaro; Hasegawa, Hiroyuki; Hirano, Yoshiyasu

    2012-01-01

    A modified self-piercing rivet (SPR) has been proposed to mechanically fasten CFRP laminates. The modified SPR consists of a rivet body and two flat washers. The two flat washers were used to suppress delamination in the CFRP laminates at the point of piercing. The advantages of the modified SPR for fastening CFRP laminates are instantaneous process time and low cost. Any pretreatments such as surface treatments or hole drilling are not required. In this study, the viability of the modified S...

  17. Field performance of stress-laminated timber bridges on low-volume roads

    M. A. Ritter; J. P. Wacker; S. R. Duwadi

    1995-01-01

    Stress-laminated timber bridges were first introduced in the United States in the late 1980s. Since that time, the concept of stress-laminating has received a great deal of attention and hundreds of bridges have been built. Most of these bridges are located on rural low-volume roads. To evaluate the performance of stress-laminated bridges, the United States Department...

  18. Numerical evaluation of delamination in CFRP laminates by stereo X-ray pictures

    Kunoo, Kazuo; Uda, Nobuhide; Ono, Kousei; Onohara, Kaoru; Takahashi, Toshiaki; Tanaka, Hisahiro.

    1989-01-01

    This paper presents a method for quantifying damage in composite laminates by stereo X-ray pictures. A three dimensional image of delamination, which is one of the characteristic types of damage in composite laminates can be reconstructed with this method. A digital image processing technique is used to analyze X-ray pictures. Experimental results of reconstructing delaminations in carbon/epoxy cross-ply laminates show that this method is accurate enough for practical usage. (author)

  19. Synergetic effects of thin plies and aligned carbon nanotube interlaminar reinforcement in composite laminates

    Arteiro, Albertino; Borstnar, Gregor; Mavrogordato, Mark N.; Sinclair, Ian; Spearing, S. Mark; Camanho, Pedro P.; Cohen, Estelle; Kopp, Reed Alan; Furtado Pereira da Silva, Carolina; Ni, Xinchen; Wardle, Brian L

    2017-01-01

    Thin-ply carbon fiber laminates have exhibited superior mechanical properties, including higher initiation and ultimate strength, when compared to standard thickness plies and enable greater flexibility in laminate design. However, the increased ply count in thin-ply laminates also increases the number of ply-ply interfaces, thereby increasing the number of relatively weak and delamination-prone interlaminar regions. In this study, we report the first experimental realization of aligned carbo...

  20. OGT (O-GlcNAc Transferase) Selectively Modifies Multiple Residues Unique to Lamin A.

    Simon, Dan N; Wriston, Amanda; Fan, Qiong; Shabanowitz, Jeffrey; Florwick, Alyssa; Dharmaraj, Tejas; Peterson, Sherket B; Gruenbaum, Yosef; Carlson, Cathrine R; Grønning-Wang, Line M; Hunt, Donald F; Wilson, Katherine L

    2018-05-17

    The LMNA gene encodes lamins A and C with key roles in nuclear structure, signaling, gene regulation, and genome integrity. Mutations in LMNA cause over 12 diseases ('laminopathies'). Lamins A and C are identical for their first 566 residues. However, they form separate filaments in vivo, with apparently distinct roles. We report that lamin A is β- O -linked N -acetylglucosamine- (O -GlcNAc)-modified in human hepatoma (Huh7) cells and in mouse liver. In vitro assays with purified O -GlcNAc transferase (OGT) enzyme showed robust O -GlcNAcylation of recombinant mature lamin A tails (residues 385⁻646), with no detectable modification of lamin B1, lamin C, or 'progerin' (Δ50) tails. Using mass spectrometry, we identified 11 O -GlcNAc sites in a 'sweet spot' unique to lamin A, with up to seven sugars per peptide. Most sites were unpredicted by current algorithms. Double-mutant (S612A/T643A) lamin A tails were still robustly O -GlcNAc-modified at seven sites. By contrast, O -GlcNAcylation was undetectable on tails bearing deletion Δ50, which causes Hutchinson⁻Gilford progeria syndrome, and greatly reduced by deletion Δ35. We conclude that residues deleted in progeria are required for substrate recognition and/or modification by OGT in vitro. Interestingly, deletion Δ35, which does not remove the majority of identified O -GlcNAc sites, does remove potential OGT-association motifs (lamin A residues 622⁻625 and 639⁻645) homologous to that in mouse Tet1. These biochemical results are significant because they identify a novel molecular pathway that may profoundly influence lamin A function. The hypothesis that lamin A is selectively regulated by OGT warrants future testing in vivo, along with two predictions: genetic variants may contribute to disease by perturbing OGT-dependent regulation, and nutrient or other stresses might cause OGT to misregulate wildtype lamin A.

  1. Environmental Effects on Flutter Characteristics of Laminated Composite Rectangular and Skew Panels

    T.V.R. Chowdary

    1996-01-01

    Full Text Available A finite element method is presented for predicting the flutter response of laminated composite panels subjected to moisture concentration and temperature. The analysis accounts for material properties at elevated temperature and moisture concentration. The analysis is based on the first-order approximation to the linear piston theory and laminated plate theory that includes shear deformation. Both rectangular and skew panels are considered. Stability boundaries at moisture concentrations and temperatures for various lamination schemes and boundary conditions are discussed.

  2. Investigation of Forming Performance of Laminated Steel Sheets Using Finite Element Analyses

    Liu Wenning; Sun Xin; Ruokolainen, Robert; Gayden Xiaohong

    2007-01-01

    Laminated steel sheets have been used in automotive structures for reducing in-cabin noise. However, due to the marked difference in material properties of the different laminated layers, integrating laminated steel parts into the manufacturing processes can be challenging. Especially, the behavior of laminated sheets during forming processes is very different from that of monolithic steel sheets. During the deep-draw forming process, large shear deformation and corresponding high interfacial stress may initiate and propagate interfacial cracks between the core polymer and the metal skin, hence degrading the performance of the laminated sheets. In this paper, the formability of the laminated steel sheets is investigated by means of numerical analysis. The goal of this work is to gain insight into the relationship between the individual properties of the laminated sheet layers and the corresponding formability of the laminated sheet as a whole, eventually leading to reliable design and successful forming process development of such materials. Finite element analyses of laminate sheet forming are presented. Effects of polymer core thickness and viscoelastic properties of the polymer core, as well as punching velocity, are also investigated

  3. The Effect of Thermal Lamination Processes on Colorimetric Change in Spot Colours

    Eduard Galić

    2015-03-01

    Full Text Available Understanding the effect of laminating processes on spot colours is of great importance in the offset printing process, especially given the application versatility of spot colours. Laminating process, as a very common process and one of the first in a sequence of finishing processes in graphics production, can affect print’s visual impression to varying degrees. Spot colours, as mixtures of different ratios of inks, are subject to a change due to matt or gloss lamination process. The research examined the impact of thermal lamination processes on printed spot colours on different printing substrates. The degree of change on prints caused by laminating films in the thermal process was determined using spectrophotometric and densitometric methods. Particular emphasis is placed on the spot colour because of its specific characteristics. Research results are shown in charts and they are showing clearly the modality and the extent laminating processes effect the colorimetric difference in laminated and non-laminated prints. This scientific research provides objective conclusions that help in predicting the possible variations within the usage of laminating processes.

  4. Estimation of physical properties of laminated composites via the method of inverse vibration problem

    Balci, Murat [Dept. of Mechanical Engineering, Bayburt University, Bayburt (Turkmenistan); Gundogdu, Omer [Dept. of Mechanical Engineering, Ataturk University, Erzurum (Turkmenistan)

    2017-01-15

    In this study, estimation of some physical properties of a laminated composite plate was conducted via the inverse vibration problem. Laminated composite plate was modelled and simulated to obtain vibration responses for different length-to-thickness ratio in ANSYS. Furthermore, a numerical finite element model was developed for the laminated composite utilizing the Kirchhoff plate theory and programmed in MATLAB for simulations. Optimizing the difference between these two vibration responses, inverse vibration problem was solved to obtain some of the physical properties of the laminated composite using genetic algorithms. The estimated parameters are compared with the theoretical results, and a very good correspondence was observed.

  5. Estimation of physical properties of laminated composites via the method of inverse vibration problem

    Balci, Murat; Gundogdu, Omer

    2017-01-01

    In this study, estimation of some physical properties of a laminated composite plate was conducted via the inverse vibration problem. Laminated composite plate was modelled and simulated to obtain vibration responses for different length-to-thickness ratio in ANSYS. Furthermore, a numerical finite element model was developed for the laminated composite utilizing the Kirchhoff plate theory and programmed in MATLAB for simulations. Optimizing the difference between these two vibration responses, inverse vibration problem was solved to obtain some of the physical properties of the laminated composite using genetic algorithms. The estimated parameters are compared with the theoretical results, and a very good correspondence was observed

  6. Eddy-current effect on resonant magnetoelectric coupling in magnetostrictive-piezoelectric laminated composites

    Liu, Guoxi; Zhang, Chunli; Chen, Weiqiu; Dong, Shuxiang

    2013-07-01

    An analytical model of resonant magnetoelectric (ME) coupling in magnetostrictive (MS)-piezoelectric (PE) laminated composites in consideration of eddy-current effect in MS layer using equivalent circuit method is presented. Numerical calculations show that: (1) the eddy-current has a strong effect on ME coupling in MS-PE laminated composites at resonant frequency; and (2) the resonant ME coupling is then significantly dependent on the sizes of ME laminated composites, which were neglected in most previous theoretical analyses. The achieved results provide a theoretical guidance for the practice engineering design, manufacture, and application of ME laminated composites and devices.

  7. Meta-analysis of expression of l(3)mbt tumor-associated germline genes supports the model that a soma-to-germline transition is a hallmark of human cancers.

    Feichtinger, Julia; Larcombe, Lee; McFarlane, Ramsay J

    2014-05-15

    Evidence is starting to emerge indicating that tumorigenesis in metazoans involves a soma-to-germline transition, which may contribute to the acquisition of neoplastic characteristics. Here, we have meta-analyzed gene expression profiles of the human orthologs of Drosophila melanogaster germline genes that are ectopically expressed in l(3)mbt brain tumors using gene expression datasets derived from a large cohort of human tumors. We find these germline genes, some of which drive oncogenesis in D. melanogaster, are similarly ectopically activated in a wide range of human cancers. Some of these genes normally have expression restricted to the germline, making them of particular clinical interest. Importantly, these analyses provide additional support to the emerging model that proposes a soma-to-germline transition is a general hallmark of a wide range of human tumors. This has implications for our understanding of human oncogenesis and the development of new therapeutic and biomarker targets with clinical potential. © 2013 The Authors. Published by Wiley Periodicals, Inc. on behalf of UICC.

  8. Pré-resfriamento em água de lichia 'B3' mantida em armazenamento refrigerado Hydrocooling of 'B3' lychee fruit maintained in cold storage

    Juan Saavedra del Aguila

    2009-11-01

    Full Text Available Este experimento visou a estudar o efeito de diferentes temperaturas e tempos de pré-resfriamento em água sobre a qualidade de lichias 'B3', após a frigoconservação. Os tratamentos foram: T1 = controle (sem pré-resfriamento; T2 = imersão por cinco minutos em água a 2,5°C; T3 = imersão por 10 minutos em água a 2,5°C; T4 = imersão por 20 minutos em água a 2,5°C; T5 = imersão por sete minutos em água a 6°C; T6 = imersão por 20 minutos em água a 8°C e T7 = imersão por 10 minutos em água a 10°C. Após a aplicação dos respectivos tratamentos, os frutos foram acondicionados em filmes de polietileno de 24µm, selados e posteriormente armazenados a 5°C e 90% UR, por um período de sete dias, seguido por três dias de comercialização simulada a 20°C e 70% UR. O delineamento experimental foi inteiramente ao acaso, com tratamentos fatoriais de 7x3 (tratamentosxtempo. Foram utilizadas quatro repetições por tratamento, sendo cada uma composta por 150g de frutos. Determinaram-se: perda de massa fresca, coloração (L*, a e b, escurecimento (% e podridões (%. De acordo com os resultados, o pré-resfriamento com água reduz a percentagem de escurecimento, o decréscimo da luminosidade (L* e os valores de a. Por outro lado, esse tratamento favorece o surgimento de altos índices de podridão.This project studied the effects of different precooling temperatures and times with water on lychee 'B3' fruit quality cold storage. The treatments were: T1 = control (without precooling; T2 = immersed in water at 2.5°C for five minutes; T3 = immersed in water at 2.5°C for ten minutes; T4 = immersed in water at 2.5°C for 20 minutes; T5 = immersed in water at 6°C for seven minutes; T6 = immersed in water at 8°C for 20 minutes and T7 = immersed in water at 10°C for ten minutes. After treatments application, the fruits were then placed into polyethylene bags of 24µm, sealed, and stored for seven days at 5°C and 90% RH, plus 3 days at 20

  9. Long-term culture of chicken primordial germ cells isolated from embryonic blood and production of germline chimaeric chickens.

    Naito, Mitsuru; Harumi, Takashi; Kuwana, Takashi

    2015-02-01

    Production of germline chimaeric chickens by the transfer of cultured primordial germ cells (PGC) is a useful system for germline manipulation. A novel culture system was developed for chicken PGC isolated from embryonic blood. The isolated PGC were cultured on feeder cells derived from chicken embryonic fibroblast. The cultured PGC formed colonies and they proliferated about 300-times during the first 30 days. The cultured PGC retained the ability to migrate to recipient gonads and were also chicken VASA homologue (CVH)-positive. Female PGC were present in the mixed-sex PGC populations cultured for more than 90 days and gave rise to viable offspring efficiently via germline chimaeric chickens. Male cultured PGC were transferred to recipient embryos and produced putative chimaeric chickens. The DNA derived from the cultured PGC was detected in the sperm samples of male putative chimaeric chickens, but no donor derived offspring were obtained. Donor-derived offspring were also obtained from germline chimaeric chickens by the transfer of frozen-thawed cultured PGC. The culture method for PGC developed in the present study is useful for manipulation of the germline in chickens, such as preservation of genetic resources and gene transfer. Copyright © 2014 Elsevier B.V. All rights reserved.

