Conjugated oligoelectrolyte represses hydrogen oxidation by Geobacter sulfurreducens in microbial electrolysis cells

KAUST Repository

Liu, Jia

2015-12-01

© 2015 Elsevier B.V. A conjugated oligoelectrolyte (COE), which spontaneously aligns within cell membranes, was shown to completely inhibit H2 uptake by Geobacter sulfurreducens in microbial electrolysis cells. Coulombic efficiencies that were 490±95%, due to H2 recycling between the cathode and microorganisms on the anode, were reduced to 86±2% with COE addition. The use of the COE resulted in a 67-fold increase in H2 gas recovery, and a 4.4-fold increase in acetate removal. Current generation, H2 recovery and COD removals by Geobacter metallireducens, which cannot use H2, were unaffected by COE addition. These results show that this COE is an effective H2 uptake inhibitor, and that it can enable improved and sustained H2 gas recovery in this bioelectrochemical system.

Enhanced Uranium Immobilization and Reduction by Geobacter sulfurreducens Biofilms

Science.gov (United States)

Cologgi, Dena L.; Speers, Allison M.; Bullard, Blair A.; Kelly, Shelly D.

2014-01-01

Biofilms formed by dissimilatory metal reducers are of interest to develop permeable biobarriers for the immobilization of soluble contaminants such as uranium. Here we show that biofilms of the model uranium-reducing bacterium Geobacter sulfurreducens immobilized substantially more U(VI) than planktonic cells and did so for longer periods of time, reductively precipitating it to a mononuclear U(IV) phase involving carbon ligands. The biofilms also tolerated high and otherwise toxic concentrations (up to 5 mM) of uranium, consistent with a respiratory strategy that also protected the cells from uranium toxicity. The enhanced ability of the biofilms to immobilize uranium correlated only partially with the biofilm biomass and thickness and depended greatly on the area of the biofilm exposed to the soluble contaminant. In contrast, uranium reduction depended on the expression of Geobacter conductive pili and, to a lesser extent, on the presence of the c cytochrome OmcZ in the biofilm matrix. The results support a model in which the electroactive biofilm matrix immobilizes and reduces the uranium in the top stratum. This mechanism prevents the permeation and mineralization of uranium in the cell envelope, thereby preserving essential cellular functions and enhancing the catalytic capacity of Geobacter cells to reduce uranium. Hence, the biofilms provide cells with a physically and chemically protected environment for the sustained immobilization and reduction of uranium that is of interest for the development of improved strategies for the in situ bioremediation of environments impacted by uranium contamination. PMID:25128347

Visible spectroelectrochemical characterization of Geobacter sulfurreducens biofilms on optically transparent indium tin oxide electrode

International Nuclear Information System (INIS)

Jain, Anand; Gazzola, Giulio; Panzera, Aurora; Zanoni, Michele; Marsili, Enrico

2011-01-01

We report visible spectroelectrochemical (SEC) characterization of cytochrome c 552 (cyt c 552 ) in viable Geobacter sulfurreducens biofilms on tin-doped indium oxide (ITO) electrodes poised at 0.24 V vs. SHE. G. sulfurreducens biofilms were grown in minimal medium with acetate as electron donor (turnover conditions), followed by 24 h incubation in electron donor-depleted medium (non-turnover conditions). The electronic absorption spectra of G. sulfurreducens biofilms showed the lowest energy absorption band in the reduced state at 552 nm, which indicated excess of cyt c 552 in the biofilm. The spectra under non-turnover conditions displayed gradual reduction of the cyt c 552 , following the step-wise decrease of electrode potential from 0.0 V to −0.6 V vs. standard calomel electrode (SCE). The spectral changes were fully reversible in both positive and negative direction of the scan potential, with average midpoint potential value of −0.42 V vs. SCE. Confocal microscopy analysis revealed that the thickness of biofilms under turnover conditions and non-turnover conditions was approximately 35 and 3.5 μm, respectively. This is the first study to observe the reversible redox conversion of cyt c 552 in viable G. sulfurreducens biofilms.

Microbial electrocatalysis with Geobacter sulfurreducens biofilm on stainless steel cathodes

International Nuclear Information System (INIS)

Dumas, Claire; Basseguy, Regine; Bergel, Alain

2008-01-01

Stainless steel and graphite electrodes were individually addressed and polarized at -0.60 V vs. Ag/AgCl in reactors filled with a growth medium that contained 25 mM fumarate as the electron acceptor and no electron donor, in order to force the microbial cells to use the electrode as electron source. When the reactor was inoculated with Geobacter sulfurreducens, the current increased and stabilized at average values around 0.75 A m -2 for graphite and 20.5 A m -2 for stainless steel. Cyclic voltammetry performed at the end of the experiment indicated that the reduction started at around -0.30 V vs. Ag/AgCl on stainless steel. Removing the biofilm formed on the electrode surface made the current totally disappear, confirming that the G.sulfurreducens biofilm was fully responsible for the electrocatalysis of fumarate reduction. Similar current densities were recorded when the electrodes were polarized after being kept in open circuit for several days. The reasons for the bacteria presence and survival on non-connected stainless steel coupons were discussed. Chronoamperometry experiments performed at different potential values suggested that the biofilm-driven catalysis was controlled by electrochemical kinetics. The high current density obtained, quite close to the redox potential of the fumarate/succinate couple, presents stainless steel as a remarkable material to support biocathodes

MOLECULAR DOCKING AND DYNAMICS STUDIES ON THE PROTEIN-PROTEIN INTERACTIONS OF ELECTRICALLY ACTIVE PILIN NANOWIRES OF GEOBACTER SULFURREDUCENS.

Directory of Open Access Journals (Sweden)

D. Jeya Sundara Sharmila1 *

2017-06-01

Full Text Available Molecular interactions are key aspects in biological recognitions applicable in nano/micro systems. Bacterial nanowires are pilus filament based structures that can conduct electrons. The transport of electron is proposed to be facilitated by filamentous fibers made up of polymeric assemblies of proteins called pilin. Geobacter sulfurreducens is capable of delivering electrons through extracellular electron transport (EET by employing conductive nanowires, which are pilin proteins composed of type IV subunit PilA. Protein-protein interactions play an important role in the stabilization of the pilin nanowire assembly complex and it contains transmembrane (TM domain. In current study, protein-protein docking and multiple molecular dynamic (MD simulations were performed to understand the binding mode of pilin nanowires. The MD result explains the conformational behavior and folding of pilin nanowires in water environment in different time scale duration 20, 5, 5, 10 and 20ns (total of 60ns. Direct hydrogen bonds and water mediated hydrogen bonds that play a crucial role during the simulation were investigated. The conformational state, folding, end-toend distance profile and hydrogen bonding behavior had indicated that the Geobacter sulfurreducens pilin nanowires have electrical conductivity properties.

Mechanisms for the reduction of actinide ions by Geobacter sulfurreducens

International Nuclear Information System (INIS)

Renshaw, J.C.; Livens, F.R.; May, I.; Lloyd, J.R.

2005-01-01

Full text of publication follows: Three of the most problematic radioactive contaminants are the actinide elements uranium, neptunium and plutonium. All three pose considerable long-term environmental risks. The most stable environmental oxidation states of uranium and neptunium are VI and V, respectively, as the di-oxo cations [UO 2 ] 2+ and [NpO 2 ] + ; both are highly soluble and so are relatively mobile and biologically available in the environment. In similar conditions, plutonium mainly exists as Pu(IV), which forms a highly insoluble hydrous oxide, although is also environmentally stable in the more soluble III, V and VI oxidation states. The bio-reduction of U(VI) by anaerobic subsurface microorganisms has been the focus of much recent interest. Both Fe(III)- and sulfate-reducing bacteria have been shown to reduce soluble [U VI O 2 ] 2+ to insoluble U IV O 2 , with c-type cytochromes involved in electron transfer to the actinide. Such transformations offer a strategy for the bio-remediation of uranium contaminated groundwater and a potential mechanism for the bio-deposition of uranium ores. The mechanism of U(VI). reduction has important implications for the potential microbial reduction of transuranic elements with environmentally stable lower oxidation states. Reduction of mobile 237 Np(V) to Np(IV) and subsequent precipitation may be advantageous whilst remobilization of immobile Pu(IV) as more soluble Pu(III) species could have important environmental implications. Conversely, selective reduction might allow targeting of particular radionuclide species. The model anaerobic bacterium Geobacter sulfurreducens is typical of those found in contaminated subsurface environments and has been shown to reduce soluble [U VI O 2 ] 2+ to insoluble U IV O 2 . In the course of this study we use X-ray absorption spectroscopy (XAS) to show that G. sulfurreducens reduces U(VI) by a one-electron reduction, forming an unstable [UO 2 ] + species which subsequently

Geobacter anodireducens sp. nov., an exoelectrogenic microbe in bioelectrochemical systems

KAUST Repository

Sun, D.

2014-07-22

© 2014 IUMS. A previously isolated exoelectrogenic bacterium, strain SD-1(T), was further characterized and identified as a representative of a novel species of the genus Geobacter. Strain SD-1(T) was Gram-negative, aerotolerant, anaerobic, non-spore-forming, non-fermentative and non-motile. Cells were short, curved rods (0.8-1.3 µm long and 0.3 µm in diameter). Growth of strain SD-1(T) was observed at 15-42 °C and pH 6.0-8.5, with optimal growth at 30-35 °C and pH 7. Analysis of 16S rRNA gene sequences indicated that the isolate was a member of the genus Geobacter, with the closest known relative being Geobacter sulfurreducens PCA(T) (98% similarity). Similar to other members of the genus Geobacter, strain SD-1(T) used soluble or insoluble Fe(III) as the sole electron acceptor coupled with the oxidation of acetate. However, SD-1(T) could not reduce fumarate as an electron acceptor with acetate oxidization, which is an important physiological trait for G. sulfurreducens. Moreover, SD-1(T) could grow in media containing as much as 3% NaCl, while G. sulfurreducens PCA(T) can tolerate just half this concentration, and this difference in salt tolerance was even more obvious when cultivated in bioelectrochemical systems. DNA-DNA hybridization analysis of strain SD-1(T) and its closest relative, G. sulfurreducens ATCC 51573(T), showed a relatedness of 61.6%. The DNA G+C content of strain SD-1(T) was 58.9 mol%. Thus, on the basis of these characteristics, strain SD-1(T) was not assigned to G. sulfurreducens, and was instead classified in the genus Geobacter as a representative of a novel species. The name Geobacter anodireducens sp. nov. is proposed, with the type strain SD-1(T) ( = CGMCC 1.12536(T) = KCTC 4672(T)).

Reduction of low potential electron acceptors requires the CbcL inner membrane cytochrome of Geobacter sulfurreducens.

Science.gov (United States)

Zacharoff, Lori; Chan, Chi Ho; Bond, Daniel R

2016-02-01

The respiration of metals by the bacterium Geobacter sulfurreducens requires electrons generated by metabolism to pass from the interior of the cell to electron acceptors beyond the cell membranes. The G. sulfurreducens inner membrane multiheme c-type cytochrome ImcH is required for respiration to extracellular electron acceptors with redox potentials greater than -0.1 V vs. SHE, but ImcH is not essential for electron transfer to lower potential acceptors. In contrast, deletion of cbcL, encoding an inner membrane protein consisting of b-type and multiheme c-type cytochrome domains, severely affected reduction of low potential electron acceptors such as Fe(III)-oxides and electrodes poised at -0.1 V vs. SHE. Catalytic cyclic voltammetry of a ΔcbcL strain growing on poised electrodes revealed a 50 mV positive shift in driving force required for electron transfer out of the cell. In non-catalytic conditions, low-potential peaks present in wild type biofilms were absent in ∆cbcL mutants. Expression of cbcL in trans increased growth at low redox potential and restored features to cyclic voltammetry. This evidence supports a model where CbcL is a component of a second electron transfer pathway out of the G. sulfurreducens inner membrane that dominates when redox potential is at or below -0.1 V vs. SHE. Copyright © 2015. Published by Elsevier B.V.

MacA is a second cytochrome c peroxidase of Geobacter sulfurreducens.

Science.gov (United States)

Seidel, Julian; Hoffmann, Maren; Ellis, Katie E; Seidel, Antonia; Spatzal, Thomas; Gerhardt, Stefan; Elliott, Sean J; Einsle, Oliver

2012-04-03

The metal-reducing δ-proteobacterium Geobacter sulfurreducens produces a large number of c-type cytochromes, many of which have been implicated in the transfer of electrons to insoluble metal oxides. Among these, the dihemic MacA was assigned a central role. Here we have produced G. sulfurreducens MacA by recombinant expression in Escherichia coli and have solved its three-dimensional structure in three different oxidation states. Sequence comparisons group MacA into the family of diheme cytochrome c peroxidases, and the protein indeed showed hydrogen peroxide reductase activity with ABTS(-2) as an electron donor. The observed K(M) was 38.5 ± 3.7 μM H(2)O(2) and v(max) was 0.78 ± 0.03 μmol of H(2)O(2)·min(-1)·mg(-1), resulting in a turnover number k(cat) = 0.46 · s(-1). In contrast, no Fe(III) reductase activity was observed. MacA was found to display electrochemical properties similar to other bacterial diheme peroxidases, in addition to the ability to electrochemically mediate electron transfer to the soluble cytochrome PpcA. Differences in activity between CcpA and MacA can be rationalized with structural variations in one of the three loop regions, loop 2, that undergoes conformational changes during reductive activation of the enzyme. This loop is adjacent to the active site heme and forms an open loop structure rather than a more rigid helix as in CcpA. For the activation of the protein, the loop has to displace the distal ligand to the active site heme, H93, in loop 1. A H93G variant showed an unexpected formation of a helix in loop 2 and disorder in loop 1, while a M297H variant that altered the properties of the electron transfer heme abolished reductive activation.

Hydrogen Production by Geobacter Species and a Mixed Consortium in a Microbial Electrolysis Cell

KAUST Repository

Call, D. F.

2009-10-09

A hydrogen utilizing exoelectrogenic bacterium (Geobacter sulfurreducens) was compared to both a nonhydrogen oxidizer (Geobacter metallireducens) and a mixed consortium in order to compare the hydrogen production rates and hydrogen recoveries of pure and mixed cultures in microbial electrolysis cells (MECs). At an applied voltage of 0.7 V, both G. sulfurreducens and the mixed culture generated similar current densities (ca. 160 A/m3), resulting in hydrogen production rates of ca. 1.9 m3 H2/m 3/day, whereas G. metallireducens exhibited lower current densities and production rates of 110 ± 7 A/m3 and 1.3 ± 0.1 m3 H2/m3/day, respectively. Before methane was detected in the mixed-culture MEC, the mixed consortium achieved the highest overall energy recovery (relative to both electricity and substrate energy inputs) of 82% ± 8% compared to G. sulfurreducens (77% ± 2%) and G. metallireducens (78% ± 5%), due to the higher coulombic efficiency of the mixed consortium. At an applied voltage of 0.4 V, methane production increased in the mixed-culture MEC and, as a result, the hydrogen recovery decreased and the overall energy recovery dropped to 38% ± 16% compared to 80% ± 5% for G. sulfurreducens and 76% ± 0% for G. metallireducens. Internal hydrogen recycling was confirmed since the mixed culture generated a stable current density of 31 ± 0 A/m3 when fed hydrogen gas, whereas G. sulfurreducens exhibited a steady decrease in current production. Community analysis suggested that G. sulfurreducens was predominant in the mixed-culture MEC (72% of clones) despite its relative absence in the mixed-culture inoculum obtained from a microbial fuel cell reactor (2% of clones). These results demonstrate that Geobacter species are capable of obtaining similar hydrogen production rates and energy recoveries as mixed cultures in an MEC and that high coulombic efficiencies in mixed culture MECs can be attributed in part to the recycling of hydrogen into current. Copyright �

Hydrogen Production by Geobacter Species and a Mixed Consortium in a Microbial Electrolysis Cell▿

Science.gov (United States)

Call, Douglas F.; Wagner, Rachel C.; Logan, Bruce E.