  10. The role of germline promoters and I exons in cytokine-induced gene-specific class switch recombination.

    Dunnick, Wesley A; Shi, Jian; Holden, Victoria; Fontaine, Clinton; Collins, John T

    2011-01-01

    Germline transcription precedes class switch recombination (CSR). The promoter regions and I exons of these germline transcripts include binding sites for activation- and cytokine-induced transcription factors, and the promoter regions/I exons are essential for CSR. Therefore, it is a strong hypothesis that the promoter/I exons regions are responsible for much of cytokine-regulated, gene-specific CSR. We tested this hypothesis by swapping the germline promoter and I exons for the murine γ1 and γ2a H chain genes in a transgene of the entire H chain C-region locus. We found that the promoter/I exon for γ1 germline transcripts can direct robust IL-4-induced recombination to the γ2a gene. In contrast, the promoter/I exon for the γ2a germline transcripts works poorly in the context of the γ1 H chain gene, resulting in expression of γ1 H chains that is level. Nevertheless, the small amount of recombination to the chimeric γ1 gene is induced by IFN-γ. These results suggest that cytokine regulation of CSR, but not the magnitude of CSR, is regulated by the promoter/I exons.

  11. Asymmetric distribution of pl10 and bruno2, new members of a conserved core of early germline determinants in cephalochordates

    Simon eDailey

    2016-01-01

    Full Text Available Molecular fingerprinting of conserved germline and somatic ¨stemness¨ markers in different taxa have been key in defining the mechanism of germline specification (preformation or epigenesis, as well as expression domains of somatic progenitors. The distribution of molecular markers for primordial germ cells (PGCs, including vasa, nanos and piwil1, as well as Vasa antibody staining, support a determinative mechanism of germline specification in the cephalochordate Branchiostoma lanceolatum, similarly to other amphioxus species. pl10 and bruno2, but not bruno4/6, are also expressed in a pattern consistent with these other germline genes, adding to our repertoire of PGC markers in lancelets. Expression of nanos, vasa and the remaining markers (musashi, pufA, pufB, pumilio and piwil2 may define populations of putative somatic progenitors in the tailbud, the amphioxus posterior growth zone, or zones of proliferative activity. Finally, we also identify a novel expression domain for musashi, a classic neural stem cell marker, during notochord development in amphioxus. These results are discussed in the context of germline determination in other taxa, stem cell regulation and regenerative capacity in adult amphioxus.

  12. Identification of measles virus genotype B3 associated with outbreaks in Islamabad, Pakistan, 2013-2015.

    Zaidi, Syed Sohail Zahoor; Hameed, Abdul; Suleman Rana, Muhammad; Alam, Muhammad Masroor; Umair, Massab; Aamir, Uzma Bashir; Hussain, Maqbool; Sharif, Salmaan; Shaukat, Shahzad; Angez, Mehar; Khurshid, Adnan

    2017-11-09

    Measles virus infection remains a significant cause of childhood mortality and morbidity despite continued global efforts and the availability of a safe and effective vaccine. Molecular analysis of indigenous measles viruses could provide critical information on outbreak linkages and transmission pathways that can aid the implementation of appropriate control programs in Pakistan. Blood samples and throat swabs were collected from subjects suspected with measles in Islamabad, Pakistan from 2013 to 2015. Serum samples were tested for the presence of measles immunoglobulin M (IgM) antibodies using enzyme-linked immunosorbent assay (ELISA) while throat swabs were used for the isolation (Vero/SLAM cell line) and subsequent characterization and phylogenetic analysis of measles strains. Of 373 blood samples, 66% tested positive for measles IgM. Male subjects were more often infected (58%) than female (42%) with the highest frequency of positive cases (63%) in the 0-5-years age group. Among the positive cases, only 13% had received one or two doses of the measles vaccine, while 87% were unvaccinated. Of 80 throat swabs, 29 (36%) showed a measles virus-specific cytopathic effect (CPE) and were characterized as genotype B3 through partial sequencing of the nucleoprotein (N) gene. Phylogenetic analysis revealed the Pakistani B3 strains to be closely related to strains from neighboring countries (Iran and Afghanistan) as well as with B3 viruses from the USA, Germany, and the UK. The study results showed that despite the availability of an effective vaccine, the burden of measles infections is very high in Pakistan due to poor routine immunization coverage even in major cities, including the capital city of Islamabad. It is imperative that national health authorities take urgent strategic steps to improve routine immunization and implement adequate molecular identification methods to tackle future measles outbreaks. Copyright © 2017 The Authors. Published by Elsevier Ltd

  13. Interactions and encapsulation of vitamins C, B3, and B6 with dendrimers in water.

    Boisselier, Elodie; Liang, Liyuan; Dalko-Csiba, Maria; Ruiz, Jaime; Astruc, Didier

    2010-05-25

    Titrations of commercial diaminobutane (DAB) and polyamidoamine (PAMAM) dendrimers by vitamins C (ascorbic acid, AA), B(3) (nicotinic acid), and B(6) (pyridoxine) were monitored by (1)H NMR spectroscopy using the chemical shifts of both dendrimer and vitamin protons and analyzed by comparison with the titration of propylamine. Quaternarizations of the terminal primary amino groups and intradendritic tertiary amino groups, which are nearly quantitative with vitamin C, were characterized by more or less sharp variations (Deltadelta) of the (1)H chemical shift (delta) at the equivalence points. The peripheral primary amino groups of the DAB dendrimers were quaternarized first, but not selectively, whereas a sharp chemical-shift variation was recorded for the inner methylene protons near the tertiary amines, thereby indicating encapsulation, when all the dendritic amines were quaternarized. With DAB-G5-64-NH(2), some excess acid is required to protonate the inner amino groups, presumably because of basicity decrease due to excess charge repulsion. On the other hand, this selectivity was not observed with PAMAM dendrimers. The special case of the titration of the dendrimers by vitamin B(6) indicates only dominant supramolecular hydrogen-bonding interactions and no quaternarization, with core amino groups being privileged, which indicates the strong tendency to encapsulate vitamins. With vitamin B(3), a carboxylic acid, titration of DAB-G3-16-NH(2) shows that only six peripheral amino groups are protonated on average, even with excess vitamin B(3), because protonation is all the more difficult due to increased charge repulsion, as positive charges accumulate around the dendrimer. Inner amino groups interact with this vitamin, however, thus indicating encapsulation presumably with supramolecular hydrogen bonding without much charge transfer.

  14. Effect of shallow angles on compressive strength of biaxial and triaxial laminates.

    Jia, Hongli; Yang, Hyun-Ik

    2016-01-01

    Biaxial (BX) and triaxial (TX) composite laminates with ±45° angled plies have been widely used in wind turbine blades. As the scale of blades increases, BX and TX laminates with shallow-angled plies (i.e. off-axis ply angle shallow-angled BX and TX laminates are critical considering their locations in a wind turbine blade, and therefore in this study, the uniaxial static compression tests were conducted using BX and TX laminates with angled-plies of ±45°, ±35°, and ±25°, for the purpose of evaluation. On the other hand, Mori-Tanaka mean field homogenization method was employed to predict elastic constants of plies in BX and TX laminates involved in tests; linear regression analyses of experimentally measured ply strengths collected from various sources were then performed to estimate strengths of plies in BX and TX laminates; finally, Tsai-Wu, Hashin, and Puck failure criteria were chosen to predict compressive strengths of BX and TX laminates. Comparison between theoretical predictions and test results were carried out to illustrate the effectiveness of each criterion. The compressive strength of BX laminate decreases as ply angle increases, and the trend was successfully predicted by all three failure criteria. For TX laminates, ±35° angled plies rather than ±45° angled plies led to the lowest laminate compressive strength. Hashin and Puck criteria gave good predictions at certain ply angles for TX laminates, but Tsai-Wu criterion was able to capture the unexpected strength variation of TX laminates with ply angle. It was concluded that the transverse tensile stress in 0° plies of TX laminates, which attains its maximum when the off-axis ply angle is 35°, is the dominant factor in failure determination if using Tsai-Wu criterion. This explains the unexpected strength variation of TX laminates with ply angle, and also indicates that proper selection of ply angle is the key to fully utilizing the advantages of shallow-angled laminates.

  15. Lamin A reassembly at the end of mitosis is regulated by its SUMO-interacting motif

    Moriuchi, Takanobu; Kuroda, Masaki; Kusumoto, Fumiya; Osumi, Takashi; Hirose, Fumiko

    2016-01-01

    Modification of proteins with small ubiquitin-related modifier (SUMO; SUMOylation) is involved in the regulation of various biological processes. Recent studies have demonstrated that noncovalent associations between SUMOylated proteins and co-operative proteins containing SUMO-interacting motifs (SIMs) are important for the spatiotemporal organization of many protein complexes. In this study, we demonstrate that interactions between lamin A, a major component of the nuclear lamina, and SUMO isoforms are dependent on one of the four SIMs (SIM3) resided in lamin A polypeptide in vitro. Live cell imaging and immunofluorescence staining showed that SIM3 is required for accumulation of lamin A on the chromosomes during telophase, and subsequent evaluation of a panel of deletion mutants determined that a 156-amino acid region spanning the carboxyl-terminal Ig-fold domain of lamin A is sufficient for this accumulation. Notably, mutation of SIM3 abrogated the dephosphorylation of mitosis-specific phosphorylation at Ser-22 of lamin A, which normally occurs during telophase, and the subsequent nuclear lamina reorganization. Furthermore, expression of a conjugation-defective SUMO2 mutant, which was previously shown to inhibit endogenous SUMOylation in a dominant-negative manner, also impaired the accumulation of wild type lamin A on telophase chromosomes. These findings suggest that interactions between SIM3 of lamin A and a putative SUMO2-modified protein plays an important role in the reorganization of the nuclear lamina at the end of mitosis. - Highlights: • Lamin A interacts with SUMO2 via a SUMO-interacting motif (SIM) in the Ig domain. • SIM3 of lamin A is responsible for chromosomal accumulation during telophase. • A 156-aa region spanning the Ig domain is sufficient for chromosomal accumulation. • Accumulation of lamin A is required for timely dephosphorylation on chromosomes. • A putative SUMO2-modified protein may mediate chromosomal accumulation of lamin

  16. Lamin A reassembly at the end of mitosis is regulated by its SUMO-interacting motif

    Moriuchi, Takanobu; Kuroda, Masaki; Kusumoto, Fumiya; Osumi, Takashi; Hirose, Fumiko, E-mail: fhirose@sci.u-hyogo.ac.jp

    2016-03-01

    Modification of proteins with small ubiquitin-related modifier (SUMO; SUMOylation) is involved in the regulation of various biological processes. Recent studies have demonstrated that noncovalent associations between SUMOylated proteins and co-operative proteins containing SUMO-interacting motifs (SIMs) are important for the spatiotemporal organization of many protein complexes. In this study, we demonstrate that interactions between lamin A, a major component of the nuclear lamina, and SUMO isoforms are dependent on one of the four SIMs (SIM3) resided in lamin A polypeptide in vitro. Live cell imaging and immunofluorescence staining showed that SIM3 is required for accumulation of lamin A on the chromosomes during telophase, and subsequent evaluation of a panel of deletion mutants determined that a 156-amino acid region spanning the carboxyl-terminal Ig-fold domain of lamin A is sufficient for this accumulation. Notably, mutation of SIM3 abrogated the dephosphorylation of mitosis-specific phosphorylation at Ser-22 of lamin A, which normally occurs during telophase, and the subsequent nuclear lamina reorganization. Furthermore, expression of a conjugation-defective SUMO2 mutant, which was previously shown to inhibit endogenous SUMOylation in a dominant-negative manner, also impaired the accumulation of wild type lamin A on telophase chromosomes. These findings suggest that interactions between SIM3 of lamin A and a putative SUMO2-modified protein plays an important role in the reorganization of the nuclear lamina at the end of mitosis. - Highlights: • Lamin A interacts with SUMO2 via a SUMO-interacting motif (SIM) in the Ig domain. • SIM3 of lamin A is responsible for chromosomal accumulation during telophase. • A 156-aa region spanning the Ig domain is sufficient for chromosomal accumulation. • Accumulation of lamin A is required for timely dephosphorylation on chromosomes. • A putative SUMO2-modified protein may mediate chromosomal accumulation of lamin

  17. DFT/B3LYP study of tocopherols and chromans antioxidant action energetics

    Klein, Erik; Lukes, Vladimir; Ilcin, Michal

    2007-01-01

    Gas-phase reaction enthalpies related to the individual steps of three phenolic antioxidants action mechanisms - hydrogen atom transfer (HAT), single-electron transfer-proton transfer (SET-PT) and sequential proton loss electron transfer (SPLET) for four tocopherols and seven chromans - were calculated using DFT/B3LYP method. For α-tocopherol, one of the chromans and phenol, reaction enthalpies in water were computed. In comparison to gas phase, water causes severe changes in the energetics of studied compounds antioxidant action. From the thermodynamic point of view, entering SPLET mechanism represents the most probable process in water

  18. DFT/B3LYP study of tocopherols and chromans antioxidant action energetics

    Klein, Erik [Institute of Physical Chemistry and Chemical Physics, Slovak University of Technology, Radlinskeho 9, SK-812 37 Bratislava (Slovakia)], E-mail: erik.klein@stuba.sk; Lukes, Vladimir; Ilcin, Michal [Institute of Physical Chemistry and Chemical Physics, Slovak University of Technology, Radlinskeho 9, SK-812 37 Bratislava (Slovakia)

    2007-07-09

    Gas-phase reaction enthalpies related to the individual steps of three phenolic antioxidants action mechanisms - hydrogen atom transfer (HAT), single-electron transfer-proton transfer (SET-PT) and sequential proton loss electron transfer (SPLET) for four tocopherols and seven chromans - were calculated using DFT/B3LYP method. For {alpha}-tocopherol, one of the chromans and phenol, reaction enthalpies in water were computed. In comparison to gas phase, water causes severe changes in the energetics of studied compounds antioxidant action. From the thermodynamic point of view, entering SPLET mechanism represents the most probable process in water.

  19. Measles in Italy: Co-circulation of B3 variants during 2014.

    Magurano, Fabio; Baggieri, Melissa; Bordi, Licia; Lalle, Eleonora; Chironna, Maria; Lazzarotto, Tiziana; Amendola, Antonella; Baldanti, Fausto; Ansaldi, Filippo; Filia, Antonietta; Declich, Silvia; Iannazzo, Stefania; Pompa, Maria Grazia; Bucci, Paola; Marchi, Antonella; Nicoletti, Loredana

    2016-06-01

    In 2013, the majority of the WHO/EUR countries reported an annual incidence of >1 case per one million population indicating that the elimination target is far from being met. Thus, there is the urgent need to uncover and analyze chains of measles virus (MV) transmission with the objective to identify vulnerable groups and avoid possible routes of introduction of MV variants in the European population. The analysis of molecular epidemiology of MV B3 strains identified in 2014 has shown that four different variants co-circulated in Italy, including the strain that caused a cruise-line ship outbreak at the beginning of the year. © 2015 Wiley Periodicals, Inc.

  20. Internal oxidation of laminated ternary Ru–Ta–Zr coatings

    Chen, Yung-I, E-mail: yichen@mail.ntou.edu.tw; Lu, Tso-Shen

    2015-10-30

    Highlights: • Internal oxidation was observed in annealed and laminated Ru–Ta–Zr coatings. • The oxidized Ru–Ta–Zr coatings comprised three alternately stacked sublayers. • Correlated variations of O{sup 2-} and Zr{sup 4+} binding energies were verified in XPS spectra. - Abstract: Researchers have observed the internal oxidation phenomenon in binary alloy coatings when developing refractory alloy coatings for protective purposes by conducting annealing at high temperatures and in oxygen-containing atmospheres. The coatings were assembled using cyclical gradient concentration deposition during cosputtering by employing a substrate holder rotating at a slow speed. The internally oxidized zone demonstrated a laminated structure, comprising alternating oxygen-rich and oxygen-deficient layers stacked in a general orientation. In the current study, Ru–Ta–Zr coatings were prepared with various stacking sequences during cosputtering. The Ru–Ta–Zr coatings were annealed at 600 °C in an atmosphere continuously purged with 1% O{sub 2}–99% Ar mixed gas for 30 min. A transmission electron microscope was used to examine the periods of the laminated layers and crystallinity of the annealed coatings. Depth profiles produced using an Auger electron spectroscope and X-ray photoelectron spectroscope were used to certify the periodic variation of the related constituents and chemical states of the elements, respectively. The results indicate that the internally oxidized ternary coatings are stacked of Ru-, Ta{sub 2}O{sub 5}-, and ZrO{sub 2}-dominant sublayers and that the stacking sequences of the sublayers affect the crystalline structure of the coatings. Zr is oxidized preferentially in the Ru–Ta–Zr coatings, increasing the surface hardness of the oxidized coatings.

  1. Formation of germline chimera Gaok chicken used circulation primordial germ cells (circulation PGCs fresh and thawed

    Kostaman T

    2014-03-01

    Full Text Available Formation of germline chimeras by transfer of chicken primordial germ cells (PGCs is one of the effective techniques for preservation and regeneration of genetic resources in chickens. This study attempted to form germline chimeras of Gaok chicken buy purifying circulated PGCs of donor embryo before it is transferred to the recipient (White Leghorn chickens=WL and studied the ability of recipient embryo on survival in incubators, and hatchability. This study used 200 fertile eggs of Gaok and 90 fertile WL breed all of the eggs was incubated at 380C and 60% humidity in a portable incubator. PGCs-circulation of the blood collected Gaok embryos at stage 14-16 were taken from the dorsal aorta, and then purified by centrifugation method using nycodenz. PGCs-circulation results further purification frozen in liquid nitrogen before being transferred to the recipient embryo. The results showed that for the development of embryos transferred to the fresh circulation of PGCs-circulation as many as 25 cells can survive up to day 14, while one of the transferred of 50 and 100 cells into recipient embryos was hatched (10%. On the contrari recipient embryos that are transferred to the frozen PGCs-circulation the embryos development was shorter, and only survived until day 10th (treatment 25 cells, day 14th (treatment of 50 cells and day 17th (treatment of 100 cells. It is concluded that the amount of PGCs-circulation embryos transferred to the recipient is one factor that influence the success of the development germline chimeras.

  2. Genetic and genomic analysis modeling of germline c-MYC overexpression and cancer susceptibility

    Nunes Virginia

    2008-01-01

    Full Text Available Abstract Background Germline genetic variation is associated with the differential expression of many human genes. The phenotypic effects of this type of variation may be important when considering susceptibility to common genetic diseases. Three regions at 8q24 have recently been identified to independently confer risk of prostate cancer. Variation at 8q24 has also recently been associated with risk of breast and colorectal cancer. However, none of the risk variants map at or relatively close to known genes, with c-MYC mapping a few hundred kilobases distally. Results This study identifies cis-regulators of germline c-MYC expression in immortalized lymphocytes of HapMap individuals. Quantitative analysis of c-MYC expression in normal prostate tissues suggests an association between overexpression and variants in Region 1 of prostate cancer risk. Somatic c-MYC overexpression correlates with prostate cancer progression and more aggressive tumor forms, which was also a pathological variable associated with Region 1. Expression profiling analysis and modeling of transcriptional regulatory networks predicts a functional association between MYC and the prostate tumor suppressor KLF6. Analysis of MYC/Myc-driven cell transformation and tumorigenesis substantiates a model in which MYC overexpression promotes transformation by down-regulating KLF6. In this model, a feedback loop through E-cadherin down-regulation causes further transactivation of c-MYC. Conclusion This study proposes that variation at putative 8q24 cis-regulator(s of transcription can significantly alter germline c-MYC expression levels and, thus, contribute to prostate cancer susceptibility by down-regulating the prostate tumor suppressor KLF6 gene.

  3. Intraovarian Transplantation of Female Germline Stem Cells Rescue Ovarian Function in Chemotherapy-Injured Ovaries.

    Jiaqiang Xiong

    Full Text Available Early menopause and infertility often occur in female cancer patients after chemotherapy (CTx. For these patients, oocyte/embryo cryopreservation or ovarian tissue cryopreservation is the current modality for fertility preservation. However, the above methods are limited in the long-term protection of ovarian function, especially for fertility preservation (very few females with cancer have achieved pregnancy with cryopreserved ovarian tissue or eggs until now. In addition, the above methods are subject to their scope (females with no husband or prepubertal females with no mature oocytes. Thus, many females who suffer from cancers would not adopt the above methods pre- and post-CTx due to their uncertainty, safety and cost-effectiveness. Therefore, millions of women have achieved long-term survival after thorough CTx treatment and have desired to rescue their ovarian function and fertility with economic, durable and reliable methods. Recently, some studies showed that mice with infertility caused by CTx can produce normal offspring through intraovarian injection of exogenous female germline stem cells (FGSCs. Though exogenous FGSC can be derived from mice without immune rejection in the same strain, it is difficult to obtain human female germline stem cells (hFGSCs, and immune rejection could occur between different individuals. In this study, infertility in mice was caused by CTx, and the ability of FGSCs to restore ovarian function or even produce offspring was assessed. We had successfully isolated and purified the FGSCs from adult female mice two weeks after CTx. After infection with GFP-carrying virus, the FGSCs were transplanted into ovaries of mice with infertility caused by CTx. Finally, ovarian function was restored and the recipients produced offspring long-term. These findings showed that mice with CTx possessed FGSCs, restoring ovarian function and avoiding immune rejection from exogenous germline stem cells.

  4. Intraovarian Transplantation of Female Germline Stem Cells Rescue Ovarian Function in Chemotherapy-Injured Ovaries.

    Xiong, Jiaqiang; Lu, Zhiyong; Wu, Meng; Zhang, Jinjin; Cheng, Jing; Luo, Aiyue; Shen, Wei; Fang, Li; Zhou, Su; Wang, Shixuan

    2015-01-01

    Early menopause and infertility often occur in female cancer patients after chemotherapy (CTx). For these patients, oocyte/embryo cryopreservation or ovarian tissue cryopreservation is the current modality for fertility preservation. However, the above methods are limited in the long-term protection of ovarian function, especially for fertility preservation (very few females with cancer have achieved pregnancy with cryopreserved ovarian tissue or eggs until now). In addition, the above methods are subject to their scope (females with no husband or prepubertal females with no mature oocytes). Thus, many females who suffer from cancers would not adopt the above methods pre- and post-CTx due to their uncertainty, safety and cost-effectiveness. Therefore, millions of women have achieved long-term survival after thorough CTx treatment and have desired to rescue their ovarian function and fertility with economic, durable and reliable methods. Recently, some studies showed that mice with infertility caused by CTx can produce normal offspring through intraovarian injection of exogenous female germline stem cells (FGSCs). Though exogenous FGSC can be derived from mice without immune rejection in the same strain, it is difficult to obtain human female germline stem cells (hFGSCs), and immune rejection could occur between different individuals. In this study, infertility in mice was caused by CTx, and the ability of FGSCs to restore ovarian function or even produce offspring was assessed. We had successfully isolated and purified the FGSCs from adult female mice two weeks after CTx. After infection with GFP-carrying virus, the FGSCs were transplanted into ovaries of mice with infertility caused by CTx. Finally, ovarian function was restored and the recipients produced offspring long-term. These findings showed that mice with CTx possessed FGSCs, restoring ovarian function and avoiding immune rejection from exogenous germline stem cells.

  5. Repression of germline RNAi pathways in somatic cells by retinoblastoma pathway chromatin complexes.

    Xiaoyun Wu

    Full Text Available The retinoblastoma (Rb tumor suppressor acts with a number of chromatin cofactors in a wide range of species to suppress cell proliferation. The Caenorhabditis elegans retinoblastoma gene and many of these cofactors, called synMuv B genes, were identified in genetic screens for cell lineage defects caused by growth factor misexpression. Mutations in many synMuv B genes, including lin-35/Rb, also cause somatic misexpression of the germline RNA processing P granules and enhanced RNAi. We show here that multiple small RNA components, including a set of germline-specific Argonaute genes, are misexpressed in the soma of many synMuv B mutant animals, revealing one node for enhanced RNAi. Distinct classes of synMuv B mutants differ in the subcellular architecture of their misexpressed P granules, their profile of misexpressed small RNA and P granule genes, as well as their enhancement of RNAi and the related silencing of transgenes. These differences define three classes of synMuv B genes, representing three chromatin complexes: a LIN-35/Rb-containing DRM core complex, a SUMO-recruited Mec complex, and a synMuv B heterochromatin complex, suggesting that intersecting chromatin pathways regulate the repression of small RNA and P granule genes in the soma and the potency of RNAi. Consistent with this, the DRM complex and the synMuv B heterochromatin complex were genetically additive and displayed distinct antagonistic interactions with the MES-4 histone methyltransferase and the MRG-1 chromodomain protein, two germline chromatin regulators required for the synMuv phenotype and the somatic misexpression of P granule components. Thus intersecting synMuv B chromatin pathways conspire with synMuv B suppressor chromatin factors to regulate the expression of small RNA pathway genes, which enables heightened RNAi response. Regulation of small RNA pathway genes by human retinoblastoma may also underlie its role as a tumor suppressor gene.

  6. Germline HVR-II mitochondrial polymorphisms associated with breast cancer in Tunisian women.

    Yacoubi Loueslati, B; Troudi, W; Cherni, L; Rhomdhane, K B; Mota-Vieira, L

    2010-08-31

    A high incidence of somatic mtDNA polymorphisms has been reported in a wide variety of human cancers; some of them have been proposed as markers for the early detection of breast cancer. However, little attention has been paid to the potential of germline mitochondrial sequence variations as genetic risk factors for cancer. We performed a case-control study of 70 unrelated Tunisian women with breast cancer and 80 healthy age- and gender-matched blood donors, taking into account clinicopathological data, to evaluate germline polymorphism of mitochondrial HVR-II region as a genetic risk factor for breast cancer. Through direct sequencing, we detected 351 polymorphisms in controls and 248 variants in patients, with 47 and 39 segregating sites, respectively. In both groups, more than 50% of the polymorphisms were due to four variants: 315 ins C, 309 ins C, 263 A>G, and 73 A>G. The HVR-II sequences were also classified into haplotypes on the basis of the polymorphisms. Fifty-nine different haplotypes were found, 20 of them shared between patients and controls. Both groups had specific haplotypes, 18 in breast cancer patients and 21 in controls. Statistical analysis revealed a weak protective effect against breast cancer risk for two mitochondrial polymorphisms - 152 T>C (odds ratio (OR) = 0.33, 95% confidence interval (CI) = 0.12-0.91) and 263 A>G (OR = 0.17, 95%CI = 0.06-0.47). In contrast, an increased risk of breast cancer was detected for the 315+C haplotype (OR = 11.66, 95%CI = 1.44-252.23). We conclude that mitochondrial variants can affect breast cancer risk. More extensive studies, involving different types of cancer and patients with different genetic makeup, will be required to improve our understanding of the effects of germline mtDNA polymorphisms on carcinogenesis.

  7. Understanding the role of p53 in adaptive response to radiation-induced germline mutations

    Langlois, N.L.; Quinn, J.S.; Somers, C.M.; Boreham, D.R.; Mitchel, R.E.J.

    2003-01-01

    Full text: Radiation-induced adaptive response is now a widely studied area of radiation biology. Studies have demonstrated reduced levels of radiation-induced biological damage when an 'adaptive dose' is given before a higher 'challenge dose' compared to when the challenge dose is given alone. It has been shown in some systems to be a result of inducible cellular repair systems. The adaptive response has been clearly demonstrated in many model systems, however its impact on heritable effects in the mammalian germline has never been studied. Expanded Simple Tandem Repeat (ESTR) loci have been used as markers demonstrating that induced heritable mutations in mice follow a dose-response relationship. Recent data in our laboratory show preliminary evidence of radiation-induced adaptive response suppressing germline mutations at ESTR loci in wild type mice. The frequency of heritable mutations was significantly reduced when a priming dose of 0.1 Gy was given 24 hours prior to a 1 Gy acute challenging dose. We are now conducting a follow-up study to attempt to understand the mechanism of this adaptive response. P53 is known to play a significant role in governing apoptosis, DNA repair and cancer induction. In order to determine what function p53 has in the adaptive response for heritable mutations, we have mated radiation treated Trp53+/- male mice (C57Bl) to untreated, normal females (C57Bl). Using DNA fingerprinting, we are investigating the rate of inherited radiation-induced mutations on pre- and post-meiotic radiation-treated gametocytes by examining mutation frequencies in offspring DNA. If p53 is integral in the mechanism of adaptive response, we should not see an adaptive response in radiation-induced heritable mutations in these mice. This research is significant in that it will provide insight to understanding the mechanism behind radiation-induced adaptive response in the mammalian germline

  8. Use of Germline Polymorphisms in Predicting Concurrent Chemoradiotherapy Response in Esophageal Cancer

    Chen, Pei-Chun; Chen, Yen-Ching; Lai, Liang-Chuan; Tsai, Mong-Hsun; Chen, Shin-Kuang; Yang, Pei-Wen; Lee, Yung-Chie; Hsiao, Chuhsing K.; Lee, Jang-Ming; Chuang, Eric Y.