2009-01-01

A hydrogen utilizing exoelectrogenic bacterium (Geobacter sulfurreducens) was compared to both a nonhydrogen oxidizer (Geobacter metallireducens) and a mixed consortium in order to compare the hydrogen production rates and hydrogen recoveries of pure and mixed cultures in microbial electrolysis cells (MECs). At an applied voltage of 0.7 V, both G. sulfurreducens and the mixed culture generated similar current densities (ca. 160 A/m3), resulting in hydrogen production rates of ca. 1.9 m3 H2/m3/day, whereas G. metallireducens exhibited lower current densities and production rates of 110 ± 7 A/m3 and 1.3 ± 0.1 m3 H2/m3/day, respectively. Before methane was detected in the mixed-culture MEC, the mixed consortium achieved the highest overall energy recovery (relative to both electricity and substrate energy inputs) of 82% ± 8% compared to G. sulfurreducens (77% ± 2%) and G. metallireducens (78% ± 5%), due to the higher coulombic efficiency of the mixed consortium. At an applied voltage of 0.4 V, methane production increased in the mixed-culture MEC and, as a result, the hydrogen recovery decreased and the overall energy recovery dropped to 38% ± 16% compared to 80% ± 5% for G. sulfurreducens and 76% ± 0% for G. metallireducens. Internal hydrogen recycling was confirmed since the mixed culture generated a stable current density of 31 ± 0 A/m3 when fed hydrogen gas, whereas G. sulfurreducens exhibited a steady decrease in current production. Community analysis suggested that G. sulfurreducens was predominant in the mixed-culture MEC (72% of clones) despite its relative absence in the mixed-culture inoculum obtained from a microbial fuel cell reactor (2% of clones). These results demonstrate that Geobacter species are capable of obtaining similar hydrogen production rates and energy recoveries as mixed cultures in an MEC and that high coulombic efficiencies in mixed culture MECs can be attributed in part to the recycling of hydrogen into current. PMID:19820150

Abundance of the multiheme c-type cytochrome OmcB increases in outer biofilm layers of electrode-grown Geobacter sulfurreducens.

Directory of Open Access Journals (Sweden)

Camille S Stephen

Full Text Available When Geobacter sulfurreducens utilizes an electrode as its electron acceptor, cells embed themselves in a conductive biofilm tens of microns thick. While environmental conditions such as pH or redox potential have been shown to change close to the electrode, less is known about the response of G. sulfurreducens to growth in this biofilm environment. To investigate whether respiratory protein abundance varies with distance from the electrode, antibodies against an outer membrane multiheme cytochrome (OmcB and cytoplasmic acetate kinase (AckA were used to determine protein localization in slices spanning ∼25 µm-thick G. sulfurreducens biofilms growing on polished electrodes poised at +0.24 V (vs. Standard Hydrogen Electrode. Slices were immunogold labeled post-fixing, imaged via transmission electron microscopy, and digitally reassembled to create continuous images allowing subcellular location and abundance per cell to be quantified across an entire biofilm. OmcB was predominantly localized on cell membranes, and 3.6-fold more OmcB was detected on cells 10-20 µm distant from the electrode surface compared to inner layers (0-10 µm. In contrast, acetate kinase remained constant throughout the biofilm, and was always associated with the cell interior. This method for detecting proteins in intact conductive biofilms supports a model where the utilization of redox proteins changes with depth.

Geobacter sulfurreducens adapts to low electrode potential for extracellular electron transfer

International Nuclear Information System (INIS)

Peng, Luo; Zhang, Xiao-Ting; Yin, Jie; Xu, Shuo-Yuan; Zhang, Yong; Xie, De-Ti; Li, Zhen-Lun

2016-01-01

Microbial extracellular electron transfer (EET) occurring in natural and engineering processes is attracting increasing interests. While a meaningful question for bioenergetics, microbial physiology and microbial electrochemical systems; less is known about the lower limit of electron acceptor reduction potential for EET. It is also unclear how microbes adapt to weak electron acceptors. This study evaluated Geobacter sulfurreducens biofilms grown with an electrode poised at −0.25 V vs. SHE. This potential was found to be sufficient for microbial metabolism and proliferation. The turnover cyclic voltammetries found that these biofilms had a half-saturation potential of −0.242 ± 0.004 V, in contrast to −0.151 ± 0.003 V for that of the biofilms grown under 0.2 V. For the biofilms grown under 0.2 V, differential pulse voltammetry showed that the metabolic current was mediated by interfacial cofactors with mid-point potential around −0.16 V performing single-electron electron transfer (ET). The major electron conduits for the biofilms respiring under −0.25 V had mid-point potentials of −0.22 V or −0.26 V, which appeared to perform two-electron ET. Under the non-turnover condition, both biofilms showed similar patterns in voltammograms and the low-potential conduits largely disappeared for the biofilms grown under −0.25 V. Transcriptome analysis identified 17 cytochrome-c genes significantly up-regulated for the biofilms grown under −0.25 V, together with many other genes linked to the ET system. It was also noted that, lowering the poised potential from −0.25 V to −0.28 V (the fuel standard oxidation potential) did not fully inhibit microbial respiration.

Contrasting Effects of Dissolved Organic Matter on Mercury Methylation by Geobacter sulfurreducens PCA and Desulfovibrio desulfuricans ND132.

Science.gov (United States)

Zhao, Linduo; Chen, Hongmei; Lu, Xia; Lin, Hui; Christensen, Geoff A; Pierce, Eric M; Gu, Baohua

2017-09-19

Natural dissolved organic matter (DOM) affects mercury (Hg) redox reactions and anaerobic microbial methylation in the environment. Several studies have shown that DOM can enhance Hg methylation, especially under sulfidic conditions, whereas others show that DOM inhibits Hg methylation due to strong Hg-DOM complexation. In this study, we investigated and compared the effects of DOM on Hg methylation by an iron-reducing bacterium Geobacter sulfurreducens PCA and a sulfate-reducing bacterium Desulfovibrio desulfuricans ND132 under nonsulfidic conditions. The methylation experiment was performed with washed cells either in the absence or presence of DOM or glutathione, both of which form strong complexes with Hg via thiol-functional groups. DOM was found to greatly inhibit Hg methylation by G. Sulfurreducens PCA but enhance Hg methylation by D. desulfuricans ND132 cells with increasing DOM concentration. These strain-dependent opposing effects of DOM were also observed with glutathione, suggesting that thiols in DOM likely played an essential role in affecting microbial Hg uptake and methylation. Additionally, DOM and glutathione greatly decreased Hg sorption by G. sulfurreducens PCA but showed little effect on D. desulfuricans ND132 cells, demonstrating that ND132 has a higher affinity to sorb or take up Hg than the PCA strain. These observations indicate that DOM effects on Hg methylation are bacterial strain specific, depend on the DOM:Hg ratio or site-specific conditions, and may thus offer new insights into the role of DOM in methylmercury production in the environment.

Hydrogen Production by Geobacter Species and a Mixed Consortium in a Microbial Electrolysis Cell

KAUST Repository

Call, D. F.; Wagner, R. C.; Logan, B. E.

2009-01-01

A hydrogen utilizing exoelectrogenic bacterium (Geobacter sulfurreducens) was compared to both a nonhydrogen oxidizer (Geobacter metallireducens) and a mixed consortium in order to compare the hydrogen production rates and hydrogen recoveries

Investigating different mechanisms for biogenic selenite transformations: Geobacter sulfurreducens, Shewanella oneidensis and Veillonella atypica

Science.gov (United States)

Pearce, C.I.; Pattrick, R.A.D.; Law, N.; Charnock, J.M.; Coker, V.S.; Fellowes, J.W.; Oremland, R.S.; Lloyd, J.R.

2009-01-01

The metal-reducing bacteria Geobacter sulfurreducens, Shewanella oneidensis and Veillonella atypica, use different mechanisms to transform toxic, bioavailable sodium selenite to less toxic, non-mobile elemental selenium and then to selenide in anaerobic environments, offering the potential for in situ and ex situ bioremediation of contaminated soils, sediments, industrial effluents, and agricultural drainage waters. The products of these reductive transformations depend on both the organism involved and the reduction conditions employed, in terms of electron donor and exogenous extracellular redox mediator. The intermediary phase involves the precipitation of elemental selenium nanospheres and the potential role of proteins in the formation of these structures is discussed. The bionanomineral phases produced during these transformations, including both elemental selenium nanospheres and metal selenide nanoparticles, have catalytic, semiconducting and light-emitting properties, which may have unique applications in the realm of nanophotonics. This research offers the potential to combine remediation of contaminants with the development of environmentally friendly manufacturing pathways for novel bionanominerals. ?? 2009 Taylor & Francis.

pH, redox potential and local biofilm potential microenvironments within Geobacter sulfurreducens biofilms and their roles in electron transfer.

Science.gov (United States)

Babauta, Jerome T; Nguyen, Hung Duc; Harrington, Timothy D; Renslow, Ryan; Beyenal, Haluk

2012-10-01

The limitation of pH inside electrode-respiring biofilms is a well-known concept. However, little is known about how pH and redox potential are affected by increasing current inside biofilms respiring on electrodes. Quantifying the variations in pH and redox potential with increasing current is needed to determine how electron transfer is tied to proton transfer within the biofilm. In this research, we quantified pH and redox potential variations in electrode-respiring Geobacter sulfurreducens biofilms as a function of respiration rates, measured as current. We also characterized pH and redox potential at the counter electrode. We concluded that (1) pH continued to decrease in the biofilm through different growth phases, showing that the pH is not always a limiting factor in a biofilm and (2) decreasing pH and increasing redox potential at the biofilm electrode were associated only with the biofilm, demonstrating that G. sulfurreducens biofilms respire in a unique internal environment. Redox potential inside the biofilm was also compared to the local biofilm potential measured by a graphite microelectrode, where the tip of the microelectrode was allowed to acclimatize inside the biofilm. Copyright © 2012 Wiley Periodicals, Inc.

A novel Geobacteraceae-specific outer membrane protein J (OmpJ is essential for electron transport to Fe (III and Mn (IV oxides in Geobacter sulfurreducens

Directory of Open Access Journals (Sweden)

Schiffer Marianne

2005-07-01

Full Text Available Abstract Background Metal reduction is thought to take place at or near the bacterial outer membrane and, thus, outer membrane proteins in the model dissimilatory metal-reducing organism Geobacter sulfurreducens are of interest to understand the mechanisms of Fe(III reduction in the Geobacter species that are the predominant Fe(III reducers in many environments. Previous studies have implicated periplasmic and outer membrane cytochromes in electron transfer to metals. Here we show that the most abundant outer membrane protein of G. sulfurreducens, OmpJ, is not a cytochrome yet it is required for metal respiration. Results When outer membrane proteins of G. sulfurreducens were separated via SDS-PAGE, one protein, designated OmpJ (outer membrane protein J, was particularly abundant. The encoding gene, which was identified from mass spectrometry analysis of peptide fragments, is present in other Geobacteraceae, but not in organisms outside this family. The predicted localization and structure of the OmpJ protein suggested that it was a porin. Deletion of the ompJ gene in G. sulfurreducens produced a strain that grew as well as the wild-type strain with fumarate as the electron acceptor but could not grow with metals, such as soluble or insoluble Fe (III and insoluble Mn (IV oxide, as the electron acceptor. The heme c content in the mutant strain was ca. 50% of the wild-type and there was a widespread loss of multiple cytochromes from soluble and membrane fractions. Transmission electron microscopy analyses of mutant cells revealed an unusually enlarged periplasm, which is likely to trigger extracytoplasmic stress response mechanisms leading to the degradation of periplasmic and/or outer membrane proteins, such as cytochromes, required for metal reduction. Thus, the loss of the capacity for extracellular electron transport in the mutant could be due to the missing c-type cytochromes, or some more direct, but as yet unknown, role of OmpJ in metal

Computational and experimental analysis of redundancy in the central metabolism of Geobacter sulfurreducens.

Directory of Open Access Journals (Sweden)

Daniel Segura

2008-02-01

Full Text Available Previous model-based analysis of the metabolic network of Geobacter sulfurreducens suggested the existence of several redundant pathways. Here, we identified eight sets of redundant pathways that included redundancy for the assimilation of acetate, and for the conversion of pyruvate into acetyl-CoA. These equivalent pathways and two other sub-optimal pathways were studied using 5 single-gene deletion mutants in those pathways for the evaluation of the predictive capacity of the model. The growth phenotypes of these mutants were studied under 12 different conditions of electron donor and acceptor availability. The comparison of the model predictions with the resulting experimental phenotypes indicated that pyruvate ferredoxin oxidoreductase is the only activity able to convert pyruvate into acetyl-CoA. However, the results and the modeling showed that the two acetate activation pathways present are not only active, but needed due to the additional role of the acetyl-CoA transferase in the TCA cycle, probably reflecting the adaptation of these bacteria to acetate utilization. In other cases, the data reconciliation suggested additional capacity constraints that were confirmed with biochemical assays. The results demonstrate the need to experimentally verify the activity of key enzymes when developing in silico models of microbial physiology based on sequence-based reconstruction of metabolic networks.

Global Proteome Response to Deletion of Genes Related to Mercury Methylation and Dissimilatory Metal Reduction Reveals Changes in Respiratory Metabolism in Geobacter sulfurreducens PCA.

Science.gov (United States)

Qian, Chen; Johs, Alexander; Chen, Hongmei; Mann, Benjamin F; Lu, Xia; Abraham, Paul E; Hettich, Robert L; Gu, Baohua

2016-10-07

Geobacter sulfurreducens PCA can reduce, sorb, and methylate mercury (Hg); however, the underlying biochemical mechanisms of these processes and interdependent metabolic pathways remain unknown. In this study, shotgun proteomics was used to compare global proteome profiles between wild-type G. sulfurreducens PCA and two mutant strains: a ΔhgcAB mutant, which is deficient in two genes known to be essential for Hg methylation and a ΔomcBESTZ mutant, which is deficient in five outer membrane c-type cytochromes and thus impaired in its ability for dissimilatory metal ion reduction. We were able to delineate the global response of G. sulfurreducens PCA in both mutants and identify cellular networks and metabolic pathways that were affected by the loss of these genes. Deletion of hgcAB increased the relative abundances of proteins implicated in extracellular electron transfer, including most of the c-type cytochromes, PilA-C, and OmpB, and is consistent with a previously observed increase in Hg reduction in the ΔhgcAB mutant. Deletion of omcBESTZ was found to significantly increase relative abundances of various methyltransferases, suggesting that a loss of dissimilatory reduction capacity results in elevated activity among one-carbon (C1) metabolic pathways and thus increased methylation. We show that G. sulfurreducens PCA encodes only the folate branch of the acetyl-CoA pathway, and proteins associated with the folate branch were found at lower abundance in the ΔhgcAB mutant strain than the wild type. This observation supports the hypothesis that the function of HgcA and HgcB is linked to C1 metabolism through the folate branch of the acetyl-CoA pathway by providing methyl groups required for Hg methylation.