    2012-01-01

    Purpose: To identify germline polymorphisms to predict concurrent chemoradiation therapy (CCRT) response in esophageal cancer patients. Materials and Methods: A total of 139 esophageal cancer patients treated with CCRT (cisplatin-based chemotherapy combined with 40 Gy of irradiation) and subsequent esophagectomy were recruited at the National Taiwan University Hospital between 1997 and 2008. After excluding confounding factors (i.e., females and patients aged ≥70 years), 116 patients were enrolled to identify single nucleotide polymorphisms (SNPs) associated with specific CCRT responses. Genotyping arrays and mass spectrometry were used sequentially to determine germline polymorphisms from blood samples. These polymorphisms remain stable throughout disease progression, unlike somatic mutations from tumor tissues. Two-stage design and additive genetic models were adopted in this study. Results: From the 26 SNPs identified in the first stage, 2 SNPs were found to be significantly associated with CCRT response in the second stage. Single nucleotide polymorphism rs16863886, located between SGPP2 and FARSB on chromosome 2q36.1, was significantly associated with a 3.93-fold increase in pathologic complete response to CCRT (95% confidence interval 1.62–10.30) under additive models. Single nucleotide polymorphism rs4954256, located in ZRANB3 on chromosome 2q21.3, was associated with a 3.93-fold increase in pathologic complete response to CCRT (95% confidence interval 1.57–10.87). The predictive accuracy for CCRT response was 71.59% with these two SNPs combined. Conclusions: This is the first study to identify germline polymorphisms with a high accuracy for predicting CCRT response in the treatment of esophageal cancer.

  9. Prospective Evaluation of Germline Alterations in Patients With Exocrine Pancreatic Neoplasms.

    Lowery, Maeve A; Wong, Winston; Jordan, Emmet J; Lee, Jonathan W; Kemel, Yelena; Vijai, Joseph; Mandelker, Diana; Zehir, Ahmet; Capanu, Marinela; Salo-Mullen, Erin; Arnold, Angela G; Yu, Kenneth H; Varghese, Anna M; Kelsen, David P; Brenner, Robin; Kaufmann, Erica; Ravichandran, Vignesh; Mukherjee, Semanti; Berger, Michael F; Hyman, David M; Klimstra, David S; Abou-Alfa, Ghassan K; Tjan, Catherine; Covington, Christina; Maynard, Hannah; Allen, Peter J; Askan, Gokce; Leach, Steven D; Iacobuzio-Donahue, Christine A; Robson, Mark E; Offit, Kenneth; Stadler, Zsofia K; O'Reilly, Eileen M

    2018-02-28

    Identification of pathogenic germline alterations (PGAs) has important clinical and therapeutic implications in pancreas cancer. We performed comprehensive germline testing (GT) in an unselected prospective cohort of patients with exocrine pancreatic neoplasms with genotype and phenotype association to facilitate identification of prognostic and/or predictive biomarkers and examine potential therapeutic implications. Six hundred fifteen unselected patients with exocrine pancreatic neoplasms were prospectively consented for somatic tumor and matched sample profiling for 410-468 genes. GT for PGAs in 76 genes associated with cancer susceptibility was performed in an "identified" manner in 356 (57.9%) patients and in an "anonymized" manner in 259 (42.1%) patients, using an institutional review board-approved protocol. Detailed clinical and pathological features, response to platinum, and overall survival (OS) were collected for the identified cohort. OS was analyzed with Kaplan-Meier curves. PGAs were present in 122 (19.8%) of 615 patients involving 24 different genes, including BRCA1/2, ATM, PALB2, and multiple additional genes associated with the DNA damage response pathway. Of 122 patients with germline alterations, 41.8% did not meet current guidelines for GT. The difference in median OS was not statistically significant between patients with and without PGA (50.8 months, 95% confidence interval = 34.5 to not reached, two-sided P = .94). Loss of heterozygosity was found in 60.0% of BRCA1/2. PGAs frequently occur in pancreas exocrine neoplasms and involve multiple genes beyond those previously associated with hereditary pancreatic cancer. These PGAs are therapeutically actionable in about 5% to 10% of patients. These data support routinely offering GT in all pancreatic ductal adenocarcimona patients with a broad panel of known hereditary cancer predisposition genes.

  10. Symbolic manipulation techniques for vibration analysis of laminated elliptic plates

    Andersen, C. M.; Noor, A. K.

    1977-01-01

    A computational scheme is presented for the free vibration analysis of laminated composite elliptic plates. The scheme is based on Hamilton's principle, the Rayleigh-Ritz technique and symmetry considerations and is implemented with the aid of the MACSYMA symbolic manipulation system. The MACYSMA system, through differentiation, integration, and simplification of analytic expressions, produces highly-efficient FORTRAN code for the evaluation of the stiffness and mass coefficients. Multiple use is made of this code to obtain not only the frequencies and mode shapes of the plate, but also the derivatives of the frequencies with respect to various material and geometric parameters.

  11. Interlaminar fracture in woven carbon/epoxy laminates

    Paulo N.B. Reis

    2014-10-01

    Full Text Available This paper describes an experimental study developed to characterize the mode I and mode II fracture toughness of carbon/epoxy woven composites, using DCB and ENF tests, respectively. The laminates were manufactured using an epoxy resin and twelve woven balanced bi-directional layers of carbon fibres, all of them with the same orientation (0/90º. Significant instantaneous delaminations were observed particularly for the DCB specimen, which were responsible for an oscillatory behaviour of GI versus crack length. The maximum values obtained for GIC and GIIC were 281 and 1800 J/m2, respectively.

  12. Microcracking in composite laminates under thermal and mechanical loading. Thesis

    Maddocks, Jason R.

    1995-01-01

    Composites used in space structures are exposed to both extremes in temperature and applied mechanical loads. Cracks in the matrix form, changing the laminate thermoelastic properties. The goal of the present investigation is to develop a predictive methodology to quantify microcracking in general composite laminates under both thermal and mechanical loading. This objective is successfully met through a combination of analytical modeling and experimental investigation. In the analysis, the stress and displacement distributions in the vicinity of a crack are determined using a shear lag model. These are incorporated into an energy based cracking criterion to determine the favorability of crack formation. A progressive damage algorithm allows the inclusion of material softening effects and temperature-dependent material properties. The analysis is implemented by a computer code which gives predicted crack density and degraded laminate properties as functions of any thermomechanical load history. Extensive experimentation provides verification of the analysis. AS4/3501-6 graphite/epoxy laminates are manufactured with three different layups to investigate ply thickness and orientation effects. Thermal specimens are cooled to progressively lower temperatures down to -184 C. After conditioning the specimens to each temperature, cracks are counted on their edges using optical microscopy and in their interiors by sanding to incremental depths. Tensile coupons are loaded monotonically to progressively higher loads until failure. Cracks are counted on the coupon edges after each loading. A data fit to all available results provides input parameters for the analysis and shows them to be material properties, independent of geometry and loading. Correlation between experiment and analysis is generally very good under both thermal and mechanical loading, showing the methodology to be a powerful, unified tool. Delayed crack initiation observed in a few cases is attributed to a

  13. Grafting, pruning, and the antipodal map on measured laminations

    Dumas, David

    2006-01-01

    Grafting a measured lamination on a hyperbolic surface defines a self-map of Teichmuller space, which is a homeomorphism by a result of Scannell and Wolf. In this paper we study the large-scale behavior of pruning, which is the inverse of grafting. Specifically, for each conformal structure $X \\in \\T(S)$, pruning $X$ gives a map $\\ML(S) \\to \\T(S)$. We show that this map extends to the Thurston compactification of $\\T(S)$, and that its boundary values are the natural antipodal involution relat...

  14. Buckling analysis of laminated sandwich beam with soft core

    Anupam Chakrabarti

    Full Text Available Stability analysis of laminated soft core sandwich beam has been studied by a C0 FE model developed by the authors based on higher order zigzag theory (HOZT. The in-plane displacement variation is considered to be cubic for the face sheets and the core, while transverse displacement is quadratic within the core and constant in the faces beyond the core. The proposed model satisfies the condition of stress continuity at the layer interfaces and the zero stress condition at the top and bottom of the beam for transverse shear. Numerical examples are presented to illustrate the accuracy of the present model.

  15. On the lamb wave propagation in anisotropic laminated composite plates

    Park, Soo Keun; Jeong, Hyun Jo; Kim, Moon Saeng

    1998-01-01

    This paper examines the propagation of Lamb (or plate) waves in anisotropic laminated composite plates. The dispersion relations are explicitly derived using the classical plate theory (CLT), the first-order shear deformation theory (FSDT) and the exact solution (ES), Attention is paid to the lowest antisymmetric (flexural) and lowest symmetric(extensional) modes in the low frequency, long wavelength limit. Different values of shear correction factor were tested in FSDT and comparisons between flexural wave dispersion curves were made with exact results to asses the range of validity of approximate plate theories in the frequency domain.

  16. On the Architectural Qualities of Cross Laminated Timber

    Bejder, Anne Kirkegaard; Kirkegaard, Poul Henning; Fisker, Anna Marie

    2010-01-01

    In resent years wood as a building material has gain renewed focus and with that new production methods and wooden products have been developed. One of these products is Cross Laminated Timber (CLT) which, by means of high-technology production and a distinctive construction with layers of lamellae...... glued together crosswise, possesses structural capacities which are out of woods nature. Several research studies have clarified that CLT has many qualities within the engineering field but knowledge regarding its applications and aesthetics is more insufficient. Thus, the purpose of this paper...

  17. Disease evolution and outcomes in familial AML with germline CEBPA mutations

    Tawana, Kiran; Wang, Jun; Renneville, Aline

    2015-01-01

    collected from 10 CEBPA-mutated families, representing 24 members with acute myeloid leukemia (AML). Whole-exome (WES) and deep sequencing were performed to genetically profile tumors and define patterns of clonal evolution. Germline CEBPA mutations clustered within the N-terminal and were highly penetrant......, with AML presenting at a median age of 24.5 years (range, 1.75-46 years). In all diagnostic tumors tested (n = 18), double CEBPA mutations (CEBPAdm) were detected, with acquired (somatic) mutations preferentially targeting the C-terminal. Somatic CEBPA mutations were unstable throughout the disease course...

  18. A novel molecular diagnostics platform for somatic and germline precision oncology.

    Cabanillas, Rubén; Diñeiro, Marta; Castillo, David; Pruneda, Patricia C; Penas, Cristina; Cifuentes, Guadalupe A; de Vicente, Álvaro; Durán, Noelia S; Álvarez, Rebeca; Ordóñez, Gonzalo R; Cadiñanos, Juan

    2017-07-01

    Next-generation sequencing (NGS) opens new options in clinical oncology, from therapy selection to genetic counseling. However, realization of this potential not only requires succeeding in the bioinformatics and interpretation of the results, but also in their integration into the clinical practice. We have developed a novel NGS diagnostic platform aimed at detecting (1) somatic genomic alterations associated with the response to approved targeted cancer therapies and (2) germline mutations predisposing to hereditary malignancies. Next-generation sequencing libraries enriched in the exons of 215 cancer genes (97 for therapy selection and 148 for predisposition, with 30 informative for both applications), as well as selected introns from 17 genes involved in drug-related rearrangements, were prepared from 39 tumors (paraffin-embedded tissues/cytologies), 36 germline samples (blood) and 10 cell lines using hybrid capture. Analysis of NGS results was performed with specifically developed bioinformatics pipelines. The platform detects single-nucleotide variants (SNVs) and insertions/deletions (indels) with sensitivity and specificity >99.5% (allelic frequency ≥0.1), as well as copy-number variants (CNVs) and rearrangements. Somatic testing identified tailored approved targeted drugs in 35/39 tumors (89.74%), showing a diagnostic yield comparable to that of leading commercial platforms. A somatic EGFR p.E746_S752delinsA mutation in a mediastinal metastasis from a breast cancer prompted its anatomopathologic reassessment, its definite reclassification as a lung cancer and its treatment with gefitinib (partial response sustained for 15 months). Testing of 36 germline samples identified two pathogenic mutations (in CDKN2A and BRCA2 ). We propose a strategy for interpretation and reporting of results adaptable to the aim of the request, the availability of tumor and/or normal samples and the scope of the informed consent. With an adequate methodology, it is possible to

  19. Transgenic mice produced by retroviral transduction of male germ-line stem cells

    Nagano, Makoto; Brinster, Clayton J.; Orwig, Kyle E.; Ryu, Buom-Yong; Avarbock, Mary R.; Brinster, Ralph L.

    2001-01-01

    Male germ-line stem cells are the only cell type in postnatal mammals that have the capability to self-renew and to contribute genes to the next generation. Genetic modification of these cells would provide an opportunity to study the biology of their complex self-renewal and differentiation processes, as well as enable the generation of transgenic animals in a wide range of species. Although retroviral vectors have been used as an efficient method to introduce genes into a variety of cell ty...

  20. Low Base-Substitution Mutation Rate in the Germline Genome of the Ciliate Tetrahymena thermophila

    2016-09-15

    Tetrahymena thermophila, a model eukaryote. PLoS Biol. 4:e286. Farlow A, et al. 2015. The spontaneous mutation rate in the fission yeast Schizosaccharomyces...spontane- ous mutations in yeast . Proc Natl Acad Sci U S A. 105:9272–9277. Lynn DH, Doerder FP. 2012. The life and times of Tetrahymena. Methods Cell...Low Base-Substitution Mutation Rate in the Germline Genome of the Ciliate Tetrahymena thermophila Hongan Long1,2,y, David J. Winter3,*,y, Allan Y.-C

  1. A germline chromothripsis event stably segregating in 11 individuals through three generations

    Bertelsen, Birgitte; Nazaryan-Petersen, Lusine; Sun, Wei

    2016-01-01

    PURPOSE: Parentally transmitted germ-line chromothripsis (G-CTH) has been identified in only a few cases. Most of these rearrangements were stably transmitted, in an unbalanced form, from a healthy mother to her child with congenital abnormalities probably caused by de novo copy-number changes...... of the DNA damage response, may be related to G-CTH formation. CONCLUSION: G-CTH rearrangements are not always associated with abnormal phenotypes and may be misinterpreted as balanced two-way translocations, suggesting that G-CTH is an underdiagnosed phenomenon.Genet Med 18 5, 494-500....