Changes in phosphorylation of adenosine phosphate and redox state of nicotinamide-adenine dinucleotide (phosphate) in Geobacter sulfurreducens in response to electron acceptor and anode potential variation

KAUST Repository

Rose, Nicholas D.; Regan, John M.

2015-01-01

© 2015 Elsevier B.V. Geobacter sulfurreducens is one of the dominant bacterial species found in biofilms growing on anodes in bioelectrochemical systems. The intracellular concentrations of reduced and oxidized forms of nicotinamide-adenine dinucleotide (NADH and NAD⁺, respectively) and nicotinamide-adenine dinucleotide phosphate (NADPH and NADP⁺, respectively) as well as adenosine triphosphate (ATP), adenosine diphosphate (ADP), and adenosine monophosphate (AMP) were measured in G. sulfurreducens using fumarate, Fe(III)-citrate, or anodes poised at different potentials (110, 10, -90, and -190mV (vs. SHE)) as the electron acceptor. The ratios of CNADH/CNAD+ (0.088±0.022) and CNADPH/CNADP+ (0.268±0.098) were similar under all anode potentials tested and with Fe(III)-citrate (reduced extracellularly). Both ratios significantly increased with fumarate as the electron acceptor (0.331±0.094 for NAD and 1.96±0.37 for NADP). The adenylate energy charge (the fraction of phosphorylation in intracellular adenosine phosphates) was maintained near 0.47 under almost all conditions. Anode-growing biofilms demonstrated a significantly higher molar ratio of ATP/ADP relative to suspended cultures grown on fumarate or Fe(III)-citrate. These results provide evidence that the cellular location of reduction and not the redox potential of the electron acceptor controls the intracellular redox potential in G. sulfurreducens and that biofilm growth alters adenylate phosphorylation.

Changes in phosphorylation of adenosine phosphate and redox state of nicotinamide-adenine dinucleotide (phosphate) in Geobacter sulfurreducens in response to electron acceptor and anode potential variation

KAUST Repository

Rose, Nicholas D.

2015-12-01

© 2015 Elsevier B.V. Geobacter sulfurreducens is one of the dominant bacterial species found in biofilms growing on anodes in bioelectrochemical systems. The intracellular concentrations of reduced and oxidized forms of nicotinamide-adenine dinucleotide (NADH and NAD⁺, respectively) and nicotinamide-adenine dinucleotide phosphate (NADPH and NADP⁺, respectively) as well as adenosine triphosphate (ATP), adenosine diphosphate (ADP), and adenosine monophosphate (AMP) were measured in G. sulfurreducens using fumarate, Fe(III)-citrate, or anodes poised at different potentials (110, 10, -90, and -190mV (vs. SHE)) as the electron acceptor. The ratios of CNADH/CNAD+ (0.088±0.022) and CNADPH/CNADP+ (0.268±0.098) were similar under all anode potentials tested and with Fe(III)-citrate (reduced extracellularly). Both ratios significantly increased with fumarate as the electron acceptor (0.331±0.094 for NAD and 1.96±0.37 for NADP). The adenylate energy charge (the fraction of phosphorylation in intracellular adenosine phosphates) was maintained near 0.47 under almost all conditions. Anode-growing biofilms demonstrated a significantly higher molar ratio of ATP/ADP relative to suspended cultures grown on fumarate or Fe(III)-citrate. These results provide evidence that the cellular location of reduction and not the redox potential of the electron acceptor controls the intracellular redox potential in G. sulfurreducens and that biofilm growth alters adenylate phosphorylation.

Rational engineering of Geobacter sulfurreducens electron transfer components: a foundation for building improved Geobacter-based bioelectrochemical technologies

Directory of Open Access Journals (Sweden)

Joana M Dantas

2015-07-01

Full Text Available Multiheme cytochromes have been implicated in Geobacter sulfurreducens (Gs extracellular electron transfer (EET. These proteins are potential targets to improve EET and enhance bioremediation and electrical current production by Gs. However, the functional characterization of multiheme cytochromes is particularly complex due to the co-existence of several microstates in solution, connecting the fully reduced and fully oxidized states. Over the last decade, new strategies have been developed to characterize multiheme redox proteins functionally and structurally. These strategies were used to reveal the functional mechanism of Gs multiheme cytochromes and also to identify key residues in these proteins for EET. In previous studies, we set the foundations for enhancement of the EET abilities of Gs by characterizing a family of five triheme cytochromes (PpcA-E. These periplasmic cytochromes are implicated in electron transfer between the oxidative reactions of metabolism in the cytoplasm and the reduction of extracellular terminal electron acceptors at the cell’s outer surface. The results obtained suggested that PpcA can couple e-/H+ transfer, a property that might contribute to the proton electrochemical gradient across the cytoplasmic membrane for metabolic energy production. The structural and functional properties of PpcA were characterized in detail and used for rational design of a family of 23 single site PpcA mutants. In this review, we summarize the functional characterization of the native and mutant proteins. Mutants that retain the mechanistic features of PpcA and adopt preferential e-/H+ transfer pathways at lower reduction potential values compared to the wild-type protein were selected for in vivo studies as the best candidates to increase the electron transfer rate of Gs. For the first time Gs strains have been manipulated by the introduction of mutant forms of essential proteins with the aim to develop and improve

High Resolution AFM and Single-Cell Resonance Raman Spectroscopy of Geobacter sulfurreducens Biofilms Early in Growth

Energy Technology Data Exchange (ETDEWEB)

Lebedev, Nikolai, E-mail: nikolai.lebedev@nrl.navy.mil; Strycharz-Glaven, Sarah M.; Tender, Leonard M., E-mail: nikolai.lebedev@nrl.navy.mil [Center for Biomolecular Science and Engineering, US Naval Research Laboratory, Washington, DC (United States)

2014-08-21

Atomic force microscopy and confocal resonance Raman microscopy (CRRM) of single-cells were used to study the transition of anode-grown Geobacter sulfurreducens biofilms from lag phase (initial period of low current) to exponential phase (subsequent period of rapidly increasing current). Results reveal that lag phase biofilms consist of lone cells and tightly packed single-cell thick clusters crisscrossed with extracellular linear structures that appears to be comprised of nodules approximately 20 nm in diameter aligned end to end. By early exponential phase, cell clusters expand laterally and a second layer of closely packed cells begins to form on top of the first. Abundance of c-type cytochromes (c-Cyt) is threefold greater in two-cell thick regions than in one-cell thick regions. The results indicate that early biofilm growth involves two transformations. The first is from lone cells to two-dimensionally associated cells during lag phase when current remains low. This is accompanied by formation of extracellular linear structures. The second is from two- to three-dimensionally associated cells during early exponential phase when current begins to increase rapidly. This is accompanied by a dramatic increase in c-Cyt abundance.

High Resolution AFM and Single-Cell Resonance Raman Spectroscopy of Geobacter sulfurreducens Biofilms Early in Growth

International Nuclear Information System (INIS)

Lebedev, Nikolai; Strycharz-Glaven, Sarah M.; Tender, Leonard M.

2014-01-01

Atomic force microscopy and confocal resonance Raman microscopy (CRRM) of single-cells were used to study the transition of anode-grown Geobacter sulfurreducens biofilms from lag phase (initial period of low current) to exponential phase (subsequent period of rapidly increasing current). Results reveal that lag phase biofilms consist of lone cells and tightly packed single-cell thick clusters crisscrossed with extracellular linear structures that appears to be comprised of nodules approximately 20 nm in diameter aligned end to end. By early exponential phase, cell clusters expand laterally and a second layer of closely packed cells begins to form on top of the first. Abundance of c-type cytochromes (c-Cyt) is threefold greater in two-cell thick regions than in one-cell thick regions. The results indicate that early biofilm growth involves two transformations. The first is from lone cells to two-dimensionally associated cells during lag phase when current remains low. This is accompanied by formation of extracellular linear structures. The second is from two- to three-dimensionally associated cells during early exponential phase when current begins to increase rapidly. This is accompanied by a dramatic increase in c-Cyt abundance.

Direct Involvement of ombB, omaB and omcB Genes in Extracellular Reduction of Fe(III by Geobacter sulfurreducens PCA

Directory of Open Access Journals (Sweden)

Yimo eLiu

2015-10-01

Full Text Available The tandem gene clusters orfR-ombB-omaB-omcB and orfS-ombC-omaC-omcC of the metal-reducing bacterium Geobacter sulfurreducens PCA are responsible for trans-outer membrane electron transfer during extracellular reduction of Fe(III-citrate and ferrihydrite [a poorly crystalline Fe(III oxide]. Each gene cluster encodes a putative transcriptional factor (OrfR/OrfS, a porin-like outer-membrane protein (OmbB/OmbC, a periplasmic c-type cytochrome (c-Cyt, OmaB/OmaC and an outer-membrane c-Cyt (OmcB/OmcC. The individual roles of OmbB, OmaB and OmcB in extracellular reduction of Fe(III, however, have remained either uninvestigated or controversial. Here, we showed that replacements of ombB, omaB, omcB and ombB-omaB with an antibiotic gene in the presence of ombC-omaC-omcC had no impact on reduction of Fe(III-citrate by G. sulfurreducens PCA. Disruption of ombB, omaB, omcB and ombB-omaB in the absence of ombC-omaC-omcC, however, severely impaired the bacterial ability to reduce Fe(III-citrate as well as ferrihydrite. These results unequivocally demonstrate an overlapping role of ombB-omaB-omcB and ombC-omaC-omcC in extracellular Fe(III reduction by G. sulfurreducens PCA. Involvement of both ombB-omaB-omcB and ombC-omaC-omcC in extracellular Fe(III reduction reflects the importance of these trans-outer membrane protein complexes in the physiology of this bacterium. Moreover, the kinetics of Fe(III-citrate and ferrihydrite reduction by these mutants in the absence of ombC-omaC-omcC were nearly identical, which suggests that absence of any protein subunit eliminates function of OmaB/OmbB/OmcB protein complex. Finally, orfS was found to have a negative impact on the extracellular reduction of Fe(III-citrate and ferrihydrite in G. sulfurreducens PCA probably by serving as a transcriptional repressor.

Comparative genomics of Geobacter chemotaxis genes reveals diverse signaling function

Directory of Open Access Journals (Sweden)

Antommattei Frances M

2008-10-01

Full Text Available Abstract Background Geobacter species are δ-Proteobacteria and are often the predominant species in a variety of sedimentary environments where Fe(III reduction is important. Their ability to remediate contaminated environments and produce electricity makes them attractive for further study. Cell motility, biofilm formation, and type IV pili all appear important for the growth of Geobacter in changing environments and for electricity production. Recent studies in other bacteria have demonstrated that signaling pathways homologous to the paradigm established for Escherichia coli chemotaxis can regulate type IV pili-dependent motility, the synthesis of flagella and type IV pili, the production of extracellular matrix material, and biofilm formation. The classification of these pathways by comparative genomics improves the ability to understand how Geobacter thrives in natural environments and better their use in microbial fuel cells. Results The genomes of G. sulfurreducens, G. metallireducens, and G. uraniireducens contain multiple (~70 homologs of chemotaxis genes arranged in several major clusters (six, seven, and seven, respectively. Unlike the single gene cluster of E. coli, the Geobacter clusters are not all located near the flagellar genes. The probable functions of some Geobacter clusters are assignable by homology to known pathways; others appear to be unique to the Geobacter sp. and contain genes of unknown function. We identified large numbers of methyl-accepting chemotaxis protein (MCP homologs that have diverse sensing domain architectures and generate a potential for sensing a great variety of environmental signals. We discuss mechanisms for class-specific segregation of the MCPs in the cell membrane, which serve to maintain pathway specificity and diminish crosstalk. Finally, the regulation of gene expression in Geobacter differs from E. coli. The sequences of predicted promoter elements suggest that the alternative sigma factors �

Link Between Capacity for Current Production and Syntrophic Growth in Geobacter species

Directory of Open Access Journals (Sweden)

Amelia-Elena eRotaru

2015-07-01

Full Text Available Electrodes are unnatural electron acceptors, and it is yet unknown how some Geobacter species evolved to use electrodes as terminal electron acceptors. Analysis of different Geobacter species revealed that they varied in their capacity for current production. G. metallireducens and G. hydrogenophilus generated high current densities (ca. 0.05 mA/cm2, comparable to G. sulfurreducens. G. bremensis, G. chapellei, G. humireducens, and G. uranireducens, produced much lower currents (ca. 0.05 mA/cm2 and G. bemidjiensis was previously found to not produce current. There was no correspondence between the effectiveness of current generation and Fe(III oxide reduction rates. Some high-current-density strains (G. metallireducens and G. hydrogenophilus reduced Fe(III-oxides as fast as some low-current-density strains (G. bremensis, G. humireducens, and G. uranireducens whereas other low-current-density strains (G. bemidjiensis and G. chapellei reduced Fe(III oxide as slowly as G. sulfurreducens, a high-current-density strain. However, there was a correspondence between the ability to produce higher currents and the ability to grow syntrophically. G. hydrogenophilius was found to grow in co-culture with Methanosarcina barkeri, which is capable of direct interspecies electron transfer (DIET, but not with Methanospirillium hungatei capable only of H2 or formate transfer. Conductive granular activated carbon (GAC stimulated metabolism of the G. hydrogenophilus - M. barkeri co-culture, consistent with electron exchange via DIET. These findings, coupled with the previous finding that G. metallireducens and G. sulfurreducens are also capable of DIET, suggest that evolution to optimize DIET has fortuitiously conferred the capability for high-density current production to some Geobacter species.

Control of nanoparticle size, reactivity and magnetic properties during the bioproduction of magnetite by Geobacter sulfurreducens

Energy Technology Data Exchange (ETDEWEB)

Byrne, J. M.; Telling, N. D.; Coker, V. S.; Pattrick, R. A. D.; Laan, G. van der; Arenholz, E.; Tuna, F.; Lloyd, J. R.

2011-08-02

The bioproduction of nano-scale magnetite by Fe(III)-reducing bacteria offers a potentially tunable, environmentally benign route to magnetic nanoparticle synthesis. Here, we demonstrate that it is possible to control the size of magnetite nanoparticles produced by Geobacter sulfurreducens, by adjusting the total biomass introduced at the start of the process. The particles have a narrow size distribution and can be controlled within the range of 10-50 nm. X-ray diffraction analysis indicates that controlled production of a number of different biominerals is possible via this method including goethite, magnetite and siderite, but their formation is strongly dependent upon the rate of Fe(III) reduction and total concentration and rate of Fe(II) produced by the bacteria during the reduction process. Relative cation distributions within the structure of the nanoparticles has been investigated by X-ray magnetic circular dichroism and indicates the presence of a highly reduced surface layer which is not observed when magnetite is produced through abiotic methods. The enhanced Fe(II)-rich surface, combined with small particle size, has important environmental applications such as in the reductive bioremediation of organics, radionuclides and metals. In the case of Cr(VI), as a model high-valence toxic metal, optimised biogenic magnetite is able to reduce and sequester the toxic hexavalent chromium very efficiently in the less harmful trivalent form.

Set potential regulation reveals additional oxidation peaks of Geobacter sulfurreducens anodic biofilms

KAUST Repository

Zhu, Xiuping; Yates, Matthew D.; Logan, Bruce E.

2012-01-01

larger range of set potentials was used to acclimate electroactive biofilms. The potentials of oxidation peaks obtained with G. sulfurreducens biofilms acclimated at 0.60 V (vs. Ag/AgCl) were different from those that developed at - 0.46 V, and both

A Highly Efficient Mixed-culture Biofilm as Anodic Catalyst and Insights into Its Enhancement through Electrochemistry by Comparison with G. sulfurreducens

International Nuclear Information System (INIS)

Liu, Ying; Deng, Dandan; Lan, Xiaoji

2015-01-01

Highlights: • A mixed-culture biofilm with 68.6% higher current than Geobacter sulfurreducens was firstly reported, while G. sulfurreducens biofilm showed five-time higher apparent affinity than the mixed-culture. • The mixed-culture biofilm showed surface-controlled process, while diffusion-controlled process was obtained for G. sulfurreducens as at certain accelerating scan rates. • When the used medium was replaced with the fresh, decrease percentage of currents for both kinds of biofilms is similar (50%). • A suitable community will be an alternative for improving MFC performance. - Abstract: In this paper an efficient mixed-culture microbial biofilm with increased current density by 68.6% (1020.9 ± 47 μA cm −2 ) than that on typical culture of Geobacter sulfurreducens biofilm was firstly reported. The insights into the enhanced electricity-producing ability was investigated through evaluating the dependence of limiting current density on electroactive biomass coverage, replacing used growth medium, applying stirring and electron transfer kinetics. It was shown that the enhanced electricity generation ability of the mixed-culture biofilm is from population superiority of active molecules or electron shuttles from the biofilm. This work suggested that the optimized synergistic effect between interspecies in community could significantly improve electricity-producing performance than single strain. This study highlighted the potential synergistic role in special community on electricity generation capability

Anode microbial communities produced by changing from microbial fuel cell to microbial electrolysis cell operation using two different wastewaters

KAUST Repository

Kiely, Patrick D.; Cusick, Roland; Call, Douglas F.; Selembo, Priscilla A.; Regan, John M.; Logan, Bruce E.

2011-01-01

Conditions in microbial fuel cells (MFCs) differ from those in microbial electrolysis cells (MECs) due to the intrusion of oxygen through the cathode and the release of H2 gas into solution. Based on 16S rRNA gene clone libraries, anode communities in reactors fed acetic acid decreased in species richness and diversity, and increased in numbers of Geobacter sulfurreducens, when reactors were shifted from MFCs to MECs. With a complex source of organic matter (potato wastewater), the proportion of Geobacteraceae remained constant when MFCs were converted into MECs, but the percentage of clones belonging to G. sulfurreducens decreased and the percentage of G. metallireducens clones increased. A dairy manure wastewater-fed MFC produced little power, and had more diverse microbial communities, but did not generate current in an MEC. These results show changes in Geobacter species in response to the MEC environment and that higher species diversity is not correlated with current. © 2010 Elsevier Ltd.

Electrochemical activities of Geobacter biofilms growing on electrodes with various potentials

International Nuclear Information System (INIS)

Li, Dao-Bo; Huang, Yu-Xi; Li, Jie; Li, Ling-Li; Tian, Li-Jiao; Yu, Han-Qing

2017-01-01

Highlights: • Dependence of current generation on potentials by G. sulfurreducens is complex with the optimum at +0.1 V. • Unfavorable spatial distribution of biological activity within the biofilm at high potentials limits the current generation. • Same cytochrome c species are used for electron transfer in the biofilms developed at all potentials. - Abstract: Exoelectrogenic bacteria (EEB) play a central role in bioenergy recovery, biogeochemistry of elements, and polluting remediation. The electrochemical activity of EEB biofilm on electrode was proven to be dependent on the electrode potential, but the mechanism behind such a phenomenon is unclear. In this work, Geobacter sulfurreducens biofilms were developed at potentials ranging from −0.1 V to +0.6 V vs. standard hydrogen electrode to explore the profiles of potential regulation on G. sulfurreducens biofilm development and the electrochemical activity. We found that elevating the developing potential could improve the current generation by G. sulfurreducens biofilm until +0.1 V. At higher potentials less current was generated, although more biomass was formed on the electrode. The same cytochrome c species were synthesized for electron transfer in all biofilms, independent of the developing potential. Electrochemical experimental results and redox-sensitive staining imagings proved that the biofilms developed at +0.2 V–+0.4 V had greater cytochrome c contents and reducing capacities than the others. Current generation at high potentials was likely to be limited by both the metabolic rate and the electron transfer kinetics. These findings are useful for tuning the electrochemical activity of biofilm in catalyzing redox processes or generating electricity, which is crucial for the environmental and electrochemical application of EEB.

Maintenance of Geobacter-dominated biofilms in microbial fuel cells treating synthetic wastewater.

Science.gov (United States)

Commault, Audrey S; Lear, Gavin; Weld, Richard J

2015-12-01

Geobacter-dominated biofilms can be selected under stringent conditions that limit the growth of competing bacteria. However, in many practical applications, such stringent conditions cannot be maintained and the efficacy and stability of these artificial biofilms may be challenged. In this work, biofilms were selected on low-potential anodes (-0.36 V vs Ag/AgCl, i.e. -0.08 V vs SHE) in minimal acetate or ethanol media. Selection conditions were then relaxed by transferring the biofilms to synthetic wastewater supplemented with soil as a source of competing bacteria. We tracked community succession and functional changes in these biofilms. The Geobacter-dominated biofilms showed stability in their community composition and electrochemical properties, with Geobacter sp. being still electrically active after six weeks in synthetic wastewater with power densities of 100±19 mW·m(-2) (against 74±14 mW·m(-2) at week 0) for all treatments. After six weeks, the ethanol-selected biofilms, despite their high taxon richness and their efficiency at removing the chemical oxygen demand (0.8 g·L(-1) removed against the initial 1.3 g·L(-1) injected), were the least stable in terms of community structure. These findings have important implications for environmental microbial fuel cells based on Geobacter-dominated biofilms and suggest that they could be stable in challenging environments. Copyright © 2015 Elsevier B.V. All rights reserved.

Electrochemical evaluation of Ti/TiO{sub 2}-polyaniline anodes for microbial fuel cells using hypersaline microbial consortia for synthetic-wastewater treatment

Energy Technology Data Exchange (ETDEWEB)

Benetton, X.D.; Navarro-Avila, S.G. [Univ. Autonoma de Yucatan, Yucatan (Mexico). Biotecnologia y Bioingenieria; Carrera-Figueiras, C. [Univ. Autonoma de Yucatan, Yucatan (Mexico). Quimica Fundamental y Aplicada

2010-07-01

This paper described the development of a titanium (Ti/TiO{sub 2}) polyaniline composite electrode. The electrode was designed for use with a microbial fuel cell (MFC) that generated electricity through the microbial biodegradation of organic compounds. A modified NBAF medium was used with a 20 mM acetate as an electron donor and 53 mM fumarate as an electron acceptor for a period of 96 hours at 37 degrees C. Strains were cultured under strict anaerobic conditions. Two microbial cultures were used: (1) pure cultures of Geobacter sulfur-reducens; and (2) an uncharacterized stable microbial consortia isolated from hypersaline swamp sediments. The anodes were made with an emeraldine form of PANI deposited over Ti/TiO{sub 2} electrodes. Electrochemical impedance spectroscopy (EIS) monitoring was used to determine the open circuit potential of the MFC. Negative real impedances were obtained and reproduced in all systems studied with the Ti/TiO{sub 2}-PANI anodes. The highest power density was obtained using the Geobacter sulfur-reducens culture. Further research is needed to study the mechanisms that contribute to the occurrence of negative real impedances. 23 refs., 1 tab., 5 figs.

Mechanisms for Electron Transfer Through Pili to Fe(III) Oxide in Geobacter

Energy Technology Data Exchange (ETDEWEB)

Lovley, Derek R. [Univ. of Massachusetts, Amherst, MA (United States)

2015-03-09

The purpose of these studies was to aid the Department of Energy in its goal of understanding how microorganisms involved in the bioremediation of metals and radionuclides sustain their activity in the subsurface. This information is required in order to incorporate biological processes into decision making for environmental remediation and long-term stewardship of contaminated sites. The proposed research was designed to elucidate the mechanisms for electron transfer to Fe(III) oxides in Geobacter species because Geobacter species are abundant dissimilatory metal-reducing microorganisms in a diversity of sites in which uranium is undergoing natural attenuation via the reduction of soluble U(VI) to insoluble U(IV) or when this process is artificially stimulated with the addition of organic electron donors. This study investigated the novel, but highly controversial, concept that the final conduit for electron transfer to Fe(III) oxides are electrically conductive pili. The specific objectives were to: 1) further evaluate the conductivity along the pili of Geobacter sulfurreducens and related organisms; 2) determine the mechanisms for pili conductivity; and 3) investigate the role of pili in Fe(III) oxide reduction. The studies demonstrated that the pili of G. sulfurreducens are conductive along their length. Surprisingly, the pili possess a metallic-like conductivity similar to that observed in synthetic organic conducting polymers such as polyaniline. Detailed physical analysis of the pili, as well as studies in which the structure of the pili was genetically modified, demonstrated that the metallic-like conductivity of the pili could be attributed to overlapping pi-pi orbitals of aromatic amino acids. Other potential mechanisms for conductivity, such as electron hopping between cytochromes associated with the pili were definitively ruled out. Pili were also found to be essential for Fe(III) oxide reduction in G. metallireducens. Ecological studies demonstrated

Geobacter

DEFF Research Database (Denmark)

Lovley, Derek R; Ueki, Toshiyuki; Zhang, Tian

2011-01-01

of organic compounds to the reduction of insoluble Fe(III) and Mn(IV) oxides in many soils and sediments, a process of global biogeochemical significance. Some Geobacter species can anaerobically oxidize aromatic hydrocarbons and play an important role in aromatic hydrocarbon removal from contaminated...... groundwater bioremediation. The growth and activity of Geobacter species in the subsurface and their biogeochemical impact under different environmental conditions can be predicted with a systems biology approach in which genome-scale metabolic models are coupled with appropriate physical/chemical models...... are temporarily unavailable. The high conductivity of Geobacter pili and biofilms and the ability of biofilms to function as supercapacitors are novel properties that might contribute to the field of bioelectronics. The study of Geobacter species has revealed a remarkable number of microbial physiological...

Strategies for merging microbial fuel cell technologies in water desalination processes: Start-up protocol and desalination efficiency assessment

Science.gov (United States)

Borjas, Zulema; Esteve-Núñez, Abraham; Ortiz, Juan Manuel

2017-07-01

Microbial Desalination Cells constitute an innovative technology where microbial fuel cell and electrodialysis merge in the same device for obtaining fresh water from saline water with no energy-associated cost for the user. In this work, an anodic biofilm of the electroactive bacteria Geobacter sulfurreducens was able to efficiently convert the acetate present in synthetic waste water into electric current (j = 0.32 mA cm-2) able to desalinate water. .Moreover, we implemented an efficient start-up protocol where desalination up to 90% occurred in a desalination cycle (water production:0.308 L m-2 h-1, initial salinity: 9 mS cm-1, final salinity: osmosis (RO) or reverse electrodialysis.

ORF Alignment: NC_002939 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002939 gi|39996821 >1v7zA 3 252 1 232 3e-42 ... ref|NP_952772.1| creatinine amidoh...ydrolase [Geobacter sulfurreducens PCA] ... gb|AAR35099.1| creatinine amidohydrolase [Geobacter ...

The Complex Conductivity Signature of Geobacter Species in Geological Media

Science.gov (United States)

Brown, I.; Atekwana, E. A.; Sarkisova, S.; Achang, M.

2013-12-01

The Complex Conductivity (CC) technique is a promising biogeophysical approach for sensing microbially-induced changes in geological media because of its low-invasive character and sufficient sensitivity to enhanced microbial activity in the near subsurface. Geobacter species have been shown to play important roles in the bioremediation of groundwater contaminated with petroleum and landfill leachate. This capability is based on the ability of Geobacter species to reduce Fe(III) by transferring of electrons from the reduced equivalents to Fe(III) rich minerals through respiration chain and special metallic-like conductors - pili. Only the cultivation of Geobacter species on Fe(III) oxides specifically express pili biosynthesis. Moreover, mutants that cannot produce pili are unable to reduce Fe(III) oxides. However, little is known about the contribution of these molecular conductors (nanowires) to the generation of complex conductivity signatures in geological media. Here, we present the results about the modulation of CC signatures in geological media by Geobacter sulfurreducens (G.s.). Cultures of wild strain G.s. and its pilA(-) mutant were anaerobically cultivated in the presence of the pair of such donors and acceptors of electrons: acetate - fumarate, and acetate - magnetite under anaerobic conditions. Each culture was injected in CC sample holders filled either with N2-CO2 mix (planktonic variant) or with this gases mix and glass beads, d=1 mm, (porous medium variant). Both strains of G.s. proliferated well in a medium supplemented with acetate-fumarate. However, pilA(-) mutant did not multiply in a medium supplemented with ox-red pair yeast extract - magnetite. This observation confirmed that only wild pilA(+) strain is capable of the dissimilatory reduction of Fe(III) within magnetite molecule. The measurement of CC responses from planktonic culture of G.s. wild strain grown with acetate-fumarate did not show linear correlation with their magnitudes but

Identification of Genes Involved in Biofilm Formation and Respiration via Mini-Himar Transposon Mutagenesis of Geobacter sulfurreducens▿ †

Science.gov (United States)

Rollefson, Janet B.; Levar, Caleb E.; Bond, Daniel R.