  2. Impact of germline and somatic missense variations on drug binding sites.

    Yan, C; Pattabiraman, N; Goecks, J; Lam, P; Nayak, A; Pan, Y; Torcivia-Rodriguez, J; Voskanian, A; Wan, Q; Mazumder, R

    2017-03-01

    Advancements in next-generation sequencing (NGS) technologies are generating a vast amount of data. This exacerbates the current challenge of translating NGS data into actionable clinical interpretations. We have comprehensively combined germline and somatic nonsynonymous single-nucleotide variations (nsSNVs) that affect drug binding sites in order to investigate their prevalence. The integrated data thus generated in conjunction with exome or whole-genome sequencing can be used to identify patients who may not respond to a specific drug because of alterations in drug binding efficacy due to nsSNVs in the target protein's gene. To identify the nsSNVs that may affect drug binding, protein-drug complex structures were retrieved from Protein Data Bank (PDB) followed by identification of amino acids in the protein-drug binding sites using an occluded surface method. Then, the germline and somatic mutations were mapped to these amino acids to identify which of these alter protein-drug binding sites. Using this method we identified 12 993 amino acid-drug binding sites across 253 unique proteins bound to 235 unique drugs. The integration of amino acid-drug binding sites data with both germline and somatic nsSNVs data sets revealed 3133 nsSNVs affecting amino acid-drug binding sites. In addition, a comprehensive drug target discovery was conducted based on protein structure similarity and conservation of amino acid-drug binding sites. Using this method, 81 paralogs were identified that could serve as alternative drug targets. In addition, non-human mammalian proteins bound to drugs were used to identify 142 homologs in humans that can potentially bind to drugs. In the current protein-drug pairs that contain somatic mutations within their binding site, we identified 85 proteins with significant differential gene expression changes associated with specific cancer types. Information on protein-drug binding predicted drug target proteins and prevalence of both somatic and

  3. Production and characterization of biosurfactant from marine Streptomyces species B3.

    Khopade, Abhijit; Ren, Biao; Liu, Xiang-Yang; Mahadik, Kakasaheb; Zhang, Lixin; Kokare, Chandrakant

    2012-02-01

    The present study demonstrates the production and properties of a biosurfactant isolated from marine Streptomyces species B3. The production of the biosurfactant was found to be higher in medium containing sucrose and lower in the medium containing glycerol. Yeast extract was the best nitrogen source for the production of the biosurfactant. The isolated biosurfactant reduced the surface tension of water to 29 mN/m. The purified biosurfactant was shown critical micelle concentrations of 110 mg/l. The emulsifying activity and stability of the biosurfactant was investigated at different salinities, pH, and temperature. The biosurfactant was effective at very low concentrations over a wide range of temperature, pH, and salt concentration. The purified biosurfactant was shown strong antimicrobial activity. The biosurfactant was produced from the marine Streptomyces sp. using non-hydrocarbon substrates such as sucrose that was readily available and not required extensive purification procedure. Streptomyces species B3 can be used for microbially enhanced oil recovery process. Copyright © 2011 Elsevier Inc. All rights reserved.

  4. Influence of carbohydrates on the interaction of procyanidin B3 with trypsin.

    Gonçalves, Rui; Mateus, Nuno; De Freitas, Victor

    2011-11-09

    The biological properties of procyanidins, in particular their inhibition of digestive enzymes, have received much attention in the past few years. Dietary carbohydrates are an environmental factor that is known to affect the interaction of procyanidins with proteins. This work aimed at understanding the effect of ionic food carbohydrates (polygalacturonic acid, arabic gum, pectin, and xanthan gum) on the interaction between procyanidins and trypsin. Physical-chemical techniques such as saturation transfer difference-NMR (STD-NMR) spectroscopy, fluorescence quenching, and nephelometry were used to evaluate the interaction process. Using STD-NMR, it was possible to identify the binding of procyanidin B3 to trypsin. The tested carbohydrates prevented the association of procyanidin B3 and trypsin by a competition mechanism in which the ionic character of carbohydrates and their ability to encapsulate procyanidins seem crucial leading to a reduction in STD signal and light scattering and to a recovery of the proteins intrinsic fluorescence. On the basis of these results, it was possible to grade the carbohydrates in their aggregation inhibition ability: XG > PA > AG ≫ PC. These effects may be relevant since the coingestion of procyanidins and ionic carbohydrates are frequent and furthermore since these might negatively affect the antinutritional properties ascribed to procyanidins in the past.

  5. Pressure dependent elastic and structural (B3-B1) properties of Ga based monopnictides

    Varshney, Dinesh; Joshi, Geetanjali; Varshney, Meenu; Shriya, Swarna

    2010-01-01

    By formulating an effective interionic interaction potential that incorporates the long-range Coulomb, the covalency effects, the charge transfer caused by the deformation of the electron shells of the overlapping ions, the Hafemeister and Flygare type short-range overlap repulsion extended up to the second neighbour ions and the van der Waals (vdW) interaction, the pressure dependent elastic and thermodynamical properties of the III-V semiconductors as GaY (Y = N, P, As) are studied. The estimated values of phase transition pressure of GaY (Y = N, P, As) are in reasonably good agreement with the available data on the phase transition pressures (P t = 41, 22, 17 GPa). The vast volume discontinuity in pressure-volume phase diagram identifies a structural phase transition from zinc-blende (B3) to rock salt (B1) structure. Later on, the Poisson's ratio ν, the ratio R S/B of S (Voigt averaged shear modulus) over B (bulk modulus), elastic anisotropy parameter, elastic wave velocity, average wave velocity and Debye temperature as functions of pressure is calculated. From Poisson's ratio and the ratio R S/B it is inferred that GaY (Y = N, P, As) is brittle [ductile] in zinc-blende (B3) [Sodium Chloride (B1)] phase. To our knowledge this is the first quantitative theoretical prediction of the pressure dependence of ductile (brittle) nature of GaY compounds and still awaits experimental confirmations.

  6. Theoretical charge-exchange total cross sections for B+3 + He and C+4 + He collisions

    Shipsey, E.J.; Browne, J.C.; Olson, R.E.

    1977-01-01

    Charge-exchange total cross sections for the B +3 + He and C +4 + He systems have been calculated in the velocity range v = (1--10) x 10 7 cm/sec. Ab initio potential-energy curves and coupling-matrix elements were computed and employed in the impact-parameter classical-coupled equations that describe the collision to obtain the cross sections. For the B +3 + He system, our calculations are in excellent agreement with experimental results with the finding that the single-electron-transfer cross section rises rapidly to a maximum of 1.45 x 10 -15 cm 2 at v = 5.5 x 10 7 cm/sec. For the C +4 + He system, however, we find that the double-electron-transfer process is more important than the single-electron-transfer process. For example, at v = 5 x 10 7 cm/sec, the double-electron-transfer cross section is found to be 0.6 x 10 -16 cm 2 vs 5.5 x 10 -17 for the single-electron transfer. This is in disagreement with an experiment of Crandall which gave the single-charge-transfer process as dominant. However, the more recent experiment reported by Crandall, Olson, Browne, and Shipsey verifies the double charge transfer as the dominant process for low energies

  7. Performance of stress-laminated timber highway bridges in cold climates

    James P. Wacker

    2009-01-01

    This paper summarizes recent laboratory and field data studies on thermal performance of stress-laminated timber highway bridges. Concerns about the reliability of stress-laminated deck bridges when exposed to sub-freezing temperatures triggered several investigations. Two laboratory studies were conducted to study the effects of wood species, preservative, moisture...

  8. Sorting nexin 6 enhances lamin a synthesis and incorporation into the nuclear envelope.

    Jose M González-Granado

    Full Text Available Nuclear lamins are important structural and functional proteins in mammalian cells, but little is known about the mechanisms and cofactors that regulate their traffic into the nucleus. Here, we demonstrate that trafficking of lamin A, but not lamin B1, and its assembly into the nuclear envelope are regulated by sorting nexin 6 (SNX6, a major component of the retromer that targets proteins and other molecules to specific subcellular locations. SNX6 interacts with lamin A in vitro and in vivo and links it to the outer surface of the endoplasmic reticulum in human and mouse cells. SNX6 transports its lamin A cargo to the nuclear envelope in a process that takes several hours. Lamin A protein levels in the nucleus augment or decrease, respectively, upon gain or loss of SNX6 function. We further show that SNX6-dependent lamin A nuclear import occurs across the nuclear pore complex via a RAN-GTP-dependent mechanism. These results identify SNX6 as a key regulator of lamin A synthesis and incorporation into the nuclear envelope.

  9. Structural Performance of the Second Oldest Glued-Laminated Structure in the United States

    Douglas R. Rammer; Jorge de Melo Moura; Robert J. Ross

    2014-01-01

    The second glued-laminated structure built in the United States was constructed at the USDA Forest Products Laboratory (FPL) in 1934 to demonstrate the performance of wooden arch buildings. After 75 years of use the structure was decommissioned in 2010. Shortly after construction, researchers structurally evaluated the glued-laminated arch structure for uniform loading...

  10. Structural Evaluation of the Second Oldest Glued-Laminated Structure in the United States

    Douglas R. Rammer; Jorge de Melo Moura

    2013-01-01

    The second glued-laminated structure built in the United States was constructed at the USDA Forest Products Laboratory (FPL) in 1934 to demonstrate the performance of wooden arch buildings. After decades of use the structure was decommissioned in 2010. Shortly after construction, researchers structurally evaluated the glued-laminated arch structure for uniform loading...

  11. Field performance of timber bridges. 5, Little Salmon Creek stress-laminated deck bridge

    M. A. Ritter; J. A. Kainz; G. J. Porter

    The Little Salmon Creek bridge was constructed in November 1988 on the Allegheny National Forest in Pennsylvania. The bridge is a simple span, single-lane, stress-laminated deck superstructure that is approximately 26-ft long and 16-ft wide. The bridge is unique in that it is the first known stress-laminated timber bridge to be constructed of hardwood lumber. The...

  12. Field performance of timber bridges. 7, Connell Lake stress-laminated deck bridge

    L. E. Hislop; M. A. Ritter

    The Connell Lake bridge was constructed in early 1991 on the Tongass National Forest, Alaska, as a demonstration bridge under the Timber Bridge Initiative. The bridge is a stress-laminated deck structure with an approximate 36-ft length and 18-ft width and is the first known stress-laminated timber bridge constructed in Alaska. Performance of the bridge was monitored...

  13. Field performance of timber bridges. 6, Hoffman Run stress-laminated deck bridge

    M. A. Ritter; P. D. Hilbrich Lee; G. J. Porter

    The Hoffman Run bridge, located just outside Dahoga, Pennsylvania, was constructed in October 1990. The bridge is a simple-span, single-lane, stress-laminated deck superstructure that is approximately 26 ft long and 16 ft wide. It is the second stress-laminated timber bridge to be constructed of hardwood lumber in Pennsylvania. The performance of the bridge was...

  14. A summary of modulus of elasticity and knot size surveys for laminating grades of lumber

    R. W. Wolfe; R. C. Moody

    1981-01-01

    A summary of modulus of elasticity (MOE) and knot data is presented for grades of lumber commonly used to manufacture glued-laminated (glulam) timber by the laminating Industry. Tabulated values represent 30 different studies covering a time span of over 16 years. Statistical estimates of average and near-maximum knot sizes as well as mean and coefficient of variation...

  15. Degradation Behavior of Epoxy Resins in Fibre Metal Laminates Under Thermal Conditions

    Zhu, G.; Xiao, Y.; Yang, Y.; Wang, J.; Sun, B.; Boom, R.

    2012-01-01

    GLARE (glass fibre/epoxy reinforced aluminum laminate) is a member of the fiber metal laminate (FML) family, and is built up of alternating metal and fiber layers. About 500m2 GLARE is employed in each Airbus A380 because of the superior mechanical properties over the monolithic aluminum alloys,

  16. Laminitis with severe rarefactive osteitis of the distal phalanx in a young Simmental bull

    Kofler, J.; Stanek, C.

    1990-01-01

    A case report of a 9-month-old Simmental bull with chronic laminitis is presented including clinical examination, radiology and pathomorphology. The condition is similar to several cases of laminitis described earlier in Jersey cattle, which have been attributed to hereditary factors

  17. Electrical Resistance and Acoustic Emission Measurements for Monitoring the Structural Behavior of CFRP Laminate

    Zhou, Wei

    2015-01-01

    methods to better access how these perform when used for Structural Health Moni- toring (SHM). Laminates with three different stacking sequences: [0]4, [02/902]s and [+45/ − 45]2s are subjected to monotonic and cyclic tensile tests. In each laminate, we

  18. Laminated electrospun nHA/PHB-composite scaffolds mimicking bone extracellular matrix for bone tissue engineering

    Chen, Zhuoyue [Lab of Tissue Engineering, Faculty of Life Science, Northwest University, 229 TaiBai North Road, Xi' an, Shaanxi Province 710069 (China); Provincial Key Laboratory of Biotechnology of Shaanxi, Northwest University, 229 TaiBai North Road, Xi' an, Shaanxi Province 710069 (China); Song, Yue [Lab of Tissue Engineering, Faculty of Life Science, Northwest University, 229 TaiBai North Road, Xi' an, Shaanxi Province 710069 (China); Zhang, Jing [Lab of Tissue Engineering, Faculty of Life Science, Northwest University, 229 TaiBai North Road, Xi' an, Shaanxi Province 710069 (China); Provincial Key Laboratory of Biotechnology of Shaanxi, Northwest University, 229 TaiBai North Road, Xi' an, Shaanxi Province 710069 (China); Key Laboratory of Resource Biology and Modern Biotechnology in Western China, Ministry of Education, Northwest University, 229 TaiBai North Road, Xi' an, Shaanxi Province, 710069 (China); Liu, Wei [Lab of Tissue Engineering, Faculty of Life Science, Northwest University, 229 TaiBai North Road, Xi' an, Shaanxi Province 710069 (China); Cui, Jihong, E-mail: cjh@nwu.edu.cn [Lab of Tissue Engineering, Faculty of Life Science, Northwest University, 229 TaiBai North Road, Xi' an, Shaanxi Province 710069 (China); Provincial Key Laboratory of Biotechnology of Shaanxi, Northwest University, 229 TaiBai North Road, Xi' an, Shaanxi Province 710069 (China); Key Laboratory of Resource Biology and Modern Biotechnology in Western China, Ministry of Education, Northwest University, 229 TaiBai North Road, Xi' an, Shaanxi Province, 710069 (China); and others

    2017-03-01

    Electrospinning is an effective means to generate nano- to micro-scale polymer fibers resembling native extracellular matrix for tissue engineering. However, a major problem of electrospun materials is that limited pore size and porosity may prevent adequate cellular infiltration and tissue ingrowth. In this study, we first prepared thin layers of hydroxyapatite nanoparticle (nHA)/poly-hydroxybutyrate (PHB) via electrospinning. We then laminated the nHA/PHB thin layers to obtain a scaffold for cell seeding and bone tissue engineering. The results demonstrated that the laminated scaffold possessed optimized cell-loading capacity. Bone marrow mesenchymal stem cells (MSCs) exhibited better adherence, proliferation and osteogenic phenotypes on nHA/PHB scaffolds than on PHB scaffolds. Thereafter, we seeded MSCs onto nHA/PHB scaffolds to fabricate bone grafts. Histological observation showed osteoid tissue formation throughout the scaffold, with most of the scaffold absorbed in the specimens 2 months after implantation, and blood vessels ingrowth into the graft could be observed in the graft. We concluded that electrospun and laminated nanoscaled biocomposite scaffolds hold great therapeutic potential for bone regeneration. - Highlights: • We laminated the nHA/PHB layers to obtain a scaffold for bone tissue engineering. • The laminated scaffold performed optimized cell-loading capacity. • MSCs exhibited osteogenic phenotypes on the laminated scaffold. • Osteoid tissue formed throughout the laminated scaffold after 2 months in vivo. The laminated bio-composite scaffolds can be applied to bone regeneration.

  19. Bending analyses for 3D engineered structural panels made from laminated paper and carbon fabric

    Jinghao Li; John F. Hunt; Zhiyong Cai; Xianyan Zhou

    2013-01-01

    This paper presents analysis of a 3-dimensional engineered structural panel (3DESP) having a tri-axial core structure made from phenolic impregnated laminated-paper composites with and without high strength composite carbon-fiber fabric laminated to the outside of both faces. Both I-beam equations and finite element method were used to analyze four-point bending of the...

  20. Self-heating forecasting for thick laminates testing coupons in fatigue

    Lahuerta, F.; Westphal, T.; Nijssen, R.P.L.

    2012-01-01

    Thick laminate sections can be found from the tip to the root in most common wind turbine blade designs. Obtaining accurate and reliable design data for thick laminates is subject of investigations. Due to the poor thermal conductivity properties of composites and the material self-heating that

  1. Probabilistic Modelling of Fatigue Life of Composite Laminates Using Bayesian Inference

    Dimitrov, Nikolay Krasimirov; Kiureghian, Armen Der

    2014-01-01

    A probabilistic model for estimating the fatigue life of laminated composite plates subjected to constant-amplitude or variable-amplitude loading is developed. The model is based on lamina-level input data, making it possible to predict fatigue properties for a wide range of laminate configuratio...

  2. Sorting Nexin 6 Enhances Lamin A Synthesis and Incorporation into the Nuclear Envelope

    González-Granado, Jose M.; Navarro-Puche, Ana; Molina-Sanchez, Pedro; Blanco-Berrocal, Marta; Viana, Rosa; de Mora, Jaime Font; Andrés, Vicente

    2014-01-01

    Nuclear lamins are important structural and functional proteins in mammalian cells, but little is known about the mechanisms and cofactors that regulate their traffic into the nucleus. Here, we demonstrate that trafficking of lamin A, but not lamin B1, and its assembly into the nuclear envelope are regulated by sorting nexin 6 (SNX6), a major component of the retromer that targets proteins and other molecules to specific subcellular locations. SNX6 interacts with lamin A in vitro and in vivo and links it to the outer surface of the endoplasmic reticulum in human and mouse cells. SNX6 transports its lamin A cargo to the nuclear envelope in a process that takes several hours. Lamin A protein levels in the nucleus augment or decrease, respectively, upon gain or loss of SNX6 function. We further show that SNX6-dependent lamin A nuclear import occurs across the nuclear pore complex via a RAN-GTP-dependent mechanism. These results identify SNX6 as a key regulator of lamin A synthesis and incorporation into the nuclear envelope. PMID:25535984

  3. The potential role of Clostridium botulinum toxin in the treatment of equine laminitis

    Hardeman, L C

    2016-01-01

    Laminitis is a severe and painful disease in the horse that may lead to loosening of the attachment of the distal phalanx to the horny hoof capsule. Although a large variety of treatment options has come and gone since the first descriptions of laminitis, there is certainly a thus far unmet need for

  4. Experimental Characterization and Cohesive Laws for Delamination of Off-Axis GFRP Laminates

    Lindgaard, Esben; Bak, Brian Lau Verndal

    2015-01-01

    This work experimentally characterizes mixed mode delamination in glass fibre reinforced polymer laminates taking into account the influence of the off-axis angle between the lamina orientation and the crack growth direction on the fracture properties. Thus, providing a cohesive law that enables...... analysis of 3D models in which mixed mode crack growth within laminates having anisotropic fracture properties takes place....

  5. Normalization of Impact Energy by Laminate Thickness for Compression After Impact Testing

    Nettles, A. T.; Hromisin, S. M.

    2013-01-01

    The amount of impact energy used to damage a composite laminate is a critical parameter when assessing residual strength properties. The compression after impact (CAI) strength of impacted laminates is dependent upon how thick the laminate is and this has traditionally been accounted for by normalizing (dividing) the impact energy by the laminate's thickness. However, when comparing CAI strength values for a given lay-up sequence and fiber/resin system, dividing the impact energy by the specimen thickness has been noted by the author to give higher CAI strength values for thicker laminates. A study was thus undertaken to assess the comparability of CAI strength data by normalizing the impact energy by the specimen thickness raised to a power to account for the higher strength of thicker laminates. One set of data from the literature and two generated in this study were analyzed by dividing the impact energy by the specimen thickness to the 1, 1.5, 2, and 2.5 powers. Results show that as laminate thickness and damage severity decreased, the value which the laminate thickness needs to be raised to in order to yield more comparable CAI data increases.

  6. Influence of porosity on the interlaminar shear strength of fibre-metal laminates

    Lopes, C.S.; Remmers, J.J.C.; Gürdal, Z.

    2008-01-01

    Structures manufactured in fibre-metal laminates (e.g. Glare) have been designedconsidering ideal mechanical properties determined by the Classical Lamination Theory. Thismeans that among other assumptions, perfect bonding conditions between layers are assumed.However, more than often, perfect

  7. A Theoretical Model for Estimation of Yield Strength of Fiber Metal Laminate

    Bhat, Sunil; Nagesh, Suresh; Umesh, C. K.; Narayanan, S.

    2017-08-01

    The paper presents a theoretical model for estimation of yield strength of fiber metal laminate. Principles of elasticity and formulation of residual stress are employed to determine the stress state in metal layer of the laminate that is found to be higher than the stress applied over the laminate resulting in reduced yield strength of the laminate in comparison with that of the metal layer. The model is tested over 4A-3/2 Glare laminate comprising three thin aerospace 2014-T6 aluminum alloy layers alternately bonded adhesively with two prepregs, each prepreg built up of three uni-directional glass fiber layers laid in longitudinal and transverse directions. Laminates with prepregs of E-Glass and S-Glass fibers are investigated separately under uni-axial tension. Yield strengths of both the Glare variants are found to be less than that of aluminum alloy with use of S-Glass fiber resulting in higher laminate yield strength than with the use of E-Glass fiber. Results from finite element analysis and tensile tests conducted over the laminates substantiate the theoretical model.

  8. Laminated electrospun nHA/PHB-composite scaffolds mimicking bone extracellular matrix for bone tissue engineering

    Chen, Zhuoyue; Song, Yue; Zhang, Jing; Liu, Wei; Cui, Jihong

    2017-01-01

    Electrospinning is an effective means to generate nano- to micro-scale polymer fibers resembling native extracellular matrix for tissue engineering. However, a major problem of electrospun materials is that limited pore size and porosity may prevent adequate cellular infiltration and tissue ingrowth. In this study, we first prepared thin layers of hydroxyapatite nanoparticle (nHA)/poly-hydroxybutyrate (PHB) via electrospinning. We then laminated the nHA/PHB thin layers to obtain a scaffold for cell seeding and bone tissue engineering. The results demonstrated that the laminated scaffold possessed optimized cell-loading capacity. Bone marrow mesenchymal stem cells (MSCs) exhibited better adherence, proliferation and osteogenic phenotypes on nHA/PHB scaffolds than on PHB scaffolds. Thereafter, we seeded MSCs onto nHA/PHB scaffolds to fabricate bone grafts. Histological observation showed osteoid tissue formation throughout the scaffold, with most of the scaffold absorbed in the specimens 2 months after implantation, and blood vessels ingrowth into the graft could be observed in the graft. We concluded that electrospun and laminated nanoscaled biocomposite scaffolds hold great therapeutic potential for bone regeneration. - Highlights: • We laminated the nHA/PHB layers to obtain a scaffold for bone tissue engineering. • The laminated scaffold performed optimized cell-loading capacity. • MSCs exhibited osteogenic phenotypes on the laminated scaffold. • Osteoid tissue formed throughout the laminated scaffold after 2 months in vivo. The laminated bio-composite scaffolds can be applied to bone regeneration.

  9. Modeling transverse cracking in laminates with a single layer of elements per ply

    Van der Meer, F.P.; Davila, C.G.

    2012-01-01

    This study aims to bridge the gap between classical understanding of transverse cracking in [0/90]s laminates and recent computational methods for the modeling of progressive laminate failure. Specifically, the study investigates under which conditions a three-dimensional model with cohesive cracks

  10. Lamin A/C mutations with lipodystrophy, cardiac abnormalities, and muscular dystrophy

    van der Kooi, A. J.; Bonne, G.; Eymard, B.; Duboc, D.; Talim, B.; van der Valk, M.; Reiss, P.; Richard, P.; Demay, L.; Merlini, L.; Schwartz, K.; Busch, H. F. M.; de Visser, M.

    2002-01-01

    Mutations in the lamin A/C gene are found in Emery-Dreifuss muscular dystrophy, limb girdle muscular dystrophy with cardiac conduction disturbances, dilated cardiomyopathy with conduction system disease, and familial partial lipodystrophy. Cases with lamin A/C mutations presenting with lipodystrophy

  11. Reliability formulation for the strength and fire endurance of glued-laminated beams

    D. A. Bender

    A model was developed for predicting the statistical distribution of glued-laminated beam strength and stiffness under normal temperature conditions using available long span modulus of elasticity data, end joint tension test data, and tensile strength data for laminating-grade lumber. The beam strength model predictions compared favorably with test data for glued-...

  12. 5 CFR 2640.302 - Waivers issued pursuant to 18 U.S.C. 208(b)(3).

    2010-01-01

    ... actual or potential profit or loss or cost of the matter to the company issuing the stock, the change in...) Requirements for issuing an individual waiver under 18 U.S.C. 208(b)(3). Pursuant to 18 U.S.C. 208(b)(3), an...) The type of interest that is creating the disqualification (e.g. stock, bonds, real estate, other...

  13. Stem cells are units of natural selection for tissue formation, for germline development, and in cancer development.

    Weissman, Irving L

    2015-07-21

    It is obvious that natural selection operates at the level of individuals and collections of individuals. Nearly two decades ago we showed that in multi-individual colonies of protochordate colonial tunicates sharing a blood circulation, there exists an exchange of somatic stem cells and germline stem cells, resulting in somatic chimeras and stem cell competitions for gonadal niches. Stem cells are unlike other cells in the body in that they alone self-renew, so that they form clones that are perpetuated for the life of the organism. Stem cell competitions have allowed the emergence of competitive somatic and germline stem cell clones. Highly successful germline stem cells usually outcompete less successful competitors both in the gonads of the genotype partner from which they arise and in the gonads of the natural parabiotic partners. Therefore, natural selection also operates at the level of germline stem cell clones. In the colonial tunicate Botryllus schlosseri the formation of natural parabionts is prevented by a single-locus highly polymorphic histocompatibility gene called Botryllus histocompatibility factor. This limits germline stem cell predation to kin, as the locus has hundreds of alleles. We show that in mice germline stem cells compete for gonad niches, and in mice and humans, blood-forming stem cells also compete for bone marrow niches. We show that the clonal progression from blood-forming stem cells to acute leukemias by successive genetic and epigenetic events in blood stem cells also involves competition and selection between clones and propose that this is a general theme in cancer.

  14. Combining molecular and immunohistochemical analyses of key drivers in primary melanomas: interplay between germline and somatic variations.

    Bruno, William; Martinuzzi, Claudia; Dalmasso, Bruna; Andreotti, Virginia; Pastorino, Lorenza; Cabiddu, Francesco; Gualco, Marina; Spagnolo, Francesco; Ballestrero, Alberto; Queirolo, Paola; Grillo, Federica; Mastracci, Luca; Ghiorzo, Paola

    2018-01-19

    Due to the high mutational somatic burden of Cutaneous Malignant Melanoma (CMM) a thorough profiling of the driver mutations and their interplay is necessary to explain the timing of tumorigenesis or for the identification of actionable genetic events. The aim of this study was to establish the mutation rate of some of the key drivers in melanoma tumorigenesis combining molecular analyses and/or immunohistochemistry in 93 primary CMMs from an Italian cohort also characterized for germline status, and to investigate an interplay between germline and somatic variants. BRAF mutations were present in 68% of cases, while CDKN2A germline mutations were found in 16 % and p16 loss in tissue was found in 63%. TERT promoter somatic mutations were detected in 38% of cases while the TERT -245T>C polymorphism was found in 51% of cases. NRAS mutations were found in 39% of BRAF negative or undetermined cases. NF1 was expressed in all cases analysed. MC1R variations were both considered as a dichotomous variable or scored. While a positive, although not significant association between CDKN2A germline mutations, but not MC1R variants, and BRAF somatic mutation was found, we did not observe other associations between germline and somatic events. A yet undescribed inverse correlation between TERT -245T>C polymorphism and the presence of BRAF mutation was found. It is possible to hypothesize that -245T>C polymorphism could be included in those genotypes which may influence the occurrence of BRAF mutations. Further studies are needed to investigate the role of -245T>C polymorphism as a germline predictor of BRAF somatic mutation status.

  15. TP53 germline mutation testing in 180 families suspected of Li-Fraumeni syndrome: mutation detection rate and relative frequency of cancers in different familial phenotypes

    Ruijs, M.W.G.; Verhoef, S.; Rookus, M.A.; Pruntel, R.; van der Hout, A.H.; Hogervorst, F.B.L.; Kluijt, I.; Sijmons, R.H.; Aalfs, C.M.; Wagner, A.; Ausems, M.G.E.M.; Hoogerbrugge, N.; van Asperen, C.J.; Gómez García, E.B.; Meijers-Heijboer, H.; ten Kate, L.P.; Menko, F.H.; van 't Veer, L.J.