2009-01-01

Electron transfer from cells to metals and electrodes by the Fe(III)-reducing anaerobe Geobacter sulfurreducens requires proper expression of redox proteins and attachment mechanisms to interface bacteria with surfaces and neighboring cells. We hypothesized that transposon mutagenesis would complement targeted knockout studies in Geobacter spp. and identify novel genes involved in this process. Escherichia coli mating strains and plasmids were used to develop a conjugation protocol and deliver mini-Himar transposons, creating a library of over 8,000 mutants that was anaerobically arrayed and screened for a range of phenotypes, including auxotrophy for amino acids, inability to reduce Fe(III) citrate, and attachment to surfaces. Following protocol validation, mutants with strong phenotypes were further characterized in a three-electrode system to simultaneously quantify attachment, biofilm development, and respiratory parameters, revealing mutants defective in Fe(III) reduction but unaffected in electron transfer to electrodes (such as an insertion in GSU1330, a putative metal export protein) or defective in electrode reduction but demonstrating wild-type biofilm formation (due to an insertion upstream of the NHL domain protein GSU2505). An insertion in a putative ATP-dependent transporter (GSU1501) eliminated electrode colonization but not Fe(III) citrate reduction. A more complex phenotype was demonstrated by a mutant containing an insertion in a transglutaminase domain protein (GSU3361), which suddenly ceased to respire when biofilms reached approximately 50% of the wild-type levels. As most insertions were not in cytochromes but rather in transporters, two-component signaling proteins, and proteins of unknown function, this collection illustrates how biofilm formation and electron transfer are separate but complementary phenotypes, controlled by multiple loci not commonly studied in Geobacter spp. PMID:19395486

Magnetite Compensates for the Lack of a Pilin-Associated c-Type Cytochrome in Extracellular Electron Exchange

DEFF Research Database (Denmark)

Liu, Fanghua; Rotaru, Amelia-Elena; Shrestha, Pravin

2015-01-01

investigation revealed that magnetite attached to the electrically conductive pili of Geobacter species in a manner reminiscent of the association of the multi-heme c-type cytochrome OmcS with the pili of Geobacter sulfurreducens. Magnetite conferred extracellular electron capabilities on an Omc...

Carboxydotrophic growth of

NARCIS (Netherlands)

Geelhoed, J.; Henstra, A.M.; Stams, A.J.M.

2016-01-01

This study shows that Geobacter sulfurreducensgrows on carbon monoxide (CO) as electron donor with fumarateas electron acceptor. Geobacter sulfurreducens wastolerant to high CO levels, with up to 150 kPa in the headspacetested. During growth, hydrogen was detected in very slightamounts (~5 Pa). In

Carbon nanotube fiber mats for microbial fuel cell electrodes.

Science.gov (United States)

Delord, Brigitte; Neri, Wilfrid; Bertaux, Karen; Derre, Alain; Ly, Isabelle; Mano, Nicolas; Poulin, Philippe

2017-11-01

Novel carbon nanotube based electrodes of microbial fuel cells (MFC) have been developed. MFC is a promising technology for the wastewater treatment and the production of electrical energy from redox reactions of natural substrates. Performances of such bio-electrochemical systems depend critically on the structure and properties of the electrodes. The presently developed materials are made by weaving fibers solely comprised of carbon nanotubes. They exhibit a large scale porosity controlled by the weaving process. This porosity allows an easy colonization by electroactive bacteria. In addition, the fibers display a nanostructuration that promotes excellent growth and adhesion of the bacteria at the surface of the electrodes. This unique combination of large scale porosity and nanostructuration allows the present electrodes to perform better than carbon reference. When used as anode in a bioelectrochemical reactor in presence of Geobacter sulfurreducens bacteria, the present electrodes show a maximal current density of about 7.5mA/cm 2 . Copyright © 2017 Elsevier Ltd. All rights reserved.

G eobacter sp. SD-1 with enhanced electrochemical activity in high-salt concentration solutions

KAUST Repository

Sun, Dan; Call, Douglas; Wang, Aijie; Cheng, Shaoan; Logan, Bruce E.

2014-01-01

© 2014 Society for Applied Microbiology and John Wiley & Sons Ltd. Summary: An isolate, designated strain SD-1, was obtained from a biofilm dominated by Geobacter sulfurreducens in a microbial fuel cell. The electrochemical activity of strain SD-1 was compared with type strains, G.sulfurreducensPCA and Geobacter metallireducensGS-15, and a mixed culture in microbial electrolysis cells. SD-1 produced a maximum current density of 290±29Am-3 in a high-concentration phosphate buffer solution (PBS-H, 200mM). This current density was significantly higher than that produced by the mixed culture (189±44Am-3) or the type strains (<70Am-3). In a highly saline water (SW; 50mM PBS and 650mM NaCl), current by SD-1 (158±4Am-3) was reduced by 28% compared with 50mM PBS (220±4Am-3), but it was still higher than that of the mixed culture (147±19Am-3), and strains PCA and GS-15 did not produce any current. Electrochemical tests showed that the improved performance of SD-1 was due to its lower charge transfer resistance and more negative potentials produced at higher current densities. These results show that the electrochemical activity of SD-1 was significantly different than other Geobacter strains and mixed cultures in terms of its salt tolerance.

G eobacter sp. SD-1 with enhanced electrochemical activity in high-salt concentration solutions

KAUST Repository

Sun, Dan

2014-07-16

© 2014 Society for Applied Microbiology and John Wiley & Sons Ltd. Summary: An isolate, designated strain SD-1, was obtained from a biofilm dominated by Geobacter sulfurreducens in a microbial fuel cell. The electrochemical activity of strain SD-1 was compared with type strains, G.sulfurreducensPCA and Geobacter metallireducensGS-15, and a mixed culture in microbial electrolysis cells. SD-1 produced a maximum current density of 290±29Am-3 in a high-concentration phosphate buffer solution (PBS-H, 200mM). This current density was significantly higher than that produced by the mixed culture (189±44Am-3) or the type strains (<70Am-3). In a highly saline water (SW; 50mM PBS and 650mM NaCl), current by SD-1 (158±4Am-3) was reduced by 28% compared with 50mM PBS (220±4Am-3), but it was still higher than that of the mixed culture (147±19Am-3), and strains PCA and GS-15 did not produce any current. Electrochemical tests showed that the improved performance of SD-1 was due to its lower charge transfer resistance and more negative potentials produced at higher current densities. These results show that the electrochemical activity of SD-1 was significantly different than other Geobacter strains and mixed cultures in terms of its salt tolerance.

ORF Alignment: NC_002939 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available Geobacter sulfurreducens PCA] ... Length = 81 ... Query: 1 ... MFVXXXXXXXXXXXXXXKGKRGIVKSILARARQDFNVSAAEVDL...QDVPDEAVLAFATVTG 60 ... MFV ... KGKRGIVKSILARARQDFNVSAAEVDLQDVPDEA...VLAFATVTG Sbjct: 1 ... MFVHSLCLHLHLPSHSLKGKRGIVKSILARARQDFNVSAAEVDLQDVPDEAVLAFATVTG 60 ...

ORF Alignment: NC_002939 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available GESSFNPLAINYNSNGTYDYGLMQINSSWEPALRK 79 ... ASAFCFEEAGNRYGISPQLLYAISKGESSFNPLAINYNSNGTYDYGLMQINSS...WEPALRK Sbjct: 1 ... ASAFCFEEAGNRYGISPQLLYAISKGESSFNPLAINYNSNGTYDYGLMQINSSWEPALRK 60 ... ...tein ... [Geobacter sulfurreducens PCA] ... Length = 101 ... Query: 20 ... ASAFCFEEAGNRYGISPQLLYAISK

ORF Alignment: NC_002939 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available FliM ... [Geobacter sulfurreducens PCA] ... Length = 79 ... Query: 248 RLSKELLEAPLDVSVEVGGAVISLNDLLSLVPGDTIMLDTPCTSDLT...VKVGGVPKFTGMP 307 ... RLSKELLEAPLDVSVEVGGAVISLNDLLSLVPGDTIMLDTPCTSDLT...VKVGGVPKFTGMP Sbjct: 1 ... RLSKELLEAPLDVSVEVGGAVISLNDLLSLVPGDTIMLDTPCTSDLTVKVGGVPKFTGMP 60 ...

ORF Alignment: NC_002939 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available tein-alanine acetyltransferase [Geobacter ... sulfurreducens PCA] ... Length = 146 ... Query: 1 ... MNTADCP...TIMPMTEGDLDEVLQIESDSFPRPWTRDHFVAELASPRSFPVVARSPGGLIVG 60 ... MNTADCP...TIMPMTEGDLDEVLQIESDSFPRPWTRDHFVAELASPRSFPVVARSPGGLIVG Sbjct: 1 ... MNTADCPTIMPMTEGDLDEVLQIESDSFPRPWTRDHFVAEL

Strategies for Reducing the Start-up Operation of Microbial Electrochemical Treatments of Urban Wastewater

Directory of Open Access Journals (Sweden)

Zulema Borjas

2015-12-01

Full Text Available Microbial electrochemical technologies (METs constitute the core of a number of emerging technologies with a high potential for treating urban wastewater due to a fascinating reaction mechanism—the electron transfer between bacteria and electrodes to transform metabolism into electrical current. In the current work, we focus on the model electroactive microorganism Geobacter sulfurreducens to explore both the design of new start-up procedures and electrochemical operations. Our chemostat-grown plug and play cells, were able to reduce the start-up period by 20-fold while enhancing chemical oxygen demand (COD removal by more than 6-fold during this period. Moreover, a filter-press based bioreactor was successfully tested for both acetate-supplemented synthetic wastewater and real urban wastewater. This proof-of-concept pre-pilot treatment included a microbial electrolysis cell (MEC followed in time by a microbial fuel cell (MFC to finally generate electrical current of ca. 20 A·m−2 with a power of 10 W·m−2 while removing 42 g COD day−1·m−2. The effective removal of acetate suggests a potential use of this modular technology for treating acetogenic wastewater where Geobacter sulfurreducens outcompetes other organisms.

Microbial electro-catalysis in fuel cell

International Nuclear Information System (INIS)

Dumas, Claire

2007-01-01

Microbial fuel cells (MFC) are devices that ensure the direct conversion of organic matter into electricity using bacterial bio-films as the catalysts of the electrochemical reactions. This study aims at improving the comprehension of the mechanisms involved in electron transfer pathways between the adhered bacteria and the electrodes. This optimization of the MFC power output could be done, for example, in exploring and characterizing various electrode materials. The electrolysis experiments carried out on Geobacter sulfurreducens deal with the microbial catalysis of the acetate oxidation, on the one hand, and the catalysis of the fumarate reduction on the other hand. On the anodic side, differences in current densities appeared on graphite, DSA R and stainless steel (8 A/m 2 , 5 A/m 2 and 0.7 A/m 2 respectively). These variations were explained more by materials roughness differences rather than their nature. Impedance spectroscopy study shows that the electro-active bio-film developed on stainless steel does not seem to modify the evolution of the stainless steel oxide layer, only the imposed potential remains determining. On the cathodic side, stainless steel sustained current densities more than twenty times higher than those obtained with graphite electrodes. The adhesion study of G. sulfurreducens on various materials in a flow cell, suggests that the bio-films resist to the hydrodynamic constraints and are not detached under a shear stress threshold value. The installation of two MFC prototypes, one in a sea station and the other directly in Genoa harbour (Italy) confirms some results obtained in laboratory and were promising for a MFC scale-up. (author) [fr

Time-course correlation of biofilm properties and electrochemical performance in single-chamber microbial fuel cells

KAUST Repository

Ren, Zhiyong; Ramasamy, Ramaraja P.; Cloud-Owen, Susan Red; Yan, Hengjing; Mench, Matthew M.; Regan, John M.

2011-01-01

The relationship between anode microbial characteristics and electrochemical parameters in microbial fuel cells (MFCs) was analyzed by time-course sampling of parallel single-bottle MFCs operated under identical conditions. While voltage stabilized within 4. days, anode biofilms continued growing during the six-week operation. Viable cell density increased asymptotically, but membrane-compromised cells accumulated steadily from only 9% of total cells on day 3 to 52% at 6. weeks. Electrochemical performance followed the viable cell trend, with a positive correlation for power density and an inverse correlation for anode charge transfer resistance. The biofilm architecture shifted from rod-shaped, dispersed cells to more filamentous structures, with the continuous detection of Geobacter sulfurreducens-like 16S rRNA fragments throughout operation and the emergence of a community member related to a known phenazine-producing Pseudomonas species. A drop in cathode open circuit potential between weeks two and three suggested that uncontrolled biofilm growth on the cathode deleteriously affects system performance. © 2010 Elsevier Ltd.

Syntrophic Growth via Quinone-Mediated Interspecies Electron Transfer

Directory of Open Access Journals (Sweden)

Jessica A Smith

2015-02-01

Full Text Available The mechanisms by which microbial species exchange electrons are of interest because interspecies electron transfer can expand the metabolic capabilities of microbial communities. Previous studies with the humic substance analog anthraquinone-2,6-disulfonate (AQDS suggested that quinone-mediated interspecies electron transfer (QUIET is feasible, but it was not determined if sufficient energy is available from QUIET to support the growth of both species. Furthermore, there have been no previous studies on the mechanisms for the oxidation of anthrahydroquinone-2,6-disulfonate (AHQDS. A co-culture of Geobacter metallireducens and Geobacter sulfurreducens metabolized ethanol with the reduction of fumarate much faster in the presence of AQDS, and there was an increase in cell protein. G. sulfurreducens was more abundant, consistent with G. sulfurreducens obtaining electrons from acetate that G. metallireducens produced from ethanol, as well as from AHQDS. Cocultures initiated with a citrate synthase-deficient strain of G. sulfurreducens that was unable to use acetate as an electron donor also metabolized ethanol with the reduction of fumarate and cell growth, but acetate accumulated over time. G. sulfurreducens and G. metallireducens were equally abundant in these co-cultures reflecting the inability of the citrate synthase-deficient strain of G. sulfurreducens to metabolize acetate. Evaluation of the mechanisms by which G. sulfurreducens accepts electrons from AHQDS demonstrated that a strain deficient in outer-surface c-type cytochromes that are required for AQDS reduction was as effective at QUIET as the wild-type strain. Deletion of additional genes previously implicated in extracellular electron transfer also had no impact on QUIET. These results demonstrate that QUIET can yield sufficient energy to support the growth of both syntrophic partners, but that the mechanisms by which electrons are derived from extracellular hydroquinones require

Proteogenomic monitoring of Geobacter physiology during stimulated uranium bioremediation

Energy Technology Data Exchange (ETDEWEB)

Wilkins, M.J.; VerBerkmoes, N.C.; Williams, K.H.; Callister, S.J.; Mouser, P.J.; Elifantz, H.; N' Guessan, A.L.; Thomas, B.C.; Nicora, C.D.; Shah, M.B.; Lipton, M.S.; Lovley, D.R.; Hettich, R.L.; Long, P.E.; Banfield, J.F.; Abraham, P.

2009-08-01

Implementation of uranium bioremediation requires methods for monitoring the membership and activities of the subsurface microbial communities that are responsible for reduction of soluble U(VI) to insoluble U(IV). Here, we report a proteomics-based approach for simultaneously documenting the strain membership and microbial physiology of the dominant Geobacter community members during in situ acetate amendment of the U-contaminated Rifle, CO, aquifer. Three planktonic Geobacter-dominated samples were obtained from two wells down-gradient of acetate addition. Over 2,500 proteins from each of these samples were identified by matching liquid chromatography-tandem mass spectrometry spectra to peptides predicted from seven isolate Geobacter genomes. Genome-specific peptides indicate early proliferation of multiple M21 and Geobacter bemidjiensis-like strains and later possible emergence of M21 and G. bemidjiensis-like strains more closely related to Geobacter lovleyi. Throughout biostimulation, the proteome is dominated by enzymes that convert acetate to acetyl-coenzyme A and pyruvate for central metabolism, while abundant peptides matching tricarboxylic acid cycle proteins and ATP synthase subunits were also detected, indicating the importance of energy generation during the period of rapid growth following the start of biostimulation. Evolving Geobacter strain composition may be linked to changes in protein abundance over the course of biostimulation and may reflect changes in metabolic functioning. Thus, metagenomics-independent community proteogenomics can be used to diagnose the status of the subsurface consortia upon which remediation biotechnology relies.

Thermodynamic analysis of regulation in metabolic networks using constraint-based modeling

Directory of Open Access Journals (Sweden)

Mahadevan Radhakrishnan

2010-05-01

Full Text Available Abstract Background Geobacter sulfurreducens is a member of the Geobacter species, which are capable of oxidation of organic waste coupled to the reduction of heavy metals and electrode with applications in bioremediation and bioenergy generation. While the metabolism of this organism has been studied through the development of a stoichiometry based genome-scale metabolic model, the associated regulatory network has not yet been well studied. In this manuscript, we report on the implementation of a thermodynamics based metabolic flux model for Geobacter sulfurreducens. We use this updated model to identify reactions that are subject to regulatory control in the metabolic network of G. sulfurreducens using thermodynamic variability analysis. Findings As a first step, we have validated the regulatory sites and bottleneck reactions predicted by the thermodynamic flux analysis in E. coli by evaluating the expression ranges of the corresponding genes. We then identified ten reactions in the metabolic network of G. sulfurreducens that are predicted to be candidates for regulation. We then compared the free energy ranges for these reactions with the corresponding gene expression fold changes under conditions of different environmental and genetic perturbations and show that the model predictions of regulation are consistent with data. In addition, we also identify reactions that operate close to equilibrium and show that the experimentally determined exchange coefficient (a measure of reversibility is significant for these reactions. Conclusions Application of the thermodynamic constraints resulted in identification of potential bottleneck reactions not only from the central metabolism but also from the nucleotide and amino acid subsystems, thereby showing the highly coupled nature of the thermodynamic constraints. In addition, thermodynamic variability analysis serves as a valuable tool in estimating the ranges of ΔrG' of every reaction in the model

Novel RuCoSe as non-platinum catalysts for oxygen reduction reaction in microbial fuel cells

Science.gov (United States)

Rozenfeld, Shmuel; Schechter, Michal; Teller, Hanan; Cahan, Rivka; Schechter, Alex

2017-09-01

Microbial electrochemical cells (MECs) are explored for the conversion of acetate directly to electrical energy. This device utilizes a Geobacter sulfurreducens anode and a novel RuCoSe air cathode. RuCoSe synthesized in selected compositions by a borohydride reduction method produces amorphous structures of powdered agglomerates. Oxygen reduction reaction (ORR) was measured in a phosphate buffer solution pH 7 using a rotating disc electrode (RDE), from which the kinetic current (ik) was measured as a function of potential and composition. The results show that ik of RuxCoySe catalysts increases in the range of XRu = 0.25 > x > 0.7 and y < 0.15 for all tested potentials. A poisoning study of RuCoSe and Pt catalysts in a high concentration acetate solution shows improved tolerance of RuCoSe to this fuel at acetate concentration ≥500 mM. MEC discharge plots under physiological conditions show that ∼ RuCo2Se (sample S3) has a peak power density of 750 mW cm-2 which is comparable with Pt 900 mW cm-2.

Identification of geobacter populations in the uranium mill tailings Shiprock

International Nuclear Information System (INIS)

Radeva, G.; Selenska-Pobell, S.

2006-01-01

Geobacter - specific primers were used for construction of a 16S rDNA library for a water sample collected from uranium mill tailings near Shiprock (Sh853) in the USA . Most of the retrieved sequences were affiliated with different Geobacter species, however sequences related to other δ -Proteobacteria were identified as well. (authors)

Screen-Printed Electrodes: New Tools for Developing Microbial Electrochemistry at Microscale Level

Directory of Open Access Journals (Sweden)

Marta Estevez-Canales

2015-11-01

Full Text Available Microbial electrochemical technologies (METs have a number of potential technological applications. In this work, we report the use of screen-printed electrodes (SPEs as a tool to analyze the microbial electroactivity by using Geobacter sulfurreducens as a model microorganism. We took advantage of the small volume required for the assays (75 μL and the disposable nature of the manufactured strips to explore short-term responses of microbial extracellular electron transfer to conductive materials under different scenarios. The system proved to be robust for identifying the bioelectrochemical response, while avoiding complex electrochemical setups, not available in standard biotechnology laboratories. We successfully validated the system for characterizing the response of Geobacter sulfurreducens in different physiological states (exponential phase, stationary phase, and steady state under continuous culture conditions revealing different electron transfer responses. Moreover, a combination of SPE and G. sulfurreducens resulted to be a promising biosensor for quantifying the levels of acetate, as well as for performing studies in real wastewater. In addition, the potential of the technology for identifying electroactive consortia was tested, as an example, with a mixed population with nitrate-reducing capacity. We therefore present SPEs as a novel low-cost platform for assessing microbial electrochemical activity at the microscale level.

Change in microbial communities in acetate- and glucose-fed microbial fuel cells in the presence of light

KAUST Repository

Xing, Defeng

2009-09-01

Power densities produced by microbial fuel cells (MFCs) in natural systems are changed by exposure to light through the enrichment of photosynthetic microorganisms. When MFCs with brush anodes were exposed to light (4000 lx), power densities increased by 8-10% for glucose-fed reactors, and 34% for acetate-fed reactors. Denaturing gradient gel electrophoresis (DGGE) profiles based on the 16S rRNA gene showed that exposure to high light levels changed the microbial communities on the anodes. Based on 16S rRNA gene clone libraries of light-exposed systems the anode communities using glucose were also significantly different than those fed acetate. Dominant bacteria that are known exoelectrogens were identified in the anode biofilm, including a purple nonsulfur (PNS) photosynthetic bacterium, Rhodopseudomonas palustris, and a dissimilatory iron-reducing bacterium, Geobacter sulfurreducens. Pure culture tests confirmed that PNS photosynthetic bacteria increased power production when exposed to high light intensities (4000 lx). These results demonstrate that power production and community composition are affected by light conditions as well as electron donors in single-chamber air-cathode MFCs. © 2009 Elsevier B.V. All rights reserved.

Change in microbial communities in acetate- and glucose-fed microbial fuel cells in the presence of light

KAUST Repository

Xing, Defeng; Cheng, Shaoan; Regan, John M.; Logan, Bruce E.

2009-01-01

Power densities produced by microbial fuel cells (MFCs) in natural systems are changed by exposure to light through the enrichment of photosynthetic microorganisms. When MFCs with brush anodes were exposed to light (4000 lx), power densities increased by 8-10% for glucose-fed reactors, and 34% for acetate-fed reactors. Denaturing gradient gel electrophoresis (DGGE) profiles based on the 16S rRNA gene showed that exposure to high light levels changed the microbial communities on the anodes. Based on 16S rRNA gene clone libraries of light-exposed systems the anode communities using glucose were also significantly different than those fed acetate. Dominant bacteria that are known exoelectrogens were identified in the anode biofilm, including a purple nonsulfur (PNS) photosynthetic bacterium, Rhodopseudomonas palustris, and a dissimilatory iron-reducing bacterium, Geobacter sulfurreducens. Pure culture tests confirmed that PNS photosynthetic bacteria increased power production when exposed to high light intensities (4000 lx). These results demonstrate that power production and community composition are affected by light conditions as well as electron donors in single-chamber air-cathode MFCs. © 2009 Elsevier B.V. All rights reserved.

Integrative analysis of Geobacter spp. and sulfate-reducing bacteria during uranium bioremediation

Directory of Open Access Journals (Sweden)

D. Lovley

2012-03-01

Full Text Available Enhancing microbial U(VI reduction with the addition of organic electron donors is a promising strategy for immobilizing uranium in contaminated groundwaters, but has yet to be optimized because of a poor understanding of the factors controlling the growth of various microbial communities during bioremediation. In previous field trials in which acetate was added to the subsurface, there were two distinct phases: an initial phase in which acetate-oxidizing, U(VI-reducing Geobacter predominated and U(VI was effectively reduced and a second phase in which acetate-oxidizing sulfate reducing bacteria (SRB predominated and U(VI reduction was poor. The interaction of Geobacter and SRB was investigated both in sediment incubations that mimicked in situ bioremediation and with in silico metabolic modeling. In sediment incubations, Geobacter grew quickly but then declined in numbers as the microbially reducible Fe(III was depleted whereas the SRB grow more slowly and reached dominance after 30–40 days. Modeling predicted a similar outcome. Additional modeling in which the relative initial percentages of the Geobacter and SRB were varied indicated that there was little to no competitive interaction between Geobacter and SRB when acetate was abundant. Further simulations suggested that the addition of Fe(III would revive the Geobacter, but have little to no effect on the SRB. This result was confirmed experimentally. The results demonstrate that it is possible to predict the impact of amendments on important components of the subsurface microbial community during groundwater bioremediation. The finding that Fe(III availability, rather than competition with SRB, is the key factor limiting the activity of Geobacter during in situ uranium bioremediation will aid in the design of improved uranium bioremediation strategies.

Conductive particles enable syntrophic acetate oxidation between Geobacter and Methanosarcina from coastal sediments

DEFF Research Database (Denmark)

Rotaru, Amelia-Elena; Calabrese, Federica; Stryhanyuk, Hryhoriy

2017-01-01

pressure and their survival depends on successful partnership. Here we demonstrate that conductive minerals facilitate a SAO partnership between Geobacter and Methanosarcina from the coastal sediments of the Bothnian Bay, Baltic Sea. Bothnian methanogenic sediments showed a high apparent isotopic...... fractionation (αc 1.07) characteristic of CO2-reductive methanogenesis. The native community was represented by electrogens such as Geobacter and methanogens like Methanosarcina. Upon the addition of conductive particles (activated carbon and magnetite), methanogenesis from acetate increased fourfold. Geobacter...... (96% related to G. psychrophilus) and Methanosarcina (99% related to M. subterranea) dominated the conductive particle-spiked SAO communities. Using NanoSIMS we demonstrated that during SAO, Geobacter incorporated 82% of the labeled acetate as compared to only 18% by Methanosarcina. At the same time...

Extracellular Palladium Nanoparticle Production using Geobacter sulfurreducens

KAUST Repository

Yates, Matthew D.; Cusick, Roland D.; Logan, Bruce E.

2013-01-01

verified that Pd(0) nanoparticles were predominantly in the EPS surrounding cells in H2-fed cultures, with only a small number of particles visible inside the cell. Separation of the cells and EPS by centrifugation allowed reuse of the cell suspensions

Rust dissolution and removal by iron-reducing bacteria: A potential rehabilitation of rusted equipment

International Nuclear Information System (INIS)

Starosvetsky, J.; Kamari, R.; Farber, Y.; Bilanović, D.; Armon, R.

2016-01-01

Highlights: • The present study demonstrated the high reductive capacity of both strains: the collection S. oneidensis and the wild strain Geobacter spp. (soil isolate). • The experimental strains were successful in Fe 3+ reduction for both states: soluble and crystalline (originally prepared from rust). • Rust dissolution can be improved by: addition of AFC at low concentration (0.2 g/l), increasing bacterial initial inoculum and rust reactive surface. • Both experimental IRB strains were able to completely remove previously formed rust on carbon steel coupons. • Additional results (not showed) revealed that culture S. oneidensis and the environmental isolate Geobacter spp., apparently have a different mechanism of iron reduction that requires further study. - Abstract: Iron reducing bacteria (IRB), to be used in rust dissolution and removal, have been isolated and enriched from different environmental sources. Comparative measurements revealed that a soil isolate (Geobacter sulfurreducens sp.) had the highest reductive activity equivalent to Shewanella oneidensis (strain CIP 106686, pure culture). Both reductive microorganisms can use Fe 3+ ions as electron acceptors from soluble as well as from crystalline sources. In nutrient medium containing soluble Fe 3+ , the highest reductive activity obtained for G. sulfurreducens sp. and S. oneidensis was 93 and 97% respectively. Successful removal of rust from carbon steel coupons has been achieved with both experimental bacteria.

Isolation of Geobacter species from diverse sedimentary environments

Science.gov (United States)

Coaxes, J.D.; Phillips, E.J.P.; Lonergan, D.J.; Jenter, H.; Lovley, D.R.

1996-01-01

In an attempt to better understand the microorganisms responsible for Fe(III) reduction in sedimentary environments, Fe(III)-reducing microorganisms were enriched for and isolated from freshwater aquatic sediments, a pristine deep aquifer, and a petroleum-contaminated shallow aquifer. Enrichments were initiated with acetate or toluene as the electron donor and Fe(III) as the electron acceptor. Isolations were made with acetate or benzoate. Five new strains which could obtain energy for growth by dissimilatory Fe(III) reduction were isolated. All five isolates are gram- negative strict anaerobes which grow with acetate as the electron donor and Fe(III) as the electron acceptor. Analysis of the 16S rRNA sequence of the isolated organisms demonstrated that they all belonged to the genus Geobacter in the delta subdivision of the Proteobacteria. Unlike the type strain, Geobacter metallireducens, three of the five isolates could use H2 as an electron donor fur Fe(III) reduction. The deep subsurface isolate is the first Fe(III) reducer shown to completely oxidize lactate to carbon dioxide, while one of the freshwater sediment isolates is only the second Fe(III) reducer known that can oxidize toluene. The isolation of these organisms demonstrates that Geobacter species are widely distributed in a diversity of sedimentary environments in which Fe(III) reduction is an important process.

Establishment and metabolic analysis of a model microbial community for understanding trophic and electron accepting interactions of subsurface anaerobic environments

Directory of Open Access Journals (Sweden)

Yang Zamin K

2010-05-01

Full Text Available Abstract Background Communities of microorganisms control the rates of key biogeochemical cycles, and are important for biotechnology, bioremediation, and industrial microbiological processes. For this reason, we constructed a model microbial community comprised of three species dependent on trophic interactions. The three species microbial community was comprised of Clostridium cellulolyticum, Desulfovibrio vulgaris Hildenborough, and Geobacter sulfurreducens and was grown under continuous culture conditions. Cellobiose served as the carbon and energy source for C. cellulolyticum, whereas D. vulgaris and G. sulfurreducens derived carbon and energy from the metabolic products of cellobiose fermentation and were provided with sulfate and fumarate respectively as electron acceptors. Results qPCR monitoring of the culture revealed C. cellulolyticum to be dominant as expected and confirmed the presence of D. vulgaris and G. sulfurreducens. Proposed metabolic modeling of carbon and electron flow of the three-species community indicated that the growth of C. cellulolyticum and D. vulgaris were electron donor limited whereas G. sulfurreducens was electron acceptor limited. Conclusions The results demonstrate that C. cellulolyticum, D. vulgaris, and G. sulfurreducens can be grown in coculture in a continuous culture system in which D. vulgaris and G. sulfurreducens are dependent upon the metabolic byproducts of C. cellulolyticum for nutrients. This represents a step towards developing a tractable model ecosystem comprised of members representing the functional groups of a trophic network.