    2010-01-01

    Background Li-Fraumeni syndrome (LFS) is a rare autosomal dominant cancer predisposition syndrome. Most families fulfilling the classical diagnostic criteria harbour TP53 germline mutations. However, TP53 germline mutations may also occur in less obvious phenotypes. As a result, different criteria

  16. Tungsten foil laminate for structural divertor applications – Joining of tungsten foils

    Reiser, Jens, E-mail: jens.reiser@kit.edu [Karlsruhe Institute of Technology (KIT), Institute for Applied Materials (IAM-AWP) (Germany); Rieth, Michael; Möslang, Anton; Dafferner, Bernhard; Hoffmann, Jan [Karlsruhe Institute of Technology (KIT), Institute for Applied Materials (IAM-AWP) (Germany); Mrotzek, Tobias; Hoffmann, Andreas [PLANSEE SE, Reutte (Austria); Armstrong, D.E.J.; Yi, Xiaoou [University of Oxford, Department of Materials (United Kingdom)

    2013-05-15

    This paper is the fourth in our series on tungsten laminates. The aim of this paper is to discuss laminate synthesis, meaning the joining of tungsten foils. It is obvious that the properties of the tungsten laminate strongly depend on the combination of (i) interlayer and (ii) joining technology, as this combination defines (i) the condition of the tungsten foil after joining (as-received or recrystallised) as well as (ii) the characteristics of the interface between the tungsten foil and the interlayer (wettability or diffusion leading to a solid solution or the formation of intermetallics). From the example of tungsten laminates joined by brazing with (i) an eutectic silver copper brazing filler, (ii) copper, (iii) titanium, and (iv) zirconium, the microstructure will be discussed, with special focus on the interface. Based on our assumptions of the mechanism of the extraordinary ductility of tungsten foil we present three syntheses strategies and make recommendations for the synthesis of high temperature tungsten laminates.

  17. Tungsten foil laminate for structural divertor applications - Joining of tungsten foils

    Reiser, Jens; Rieth, Michael; Möslang, Anton; Dafferner, Bernhard; Hoffmann, Jan; Mrotzek, Tobias; Hoffmann, Andreas; Armstrong, D. E. J.; Yi, Xiaoou

    2013-05-01

    This paper is the fourth in our series on tungsten laminates. The aim of this paper is to discuss laminate synthesis, meaning the joining of tungsten foils. It is obvious that the properties of the tungsten laminate strongly depend on the combination of (i) interlayer and (ii) joining technology, as this combination defines (i) the condition of the tungsten foil after joining (as-received or recrystallised) as well as (ii) the characteristics of the interface between the tungsten foil and the interlayer (wettability or diffusion leading to a solid solution or the formation of intermetallics). From the example of tungsten laminates joined by brazing with (i) an eutectic silver copper brazing filler, (ii) copper, (iii) titanium, and (iv) zirconium, the microstructure will be discussed, with special focus on the interface. Based on our assumptions of the mechanism of the extraordinary ductility of tungsten foil we present three syntheses strategies and make recommendations for the synthesis of high temperature tungsten laminates.

  18. The role of endotoxin in the pathogenesis of acute bovine laminitis.

    Boosman, R; Mutsaers, C W; Klarenbeek, A

    1991-07-01

    To study the possible role of endotoxin in the pathogenesis of bovine laminitis, local and systemic injections of endotoxin (E. coli 0111 B4) with different doses were given to three groups of four cows each. Clinical and haematologic parameters indicated an acute-phase response, including positive plasma ethanol gelation (soluble fibrin), the occurrence of fibrin degradation products and decreased thrombocyte counts. Local Shwartzman reactions were not evoked. Clinical examination of the claws and the gait of the animals revealed no signs of laminitis. However, on histopathological examination of the claw corium signs of laminitis such as vacuolisation of the Stratum basale, lymphocyte and leucocyte infiltration and thrombosis were found. These results indicate that endotoxin indeed may be involved in the pathogenesis of laminitis. For the development of a clinical acute laminitis model in cattle either another dosage, other toxins or factors in addition to the endotoxin used in this experiment are needed.

  19. Free vibration of fully functionally graded carbon nanotube reinforced graphite/epoxy laminates

    Kuo, Shih-Yao

    2018-03-01

    This study provides the first-known vibration analysis of fully functionally graded carbon nanotube reinforced hybrid composite (FFG-CNTRHC) laminates. CNTs are non-uniformly distributed to reinforce the graphite/epoxy laminates. Some CNT distribution functions in the plane and thickness directions are proposed to more efficiently increase the stiffening effect. The rule of mixtures is modified by considering the non-homogeneous material properties of FFG-CNTRHC laminates. The formulation of the location dependent stiffness matrix and mass matrix is derived. The effects of CNT volume fraction and distribution on the natural frequencies of FFG-CNTRHC laminates are discussed. The results reveal that the FFG layout may significantly increase the natural frequencies of FFG-CNTRHC laminate.

  20. Bonding techniques for flexural strengthening of R.C. beams using CFRP laminates

    Alaa Morsy

    2013-09-01

    Full Text Available This paper presents an experimental study of an alternative method of attaching FRP laminates to reinforced concrete beams by the way of fasting steel rivets through the FRP laminate and concrete substrate. Five full scale R.C. beams were casted and strengthened in flexural using FRP laminate bonded with conventional epoxy and compared with other beams strengthened with FRP laminate and bonded with fastener “steel rivets” of 50 mm length and 10 mm diameter. Based on experimental evidence the beam strengthened with conventional bonding methods failed due to de-bonding with about 13% increase over the un-strengthened beam. On the other hand, the beams strengthened with FRP laminate and bonded by four steel fastener rivets only failed by de-bonding also but at higher flexural capacity with increase 19% over the un-strengthened beam.

  1. Analysis of interlaminar stresses in symmetric and unsymmetric laminates under various loadings

    Leger, C. A.; Chan, W. S.

    1993-04-01

    A quasi-three-dimensional finite-element model is developed to investigate the interlaminar stresses in a composite laminate under combined loadings. An isoparametric quadrilateral element with eight nodes and three degrees of freedom per node is the finite element used in this study. The element is used to model a composite laminate cross section loaded by tension, torsion, transverse shear, and both beam and chord bending which are representative of loading in a helicopter rotor system. Symmetric and unsymmetric laminates are examined with comparisons made between the interlaminar stress distributions and magnitudes for each laminate. Unsymmetric results are compared favorably to limited results found in literature. The unsymmetric interlaminar normal stress distribution in a symmetric laminate containing a free edge delamination is also examined.

  2. Enhancement of Gas Barrier Properties of CFRP Laminates Fabricated Using Thin-Ply Prepregs

    横関, 智弘; 高木, 智宏; 吉村, 彰記; Ogasawara, Toshio; 荻原, 慎二

    Composite laminates manufactured using thin-ply prepregs are expected to have superior resistance properties against microcracking compared to those using standard prepregs. In this study, comparative investigations are presented on the microcrack accumulation and gas leakage characteristics of CFRP laminates fabricated using standard and thin-ply prepregs, consisting of high-performance carbon fiber and toughened epoxy, as a fundamental research on the cryogenic composite tanks for future space vehicles. It was shown that laminates using thin-ply prepregs exhibited much higher strain at microcrack initiation compared to those using standard prepregs at room and cryogenic temperatures. In addition, helium gas leak tests using CFRP laminated tubular specimens subjected to quasi-static tension loadings were performed. It was demonstrated that CFRP laminates using thin-ply prepregs have higher gas barrier properties than those using standard prepregs.

  3. A transparent, solvent-free laminated top electrode for perovskite solar cells.

    Makha, Mohammed; Fernandes, Silvia Letícia; Jenatsch, Sandra; Offermans, Ton; Schleuniger, Jürg; Tisserant, Jean-Nicolas; Véron, Anna C; Hany, Roland

    2016-01-01

    A simple lamination process of the top electrode for perovskite solar cells is demonstrated. The laminate electrode consists of a transparent and conductive plastic/metal mesh substrate, coated with an adhesive mixture of poly(3,4-ethylenedioxythiophene):poly(styrenesulfonate), PEDOT:PSS, and sorbitol. The laminate electrode showed a high degree of transparency of 85%. Best cell performance was achieved for laminate electrodes prepared with a sorbitol concentration of ~30 wt% per milliliter PEDOT:PSS dispersion, and using a pre-annealing temperature of 120°C for 10 min before lamination. Thereby, perovskite solar cells with stabilized power conversion efficiencies of (7.6 ± 1.0)% were obtained which corresponds to 80% of the reference devices with reflective opaque gold electrodes.

  4. Structural properties of laminated Douglas fir/epoxy composite material

    Spera, D.A. (National Aeronautics and Space Administration, Cleveland, OH (USA). Lewis Research Center); Esgar, J.B. (Sverdrup Technology, Inc., Cleveland, OH (USA)); Gougeon, M.; Zuteck, M.D. (Gougeon Bros., Bay City, MI (USA))

    1990-05-01

    This publication contains a compilation of static and fatigue and strength data for laminated-wood material made from Douglas fir and epoxy. Results of tests conducted by several organizations are correlated to provide insight into the effects of variables such as moisture, size, lamina-to-lamina joint design, wood veneer grade, and the ratio of cyclic stress to steady stress during fatigue testing. These test data were originally obtained during development of wood rotor blades for large-scale wind turbines of the horizontal-axis (propeller) configuration. Most of the strength property data in this compilation are not found in the published literature. Test sections ranged from round cylinders 2.25 in. in diameter to rectangular slabs 6 in. by 24 in. in cross section and approximately 30 ft long. All specimens were made from Douglas fir veneers 0.10 in. thick, bonded together with the WEST epoxy system developed for fabrication and repair of wood boats. Loading was usually parallel to the grain. Size effects (reduction in strength with increase in test volume) are observed in some of the test data, and a simple mathematical model is presented that includes the probability of failure. General characteristics of the wood/epoxy laminate are discussed, including features that make it useful for a wide variety of applications. 9 refs.

  5. Energy Saving Glass Lamination via Selective Radio Frequency Heating

    Shawn M. Allan; Patricia M. Strickland; Holly S. Shulman

    2009-11-11

    Ceralink Inc. developed FastFuse™, a rapid, new, energy saving process for lamination of glass and composites using radio frequency (RF) heating technology. The Inventions and Innovations program supported the technical and commercial research and development needed to elevate the innovation from bench scale to a self-supporting technology with significant potential for growth. The attached report provides an overview of the technical and commerical progress achieved for FastFuse™ during the course of the project. FastFuse™ has the potential to revolutionize the laminate manufacturing industries by replacing energy intensive, multi-step processes with an energy efficient, single-step process that allows higher throughput. FastFuse™ transmits RF energy directly into the interlayer to generate heat, eliminating the need to directly heat glass layers and the surrounding enclosures, such as autoclaves or vacuum systems. FastFuse™ offers lower start-up and energy costs (up to 90% or more reduction in energy costs), and faster cycles times (less than 5 minutes). FastFuse™ is compatible with EVA, TPU, and PVB interlayers, and has been demonstrated for glass, plastics, and multi-material structures such as photovoltaics and transparent armor.

  6. Analysis of nonlinear deformations and damage in CFRP textile laminates

    Ullah, H; Harland, A R; Silberschmidt, V V; Lucas, T; Price, D

    2011-01-01

    Carbon fibre-reinforced polymer (CFRP) textile composites are widely used in aerospace, automotive and construction components and structures thanks to their relatively low production costs, higher delamination and impact strength. They can also be used in various products in sports industry. These products are usually exposed to different in-service conditions such as large bending deformation and multiple impacts. Composite materials usually demonstrate multiple modes of damage and fracture due to their heterogeneity and microstructure, in contrast to more traditional homogeneous structural materials like metals and alloys. Damage evolution affects both their in-service properties and performance that can deteriorate with time. These damage modes need adequate means of analysis and investigation, the major approaches being experimental characterisation, numerical simulations and microtomography analysis. This research deals with a deformation behaviour and damage in composite laminates linked to their quasi-static bending. Experimental tests are carried out to characterise the behaviour of woven CFRP material under large-deflection bending. Two-dimensional finite element (FE) models are implemented in the commercial code Abaqus/Explicit to study the deformation behaviour and damage in woven CFRP laminates. Multiple layers of bilinear cohesive-zone elements are employed to model the onset and progression of inter-ply delamination process. X-ray Micro-Computed Tomography (MicroCT) analysis is carried out to investigate internal damage mechanisms such as cracking and delaminations. The obtained results of simulations are in agreement with experimental data and MicroCT scans.

  7. Experiments on vibration control of a piezoelectric laminated paraboloidal shell

    Yue, Honghao; Lu, Yifan; Deng, Zongquan; Tzou, Hornsen

    2017-01-01

    A paraboloidal shell plays a key role in aerospace and optical structural systems applied to large optical reflector, communications antenna, rocket fairing, missile radome, etc. Due to the complexity of analytical procedures, an experimental study of active vibration control of a piezoelectric laminated paraboloidal shell by positive position feedback is carried out. Sixteen PVDF patches are laminated inside and outside of the shell, in which eight of them are used as sensors and eight as actuators to control the vibration of the first two natural modes. Lower natural frequencies and vibration modes of the paraboloidal shell are obtained via the frequency response function analysis by Modal VIEW software. A mathematical model of the control system is formulated by means of parameter identification. The first shell mode is controlled as well as coupled the first and second modes based on the positive position feedback (PPF) algorithm. To minimize the control energy consumption in orbit, an adaptive modal control method is developed in this study by using the PPF in laboratory experiments. The control system collects vibration signals from the piezoelectric sensors to identify location(s) of the largest vibration amplitudes and then select the best two from eight PVDF actuators to apply control forces so that the modal vibration suppression could be accomplished adaptively and effectively.

  8. Irradiating rubber laminate containing sensitive agent in layer

    Bohm, G.G.A.