Enrichment of Geobacter species in response to stimulation of Fe(III) reduction in sandy aquifer sediments

Science.gov (United States)

Snoeyenbos-West, O.L.; Nevin, K.P.; Anderson, R.T.; Lovely, D.R.

2000-01-01

Engineered stimulation of Fe(III) has been proposed as a strategy to enhance the immobilization of radioactive and toxic metals in metal-contaminated subsurface environments. Therefore, laboratory and field studies were conducted to determine which microbial populations would respond to stimulation of Fe(III) reduction in the sediments of sandy aquifers. In laboratory studies, the addition of either various organic electron donors or electron shuttle compounds stimulated Fe(III) reduction and resulted in Geobacter sequences becoming important constituents of the Bacterial 16S rDNA sequences that could be detected with PCR amplification and denaturing gradient gel electrophoresis (DGGE). Quantification of Geobacteraceae sequences with a PCR most-probable-number technique indicated that the extent to which numbers of Geobacter increased was related to the degree of stimulation of Fe(III) reduction. Geothrix species were also enriched in some instances, but were orders of magnitude less numerous than Geobacter species. Shewanella species were not detected, even when organic compounds known to be electron donors for Shewanella species were used to stimulate Fe(III) reduction in the sediments. Geobacter species were also enriched in two field experiments in which Fe(III) reduction was stimulated with the addition of benzoate or aromatic hydrocarbons. The apparent growth of Geobacter species concurrent with increased Fe(III) reduction suggests that Geobacter species were responsible for much of the Fe(III) reduction in all of the stimulation approaches evaluated in three geographically distinct aquifers. Therefore, strategies for subsurface remediation that involve enhancing the activity of indigenous Fe(III)-reducing populations in aquifers should consider the physiological properties of Geobacter species in their treatment design.

Transcriptomic and genetic analysis of direct interspecies electron transfer

DEFF Research Database (Denmark)

Shrestha, Pravin Malla; Rotaru, Amelia-Elena; Summers, Zarath M

2013-01-01

The possibility that metatranscriptomic analysis could distinguish between direct interspecies electron transfer (DIET) and H2 interspecies transfer (HIT) in anaerobic communities was investigated by comparing gene transcript abundance in cocultures in which Geobacter sulfurreducens....... These results demonstrate that there are unique gene expression patterns that distinguish DIET from HIT and suggest that metatranscriptomics may be a promising route to investigate interspecies electron transfer pathways in more-complex environments....

Molecular analysis of phosphate limitation in Geobacteraceae during the bioremediation of a uranium-contaminated aquifer

Energy Technology Data Exchange (ETDEWEB)

N' Guessan, L.A.; Elifantz, H.; Nevin, K.P.; Mouser, P.J.; Methe, B.; Woodard, T. L.; Manley, K.; Williams, K. H.; Wilkins, M. J.; Larsen, J.T.; Long, P. E.; Lovley, D. R.

2009-09-01

Nutrient limitation is an environmental stress that may reduce the effectiveness of bioremediation strategies, especially when the contaminants are organic compounds or when organic compounds are added to promote microbial activities such as metal reduction. Genes indicative of phosphate-limitation were identified via microarray analysis of chemostat cultures of Geobacter sulfureducens. This analysis revealed that genes in the pst-pho operon, which is associated with a high affinity phosphate uptake system in other microorganisms, had significantly higher transcript abundance under phosphate-limiting conditions, with the genes pstB and phoU the most up-regulated. Quantitative PCR analysis of pstB and phoU transcript levels in G. sulfurreducens grown in chemostats demonstrated that the expression of these genes increased when phosphate was removed from the culture medium. Transcripts of pstB and phoU within the subsurface Geobacter species predominating during an in situ uranium bioremediation field experiment were more abundant than in chemostat cultures of G. sulfurreducens that were not limited for phosphate. Addition of phosphate to incubations of subsurface sediments did not stimulate dissimilatory metal reduction. The added phosphate was rapidly adsorbed onto the sediments. The results demonstrate that Geobacter species can effectively reduce U(VI) even when experiencing suboptimal phosphate concentrations and that increasing phosphate availability with phosphate additions is difficult to achieve due to the high reactivity of this compound. This transcript-based approach developed for diagnosing phosphate limitation should be applicable to assessing the potential need for additional phosphate in other bioremediation processes.

Combining microbial cultures for efficient production of electricity from butyrate in a microbial electrochemical cell

Science.gov (United States)

Miceli, Joseph F.; Garcia-Peña, Ines; Parameswaran, Prathap; Torres, César I.; Krajmalnik-Brown, Rosa

2014-01-01

Butyrate is an important product of anaerobic fermentation; however, it is not directly used by characterized strains of the highly efficient anode respiring bacteria (ARB) Geobacter sulfurreducens in microbial electrochemical cells. By combining a butyrate-oxidizing community with a Geobacter rich culture, we generated a microbial community which outperformed many naturally derived communities found in the literature for current production from butyrate and rivaled the highest performing natural cultures in terms of current density (~11 A/m2) and Coulombic efficiency (~70%). Microbial community analyses support the shift in the microbial community from one lacking efficient ARB in the marine hydrothermal vent community to a community consisting of ~80% Geobacter in the anode biofilm. This demonstrates the successful production and adaptation of a novel microbial culture for generating electrical current from butyrate with high current density and high Coulombic efficiency, by combining two mixed micro bial cultures containing complementing biochemical pathways. PMID:25048958

Inocula selection in microbial fuel cells based on anodic biofilm abundance of Geobacter sulfurreducens

DEFF Research Database (Denmark)

Sun, Guotao; Rodrigues, Diogo De Sacadura; Thygesen, Anders

2016-01-01

with naturally occurring mixed inocula. In this study, the electrochemical performance of MFCs and microbial community evolution were evaluated for three inocula including domestic wastewater (DW), lake sediment (LS) and biogas sludge (BS) with varying substrate loading (Lsub) and external resistance (Rext....... The data obtained contribute to understanding the microbial community response to Lsub and Rext for optimizing electricity generation in MFCs....

Syntrophic interactions improve power production in formic acid fed MFCs operated with set anode potentials or fixed resistances

KAUST Repository

Sun, Dan

2011-10-24

Formic acid is a highly energetic electron donor but it has previously resulted in low power densities in microbial fuel cells (MFCs). Three different set anode potentials (-0.30, -0.15, and +0.15V; vs. a standard hydrogen electrode, SHE) were used to evaluate syntrophic interactions in bacterial communities for formic acid degradation relative to a non-controlled, high resistance system (1,000Ω external resistance). No current was generated at -0.30V, suggesting a lack of direct formic acid oxidation (standard reduction potential: -0.40V). More positive potentials that allowed for acetic acid utilization all produced current, with the best performance at -0.15V. The anode community in the -0.15V reactor, based on 16S rDNA clone libraries, was 58% Geobacter sulfurreducens and 17% Acetobacterium, with lower proportions of these genera found in the other two MFCs. Acetic acid was detected in all MFCs suggesting that current generation by G. sulfurreducens was dependent on acetic acid production by Acetobacterium. When all MFCs were subsequently operated at an external resistance for maximum power production (100Ω for MFCs originally set at -0.15 and +0.15V; 150Ω for the control), they produced similar power densities and exhibited the same midpoint potential of -0.15V in first derivative cyclic voltammetry scans. All of the mixed communities converged to similar proportions of the two predominant genera (ca. 52% G. sulfurreducens and 22% Acetobacterium). These results show that syntrophic interactions can be enhanced through setting certain anode potentials, and that long-term performance produces stable and convergent communities. © 2011 Wiley Periodicals, Inc.

Syntrophic interactions improve power production in formic acid fed MFCs operated with set anode potentials or fixed resistances

KAUST Repository

Sun, Dan; Call, Douglas F.; Kiely, Patrick D.; Wang, Aijie; Logan, Bruce E.

2011-01-01

Formic acid is a highly energetic electron donor but it has previously resulted in low power densities in microbial fuel cells (MFCs). Three different set anode potentials (-0.30, -0.15, and +0.15V; vs. a standard hydrogen electrode, SHE) were used to evaluate syntrophic interactions in bacterial communities for formic acid degradation relative to a non-controlled, high resistance system (1,000Ω external resistance). No current was generated at -0.30V, suggesting a lack of direct formic acid oxidation (standard reduction potential: -0.40V). More positive potentials that allowed for acetic acid utilization all produced current, with the best performance at -0.15V. The anode community in the -0.15V reactor, based on 16S rDNA clone libraries, was 58% Geobacter sulfurreducens and 17% Acetobacterium, with lower proportions of these genera found in the other two MFCs. Acetic acid was detected in all MFCs suggesting that current generation by G. sulfurreducens was dependent on acetic acid production by Acetobacterium. When all MFCs were subsequently operated at an external resistance for maximum power production (100Ω for MFCs originally set at -0.15 and +0.15V; 150Ω for the control), they produced similar power densities and exhibited the same midpoint potential of -0.15V in first derivative cyclic voltammetry scans. All of the mixed communities converged to similar proportions of the two predominant genera (ca. 52% G. sulfurreducens and 22% Acetobacterium). These results show that syntrophic interactions can be enhanced through setting certain anode potentials, and that long-term performance produces stable and convergent communities. © 2011 Wiley Periodicals, Inc.

Functional Role of Infective Viral Particles on Metal Reduction

Energy Technology Data Exchange (ETDEWEB)

Coates, John D.

2014-04-01

A proposed strategy for the remediation of uranium (U) contaminated sites was based on the immobilization of U by reducing the oxidized soluble U, U(VI), to form a reduced insoluble end product, U(IV). Previous studies identified Geobacter sp., including G. sulfurreducens and G. metallireducens, as predominant U(VI)-reducing bacteria under acetate-oxidizing and U(VI)-reducing conditions. Examination of the finished genome sequence annotation of the canonical metal reducing species Geobacter sulfurreducens strain PCA and G. metallireduceans strain GS-15 as well as the draft genome sequence of G. uraniumreducens strain Rf4 identified phage related proteins. In addition, the completed genome for Anaeromyxobacter dehalogenans and the draft genome sequence of Desulfovibrio desulfuricans strain G20, two more model metal-reducing bacteria, also revealed phage related sequences. The presence of these gene sequences indicated that Geobacter spp., Anaeromyxobacter spp., and Desulfovibrio spp. are susceptible to viral infection. Furthermore, viral populations in soils and sedimentary environments in the order of 6.4×10{sup 6}–2.7×10{sup 10} VLP’s cm{sup -3} have been observed. In some cases, viral populations exceed bacterial populations in these environments suggesting that a relationship may exist between viruses and bacteria. Our preliminary screens of samples collected from the ESR FRC indicated that viral like particles were observed in significant numbers. The objective of this study was to investigate the potential functional role viruses play in metal reduction specifically Fe(III) and U(VI) reduction, the environmental parameters affecting viral infection of metal reducing bacteria, and the subsequent effects on U transport.

Functional environmental proteomics: elucidating the role of a c-type cytochrome abundant during uranium bioremediation.

Science.gov (United States)

Yun, Jiae; Malvankar, Nikhil S; Ueki, Toshiyuki; Lovley, Derek R

2016-02-01

Studies with pure cultures of dissimilatory metal-reducing microorganisms have demonstrated that outer-surface c-type cytochromes are important electron transfer agents for the reduction of metals, but previous environmental proteomic studies have typically not recovered cytochrome sequences from subsurface environments in which metal reduction is important. Gel-separation, heme-staining and mass spectrometry of proteins in groundwater from in situ uranium bioremediation experiments identified a putative c-type cytochrome, designated Geobacter subsurface c-type cytochrome A (GscA), encoded within the genome of strain M18, a Geobacter isolate previously recovered from the site. Homologs of GscA were identified in the genomes of other Geobacter isolates in the phylogenetic cluster known as subsurface clade 1, which predominates in a diversity of Fe(III)-reducing subsurface environments. Most of the gscA sequences recovered from groundwater genomic DNA clustered in a tight phylogenetic group closely related to strain M18. GscA was most abundant in groundwater samples in which Geobacter sp. predominated. Expression of gscA in a strain of Geobacter sulfurreducens that lacked the gene for the c-type cytochrome OmcS, thought to facilitate electron transfer from conductive pili to Fe(III) oxide, restored the capacity for Fe(III) oxide reduction. Atomic force microscopy provided evidence that GscA was associated with the pili. These results demonstrate that a c-type cytochrome with an apparent function similar to that of OmcS is abundant when Geobacter sp. are abundant in the subsurface, providing insight into the mechanisms for the growth of subsurface Geobacter sp. on Fe(III) oxide and suggesting an approach for functional analysis of other Geobacter proteins found in the subsurface.

Microbiome characterization of MFCs used for the treatment of swine manure.

Science.gov (United States)

Vilajeliu-Pons, Anna; Puig, Sebastià; Pous, Narcís; Salcedo-Dávila, Inmaculada; Bañeras, Lluís; Balaguer, Maria Dolors; Colprim, Jesús

2015-05-15

Conventional swine manure treatment is performed by anaerobic digestion, but nitrogen is not treated. Microbial Fuel Cells (MFCs) allow organic matter and nitrogen removal with concomitant electricity production. MFC microbiomes treating industrial wastewaters as swine manure have not been characterized. In this study, a multidisciplinary approach allowed microbiome relation with nutrient removal capacity and electricity production. Two different MFC configurations (C-1 and C-2) were used to treat swine manure. In C-1, the nitrification and denitrification processes took place in different compartments, while in C-2, simultaneous nitrification-denitrification occurred in the cathode. Clostridium disporicum and Geobacter sulfurreducens were identified in the anode compartments of both systems. C. disporicum was related to the degradation of complex organic matter compounds and G. sulfurreducens to electricity production. Different nitrifying bacteria populations were identified in both systems because of the different operational conditions. The highest microbial diversity was detected in cathode compartments of both configurations, including members of Bacteroidetes, Chloroflexiaceae and Proteobacteria. These communities allowed similar removal rates of organic matter (2.02-2.09 kg COD m(-3)d(-1)) and nitrogen (0.11-0.16 kg Nm(-3)d(-1)) in both systems. However, they differed in the generation of electric energy (20 and 2 mW m(-3) in C-1 and C-2, respectively). Copyright © 2015 Elsevier B.V. All rights reserved.

Promoting Interspecies Electron Transfer with Biochar

Science.gov (United States)

Chen, Shanshan; Rotaru, Amelia-Elena; Shrestha, Pravin Malla; Malvankar, Nikhil S.; Liu, Fanghua; Fan, Wei; Nevin, Kelly P.; Lovley, Derek R.