    1979-01-01

    Rubber compounds may be sensitized to cure or partially cure when subjected to irradiation. If certain layers of a rubber laminate are treated with sensitizing materials and other layers wth densensitizing materials a composite is produced having cured and uncured layers after it has been subjected to irradiation. This technique enables the production of composite laminates in which predetermined layers have predetermined physical characteristics which are desirable in the manufacture of the ultimate end product, for example, automotive tires. Several chemicals have been found to accelerate the cure of rubber compounds by irradiation and several have been found which inhibit the cure. Paradichlorobenzene (PDCB) and certain of the thioetherpolythiols are effective cure promotors. Effective retarders include aromatic oils, sulfur, sulfur cure accelerators and some rubber antioxidants and/or antiozonants of the substituted diphenylamine type. The dosage of irradiation is dependent upon several variables: the type of rubber, the promotor or retarder utilized, the level of the promotor or retarder, the thickness of the layer of material, the thickness of adjacent layers of materials, the sequence of the layers of material, the number of the layers of material and whether the irradiation is applied to one or both sides of the composite strip. The dosage may be controlled by the amount of energy employed so that the electrons do not completely penetrate the entire strip. This results in the irradiaton of part of the strip, but not the entire strip. (LL)

  9. Analysis of nonlinear deformations and damage in CFRP textile laminates

    Ullah, H; Harland, A R; Silberschmidt, V V [Wolfson School of Mechanical and Manufacturing Engineering, Loughborough University, Leicester-shire, LE11 3TU (United Kingdom); Lucas, T; Price, D, E-mail: H.Ullah@lboro.ac.uk [Adidas AG, Herzogenaruch (Germany)

    2011-07-19

    Carbon fibre-reinforced polymer (CFRP) textile composites are widely used in aerospace, automotive and construction components and structures thanks to their relatively low production costs, higher delamination and impact strength. They can also be used in various products in sports industry. These products are usually exposed to different in-service conditions such as large bending deformation and multiple impacts. Composite materials usually demonstrate multiple modes of damage and fracture due to their heterogeneity and microstructure, in contrast to more traditional homogeneous structural materials like metals and alloys. Damage evolution affects both their in-service properties and performance that can deteriorate with time. These damage modes need adequate means of analysis and investigation, the major approaches being experimental characterisation, numerical simulations and microtomography analysis. This research deals with a deformation behaviour and damage in composite laminates linked to their quasi-static bending. Experimental tests are carried out to characterise the behaviour of woven CFRP material under large-deflection bending. Two-dimensional finite element (FE) models are implemented in the commercial code Abaqus/Explicit to study the deformation behaviour and damage in woven CFRP laminates. Multiple layers of bilinear cohesive-zone elements are employed to model the onset and progression of inter-ply delamination process. X-ray Micro-Computed Tomography (MicroCT) analysis is carried out to investigate internal damage mechanisms such as cracking and delaminations. The obtained results of simulations are in agreement with experimental data and MicroCT scans.

  10. Control and characterization of a bistable laminate generated with piezoelectricity

    Lee, Andrew J.; Moosavian, Amin; Inman, Daniel J.

    2017-08-01

    Extensive research has been conducted on utilizing smart materials such as piezoelectric and shape memory alloy actuators to induce snap through of bistable structures for morphing applications. However, there has only been limited success in initiating snap through from both stable states due to the lack of actuation authority. A novel solution in the form of a piezoelectrically generated bistable laminate consisting of only macro fiber composites (MFC), allowing complete configuration control without any external assistance, is explored in detail here. Specifically, this paper presents the full analytical, computational, and experimental results of the laminate’s design, geometry, bifurcation behavior, and snap through capability. By bonding two actuated MFCs in a [0MFC/90MFC]T layup and releasing the voltage post cure, piezoelectric strain anisotropy and the resulting in-plane residual stresses yield two statically stable states that are cylindrically shaped. The analytical model uses the Rayleigh-Ritz minimization of total potential energy and finite element analysis is implemented in MSC Nastran. The [0MFC/90MFC]T laminate is then manufactured and experimentally characterized for model validation. This paper demonstrates the adaptive laminate’s unassisted forward and reverse snap through capability enabled by the efficiencies gained from simultaneously being the actuator and the primary structure.

  11. Irradiation effects in tungsten-copper laminate composite

    Garrison, L.M., E-mail: garrisonlm@ornl.gov [Oak Ridge National Laboratory, Oak Ridge, TN 37831 (United States); Katoh, Y. [Oak Ridge National Laboratory, Oak Ridge, TN 37831 (United States); Snead, L.L. [Oak Ridge National Laboratory, Oak Ridge, TN 37831 (United States); Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Byun, T.S. [Oak Ridge National Laboratory, Oak Ridge, TN 37831 (United States); Pacific Northwest National Laboratory, Richland, WA 99352 (United States); Reiser, J.; Rieth, M. [Karlsruhe Institute of Technology, Karlsruhe (Germany)

    2016-12-01

    Tungsten-copper laminate composite has shown promise as a structural plasma-facing component as compared to tungsten rod or plate. The present study evaluated the tungsten-copper composite after irradiation in the High Flux Isotope Reactor (HFIR) at temperatures of 410–780 °C and fast neutron fluences of 0.02–9.0 × 10{sup 25} n/m{sup 2}, E > 0.1 MeV, 0.0039–1.76 displacements per atom (dpa) in tungsten. Tensile tests were performed on the composites, and the fracture surfaces were analyzed with scanning electron microscopy. Before irradiation, the tungsten layers had brittle cleavage failure, but the overall composite had 15.5% elongation at 22 °C. After only 0.0039 dpa this was reduced to 7.7% elongation, and no ductility was observed after 0.2 dpa at all irradiation temperatures when tensile tested at 22 °C. For elevated temperature tensile tests after irradiation, the composite only had ductile failure at temperatures where the tungsten was delaminating or ductile. - Highlights: • Fusion reactors need a tough, ductile tungsten plasma-facing material. • The unirradiated tungsten-copper laminate is more ductile than tungsten alone. • After neutron irradiation, the composite has significantly less ductility. • The tungsten behavior appears to dominate the overall composite behavior.

  12. Fabrication of laminated Bi-2212/Ag multifilamentary tape

    Yuan, D.-W.; Majer, W. J.; Francavilla, T. L.

    2000-03-01

    The powder-in-tube (PIT) process has been successfully used to make long lengths of Ag-sheathed oxide superconductors. A modified PIT approach is proposed to fabricate conductors with laminated Bi-2212 configurations. Ag/Bi-2212 tapes consisting of seven laminae were produced with various thicknesses ranging from 0.38 to 0.25 mm. The use of a turkshead was found to be beneficial, yielding tapes with good dimensional integrity and consistency. Critical current density (Jc ) values greater than 105 A cm-2 (0.01 T and Bicons/Journals/Common/perp" ALT="perp" ALIGN="TOP"/> tape surface) have been attained for tapes of different thicknesses. Nonetheless, Jc was found to be related to the average thickness of individual Bi-2212 lamina. It is believed that excessive cold working accounts for the decrease in Jc with decreasing size below a threshold value. The enhancement of Jc is attributed to the high Bi-2212 grain alignment along the Ag-oxide interfaces and uniform dimensions within the laminate conductors.

  13. Laminated materials with plastic interfaces: modeling and calculation

    Sandino Aquino de los Ríos, Gilberto; Castañeda Balderas, Rubén; Diaz Diaz, Alberto; Duong, Van Anh; Chataigner, Sylvain; Caron, Jean-François; Ehrlacher, Alain; Foret, Gilles

    2009-01-01

    In this paper, a model of laminated plates called M4-5N and validated in a previous paper is modified in order to take into account interlaminar plasticity by means of displacement discontinuities at the interfaces. These discontinuities are calculated by adapting a 3D plasticity model. In order to compute the model, a Newton–Raphson-like method is employed. In this method, two sub-problems are considered: one is linear and the other is non-linear. In the linear problem the non-linear equations of the model are linearized and the calculations are performed by making use of a finite element software. By iterating the resolution of each sub-problem, one obtains after convergence the solution of the global problem. The model is then applied to the problem of a double lap, adhesively bonded joint subjected to a tensile load. The adhesive layer is modeled by an elastic–plastic interface. The results of the M4-5N model are compared with those of a commercial finite element software. A good agreement between the two computation techniques is obtained and validates the non-linear calculations proposed in this paper. Finally, the numerical tool and a delamination criterion are applied to predict delamination onset in composite laminates

  14. Enhanced laminated composite phase change material for energy storage

    Darkwa, J.; Zhou, T. [Centre for Sustainable Energy Technologies (CSET), The University of Nottingham Ningbo, 199 Taikang East Road, Ningbo 315100 (China)

    2011-02-15

    This paper summarises studies undertaken towards the development of a laminated composite aluminium/hexadecane phase change material (PCM) drywall based on previous analytical work. The study also covered the selection and testing of various types of adhesive materials and identified Polyvinyl acetate (PVA) material as a suitable bonding material. For the purpose of comparison pure hexadecane and composite aluminium/hexadecane samples were developed and tested. The test results revealed faster thermal response by the aluminium/hexadecane sample regarding the rate of heat flux and also achieved about 10% and 15% heat transfer enhancements during the charging and discharging periods respectively. Its measured effective thermal conductivity also increased remarkably to 1.25 W/mK as compared with 0.15 W/mK for pure hexadecane. However there was about 5% less total cumulative thermal energy discharged at the end of the test which indicates that its effective thermal capacity was reduced by the presence of the aluminium particles. The study has shown that some of the scientific and technical barriers associated with the development of laminated composite PCM drywall systems can be overcome but further investigations of effects of adhesive materials are needed. (author)

  15. Analysis of nonlinear deformations and damage in CFRP textile laminates

    Ullah, H.; Harland, A. R.; Lucas, T.; Price, D.; Silberschmidt, V. V.

    2011-07-01

    Carbon fibre-reinforced polymer (CFRP) textile composites are widely used in aerospace, automotive and construction components and structures thanks to their relatively low production costs, higher delamination and impact strength. They can also be used in various products in sports industry. These products are usually exposed to different in-service conditions such as large bending deformation and multiple impacts. Composite materials usually demonstrate multiple modes of damage and fracture due to their heterogeneity and microstructure, in contrast to more traditional homogeneous structural materials like metals and alloys. Damage evolution affects both their in-service properties and performance that can deteriorate with time. These damage modes need adequate means of analysis and investigation, the major approaches being experimental characterisation, numerical simulations and microtomography analysis. This research deals with a deformation behaviour and damage in composite laminates linked to their quasi-static bending. Experimental tests are carried out to characterise the behaviour of woven CFRP material under large-deflection bending. Two-dimensional finite element (FE) models are implemented in the commercial code Abaqus/Explicit to study the deformation behaviour and damage in woven CFRP laminates. Multiple layers of bilinear cohesive-zone elements are employed to model the onset and progression of inter-ply delamination process. X-ray Micro-Computed Tomography (MicroCT) analysis is carried out to investigate internal damage mechanisms such as cracking and delaminations. The obtained results of simulations are in agreement with experimental data and MicroCT scans.

  16. Aluminum Laminates in Beverage Packaging: Models and Experiences

    Gabriella Bolzon

    2015-08-01

    Full Text Available Aluminum laminates are among the main components of beverage packaging. These layered material systems are coupled to paperboard plies except in the cap opening area, where the human force limit sets a requirement on the material properties to allow open-ability and the mechanical characteristics are of particular interest. Experimental investigations have been carried out on this composite and on its components by either traditional or full-field measurement techniques. The interpretation of the collected data has been supported by the simulation of the performed tests considering either a homogenized material model or the individual laminate layers. However, different results may be recovered from similar samples due to physical factors like the material processing route and the embedded defectiveness. In turn, the conclusions may vary depending on the model assumptions. This contribution focuses on the physical effects and on the modeling of the large localized deformation induced by material singularities. This topic is discussed at the light of some experimental results.

  17. Genome-wide identification and analysis of the B3 superfamily of transcription factors in Brassicaceae and major crop plants.

    Peng, Fred Y; Weselake, Randall J

    2013-05-01

    The plant-specific B3 superfamily of transcription factors has diverse functions in plant growth and development. Using a genome-wide domain analysis, we identified 92, 187, 58, 90, 81, 55, and 77 B3 transcription factor genes in the sequenced genome of Arabidopsis, Brassica rapa, castor bean (Ricinus communis), cocoa (Theobroma cacao), soybean (Glycine max), maize (Zea mays), and rice (Oryza sativa), respectively. The B3 superfamily has substantially expanded during the evolution in eudicots particularly in Brassicaceae, as compared to monocots in the analysis. We observed domain duplication in some of these B3 proteins, forming more complex domain architectures than currently understood. We found that the length of B3 domains exhibits a large variation, which may affect their exact number of α-helices and β-sheets in the core structure of B3 domains, and possibly have functional implications. Analysis of the public microarray data indicated that most of the B3 gene pairs encoding Arabidopsis-rice orthologs are preferentially expressed in different tissues, suggesting their different roles in these two species. Using ESTs in crops, we identified many B3 genes preferentially expressed in reproductive tissues. In a sequence-based quantitative trait loci analysis in rice and maize, we have found many B3 genes associated with traits such as grain yield, seed weight and number, and protein content. Our results provide a framework for future studies into the function of B3 genes in different phases of plant development, especially the ones related to traits in major crops.

  18. 40 CFR Table 11 to Subpart Wwww of... - Data Requirements for New and Existing Continuous Lamination and Continuous Casting Lines...

    2010-07-01

    ... Continuous Lamination and Continuous Casting Lines Complying With a Percent Reduction Limit or a Lbs/Ton...—Data Requirements for New and Existing Continuous Lamination and Continuous Casting Lines Complying... lamination lines and continuous casting lines you must determine the data in the following table: For each...

  19. 40 CFR 63.5820 - What are my options for meeting the standards for continuous lamination/casting operations?

    2010-07-01

    ... standards for continuous lamination/casting operations? 63.5820 Section 63.5820 Protection of Environment... meeting the standards for continuous lamination/casting operations? You must use one or more of the... continuous lamination line and each continuous casting line complies with the applicable standard. (b...

  20. EPHB2 germline variants in patients with colorectal cancer or hyperplastic polyposis

    Kokko, Antti; Tomlinson, Ian PM; Vahteristo, Pia; Aaltonen, Lauri A; Laiho, Päivi; Lehtonen, Rainer; Korja, Sanna; Carvajal-Carmona, Luis G; Järvinen, Heikki; Mecklin, Jukka-Pekka; Eng, Charis; Schleutker, Johanna

    2006-01-01

    Ephrin receptor B2 (EPHB2) has recently been proposed as a novel tumor suppressor gene in colorectal cancer (CRC). Inactivation of the gene has been shown to correlate with progression of colorectal tumorigenesis, and somatic mutations have been reported in both colorectal and prostate tumors. Here we have analyzed the EPHB2 gene for germline alterations in 101 individuals either with 1) CRC and a personal or family history of prostate cancer (PC), or 2) intestinal hyperplastic polyposis (HPP), a condition associated with malignant degeneration such as serrated adenoma and CRC. Four previously unknown missense alterations were observed, which may be associated with the disease phenotype. Two of the changes, I361V and R568W, were identified in Finnish CRC patients, but not in over 300 Finnish familial CRC or PC patients or more than 200 population-matched healthy controls. The third change, D861N, was observed in a UK HPP patient, but not in additional 40 UK HPP patients or in 200 UK healthy controls. The fourth change R80H, originally identified in a Finnish CRC patient, was also found in 1/106 familial CRC patients and in 9/281 healthy controls and is likely to be a neutral polymorphism. We detected novel germline EPHB2 alterations in patients with colorectal tumors. The results suggest a limited role for these EPHB2 variants in colon tumor predisposition. Further studies including functional analyses are needed to confirm this