2014-01-01

Biochar, a charcoal-like product of the incomplete combustion of organic materials, is an increasingly popular soil amendment designed to improve soil fertility. We investigated the possibility that biochar could promote direct interspecies electron transfer (DIET) in a manner similar to that previously reported for granular activated carbon (GAC). Although the biochars investigated were 1000 times less conductive than GAC, they stimulated DIET in co-cultures of Geobacter metallireducens with Geobacter sulfurreducens or Methanosarcina barkeri in which ethanol was the electron donor. Cells were attached to the biochar, yet not in close contact, suggesting that electrons were likely conducted through the biochar, rather than biological electrical connections. The finding that biochar can stimulate DIET may be an important consideration when amending soils with biochar and can help explain why biochar may enhance methane production from organic wastes under anaerobic conditions. PMID:24846283

Development of a biomarker for Geobacter activity and strain composition: Proteogenomic analysis of the citrate synthase protein during bioremediation of U(VI)

Energy Technology Data Exchange (ETDEWEB)

Wilkins, M.J.; Callister, S.J.; Miletto, M.; Williams, K.H.; Nicora, C.D.; Lovley, D.R.; Long, P.E.; Lipton, M.S.

2010-02-15

Monitoring the activity of target microorganisms during stimulated bioremediation is a key problem for the development of effective remediation strategies. At the US Department of Energy's Integrated Field Research Challenge (IFRC) site in Rifle, CO, the stimulation of Geobacter growth and activity via subsurface acetate addition leads to precipitation of U(VI) from groundwater as U(IV). Citrate synthase (gltA) is a key enzyme in Geobacter central metabolism that controls flux into the TCA cycle. Here, we utilize shotgun proteomic methods to demonstrate that the measurement of gltA peptides can be used to track Geobacter activity and strain evolution during in situ biostimulation. Abundances of conserved gltA peptides tracked Fe(III) reduction and changes in U(VI) concentrations during biostimulation, whereas changing patterns of unique peptide abundances between samples suggested sample-specific strain shifts within the Geobacter population. Abundances of unique peptides indicated potential differences at the strain level between Fe(III)-reducing populations stimulated during in situ biostimulation experiments conducted a year apart at the Rifle IFRC. These results offer a novel technique for the rapid screening of large numbers of proteomic samples for Geobacter species and will aid monitoring of subsurface bioremediation efforts that rely on metal reduction for desired outcomes.

High Biofilm Conductivity Maintained Despite Anode Potential Changes in a Geobacter-Enriched Biofilm

Science.gov (United States)

This study systematically assessed intracellular electron transfer (IET) and extracellular electron transfer (EET) kinetics with respect to anode potential (Eanode) in a mixed-culture biofilm anode enriched with Geobacter spp. High biofilm conductivity (0.96–1.24 mScm^-1) was mai...

Evaluation of organic matter removal and electricity generation by using integrated microbial fuel cells for wastewater treatment.

Science.gov (United States)

Yamashita, Takahiro; Ishida, Mitsuyoshi; Ogino, Akifumi; Yokoyama, Hiroshi

2016-01-01

A floating all-in-one type of microbial fuel cell (Fa-MFC) that allows simple operation and installation in existing wastewater reservoirs for decomposition of organic matter was designed. A prototype cell was constructed by fixing a tubular floater to an assembly composed of a proton-exchange membrane and an air-cathode. To compare anode materials, carbon-cloth anodes or carbon-brush anodes were included in the assembly. The fabricated assemblies were floated in 1-L beakers filled with acetate medium. Both reactors removed acetate at a rate of 133-181 mg/L/d. The Fa-MFC quipped with brush anodes generated a 1.7-fold higher maximum power density (197 mW/m(2)-cathode area) than did that with cloth anodes (119 mW/m(2)-cathode area). To evaluate the performance of the Fa-MFCs on more realistic substrates, artificial wastewater, containing peptone and meat extract, was placed in a 2-L beaker, and the Fa-MFC with brush anodes was floated in the beaker. The Fa-MFC removed the chemical oxygen demand of the wastewater at a rate of 465-1029 mg/L/d, and generated a maximum power density of 152 mW/m(2)-cathode area. When the Fa-MFC was fed with actual livestock wastewater, the biological oxygen demand of the wastewater was removed at a rate of 45-119 mg/L/d, with electricity generation of 95 mW/m(2)-cathode area. Bacteria related to Geobacter sulfurreducens were predominantly detected in the anode biofilm, as deduced from the analysis of the 16S rRNA gene sequence.

Dissecting the functional role of key residues in triheme cytochrome PpcA: a path to rational design of G. sulfurreducens strains with enhanced electron transfer capabilities.

Directory of Open Access Journals (Sweden)

Leonor Morgado

Full Text Available PpcA is the most abundant member of a family of five triheme cytochromes c7 in the bacterium Geobacter sulfurreducens (Gs and is the most likely carrier of electrons destined for outer surface during respiration on solid metal oxides, a process that requires extracellular electron transfer. This cytochrome has the highest content of lysine residues (24% among the family, and it was suggested to be involved in e-/H(+ energy transduction processes. In the present work, we investigated the functional role of lysine residues strategically located in the vicinity of each heme group. Each lysine was replaced by glutamine or glutamic acid to evaluate the effects of a neutral or negatively charged residue in each position. The results showed that replacing Lys9 (located near heme IV, Lys18 (near heme I or Lys22 (between hemes I and III has essentially no effect on the redox properties of the heme groups and are probably involved in redox partner recognition. On the other hand, Lys43 (near heme IV, Lys52 (between hemes III and IV and Lys60 (near heme III are crucial in the regulation of the functional mechanism of PpcA, namely in the selection of microstates that allow the protein to establish preferential e-/H(+ transfer pathways. The results showed that the preferred e-/H(+ transfer pathways are only established when heme III is the last heme to oxidize, a feature reinforced by a higher difference between its reduction potential and that of its predecessor in the order of oxidation. We also showed that K43 and K52 mutants keep the mechanistic features of PpcA by establishing preferential e-/H+ transfer pathways at lower reduction potential values than the wild-type protein, a property that can enable rational design of Gs strains with optimized extracellular electron transfer capabilities.

Exoelectrogenic biofilm as a template for sustainable formation of a catalytic mesoporous structure

KAUST Repository

Yates, Matthew D.

2014-06-04

© 2014 Wiley Periodicals, Inc. Actively respiring biofilms of Geobacter sulfurreducens were used as a biotemplate to form a palladium mesoporous layer directly on an electrode surface. Cells and proteins within the biofilm acted as the reductant and stabilizer to facilitate the reduction, dispersion, and attachment of palladium nanoparticles to the electrode surface without using synthetic chemicals. © 2014 Wiley Periodicals, Inc. Mesoporous structures can increase catalytic activity by maximizing the ratio of surface area to volume, but current synthesis techniques utilize expensive polymers and toxic chemicals. A Geobacter sulfurreducens biofilm was used as a sustainable template to form mesoporous Pd structures while eliminating the need for synthetic chemicals. The bulk of the biofilm material was removed by thermal treatments after nanoparticle formation, producing a catalytic Pd mesoporous (pore size 9.7±0.1nm) structure attached to the graphite electrode with a 1.5-2μm thick backbone composed of nanoparticles (~200nm). A control electrode electrochemically plated with Pd in the absence of a biofilm exhibited a variable planar Pd base (~0.5-3μm thick) with sporadic Pd extrusions (~2μm across, 1-5μm tall) from the surface. The biotemplated mesoporous structure produced 15-20% higher stable current densities during H2 oxidation tests than the electrochemically plated control electrode, even though 30% less Pd was present in the biotemplated catalyst. These results indicate that electroactive biofilms can be used as a sustainable base material to produce nanoporous structures without the need for synthetic polymers. Biotechnol. Bioeng. 2014;111: 2349-2354.

Exoelectrogenic biofilm as a template for sustainable formation of a catalytic mesoporous structure

KAUST Repository

Yates, Matthew D.; Cusick, Roland D.; Ivanov, Ivan; Logan, Bruce E.

2014-01-01

© 2014 Wiley Periodicals, Inc. Actively respiring biofilms of Geobacter sulfurreducens were used as a biotemplate to form a palladium mesoporous layer directly on an electrode surface. Cells and proteins within the biofilm acted as the reductant and stabilizer to facilitate the reduction, dispersion, and attachment of palladium nanoparticles to the electrode surface without using synthetic chemicals. © 2014 Wiley Periodicals, Inc. Mesoporous structures can increase catalytic activity by maximizing the ratio of surface area to volume, but current synthesis techniques utilize expensive polymers and toxic chemicals. A Geobacter sulfurreducens biofilm was used as a sustainable template to form mesoporous Pd structures while eliminating the need for synthetic chemicals. The bulk of the biofilm material was removed by thermal treatments after nanoparticle formation, producing a catalytic Pd mesoporous (pore size 9.7±0.1nm) structure attached to the graphite electrode with a 1.5-2μm thick backbone composed of nanoparticles (~200nm). A control electrode electrochemically plated with Pd in the absence of a biofilm exhibited a variable planar Pd base (~0.5-3μm thick) with sporadic Pd extrusions (~2μm across, 1-5μm tall) from the surface. The biotemplated mesoporous structure produced 15-20% higher stable current densities during H2 oxidation tests than the electrochemically plated control electrode, even though 30% less Pd was present in the biotemplated catalyst. These results indicate that electroactive biofilms can be used as a sustainable base material to produce nanoporous structures without the need for synthetic polymers. Biotechnol. Bioeng. 2014;111: 2349-2354.

The impact of shearing flows on electroactive biofilm formation, structure, and current generation

Science.gov (United States)

Jones, A.-Andrew; Buie, Cullen

2016-11-01

A special class of bacteria exist that directly produce electricity. First explored in 1911, these electroactive bacteria catalyze hydrocarbons and transport electrons directly to a metallic electron acceptor forming thicker biofilms than other species. Electroactive bacteria biofilms are thicker because they are not limited by transport of oxygen or other terminal electron acceptors. Electroactive bacteria can produce power in fuel cells. Power production is limited in fuel cells by the bacteria's inability to eliminate protons near the insoluble electron acceptor not utilized in the wild. To date, they have not been successfully evolved or engineered to overcome this limit. This limitation may be overcome by enhancing convective mass transport while maintaining substantial biomass within the biofilm. Increasing convective mass transport increases shear stress. A biofilm may respond to increased shear by changing biomass, matrix, or current production. In this study, a rotating disk electrode is used to separate nutrient from physical stress. This phenomenon is investigated using the model electroactive bacterium Geobacter sulfurreducens at nutrient loads comparable to flow-through microbial fuel cells. We determine biofilm structure experimentally by measuring the porosity and calculating the tortuosity from confocal microscope images. Biofilm adaptation for electron transport is quantified using electrical impedance spectroscopy. Our ultimate objective is a framework relating biofilm thickness, porosity, shear stress and current generation for the optimization of bioelectrochemical systems The Alfred P Sloan Foundation MPHD Program.

Repression of hydrogen uptake using conjugated oligoelectrolytes in microbial electrolysis cells

KAUST Repository

Hou, Huijie

2014-11-01

Copyright © 2014, Hydrogen Energy Publications, LLC. Published by Elsevier Ltd. All rights reserved. DSBN+, a conjugated oligoelectrolyte (COE), was added to microbial electrolysis cells (MECs) to improve hydrogen recovery. The volume of hydrogen gas recovered in a fedbatch cycle of mixed culture MECs increased by 126× compared to controls (no COE addition), mainly by preventing the loss of hydrogen to methane production. Performance in pure culture MECs fed with Geobacter sulfurreducens increased by factors of 10.5 in terms of energy yield, 2.1 in COD removal, and 11.8 in hydrogen yield. Hydrogen gas recycling was reduced, and the volume of hydrogen gas recovered increased by 6.5× compared to controls. Minimal methane production and a lack of hydrogen gas uptake by G. sulfurreducens suggested that the COEs increased hydrogen recoveries by interfering with hydrogen uptake by hydrogenotrophic methanogens but also by exoelectrogenic bacteria. COEs may therefore be useful for inhibiting the activities of certain hydrogenases, although the mechanism of inhibition needs further investigation.

Repression of hydrogen uptake using conjugated oligoelectrolytes in microbial electrolysis cells

KAUST Repository

Hou, Huijie; Chen, Xiaofen; Liu, Jia; Zhu, Xiuping; Bazan, Guillermo C.; Logan, Bruce E.

2014-01-01

Copyright © 2014, Hydrogen Energy Publications, LLC. Published by Elsevier Ltd. All rights reserved. DSBN+, a conjugated oligoelectrolyte (COE), was added to microbial electrolysis cells (MECs) to improve hydrogen recovery. The volume of hydrogen gas recovered in a fedbatch cycle of mixed culture MECs increased by 126× compared to controls (no COE addition), mainly by preventing the loss of hydrogen to methane production. Performance in pure culture MECs fed with Geobacter sulfurreducens increased by factors of 10.5 in terms of energy yield, 2.1 in COD removal, and 11.8 in hydrogen yield. Hydrogen gas recycling was reduced, and the volume of hydrogen gas recovered increased by 6.5× compared to controls. Minimal methane production and a lack of hydrogen gas uptake by G. sulfurreducens suggested that the COEs increased hydrogen recoveries by interfering with hydrogen uptake by hydrogenotrophic methanogens but also by exoelectrogenic bacteria. COEs may therefore be useful for inhibiting the activities of certain hydrogenases, although the mechanism of inhibition needs further investigation.

Biological reduction of iron to the elemental state from ochre deposits of Skelton Beck in Northeast England

Directory of Open Access Journals (Sweden)

Pattanathu K S M Rahman

2014-06-01

Full Text Available Ochre, consequence of acid mine drainage, is iron oxides-rich soil pigments that can be found in the water drainage from historic base metal and coal mines. The anaerobic strains of Geobacter sulfurreducens and Shewanella denitrificans were used for the microbial reduction of iron from samples of ochre collected from Skelton Beck (Saltburn Orange River, NZ 66738 21588 in Northeast England. The aim of the research was to determine the ability of the two anaerobic bacteria to reduce the iron present in ochre and to determine the rate of the reduction process. The physico-chemical changes in the ochre sample after the microbial reduction process were observed by the production of zero-valent iron which was later confirmed by the detection of elemental Fe in XRD spectrum. The XRF results revealed that 69.16% and 84.82% of iron oxide can be reduced using G. sulfurreducens and S. denitrificans respectively after 8 days of incubation. These results could provide the basis for the development of a biohydrometallurgical process for the production of elemental iron from ochre sediments.

Necessity of electrically conductive pili for methanogenesis with magnetite stimulation

Directory of Open Access Journals (Sweden)

Oumei Wang

2018-03-01

Full Text Available Background Magnetite-mediated direct interspecies electron transfer (DIET between Geobacter and Methanosarcina species is increasingly being invoked to explain magnetite stimulation of methane production in anaerobic soils and sediments. Although magnetite-mediated DIET has been documented in defined co-cultures reducing fumarate or nitrate as the electron acceptor, the effects of magnetite have only been inferred in methanogenic systems. Methods Concentrations of methane and organic acid were analysed with a gas chromatograph and high-performance liquid chromatography, respectively. The concentration of HCl-extractable Fe(II was determined by the ferrozine method. The association of the defined co-cultures of G. metallireducens and M. barkeri with magnetite was observed with transmission electron micrographs. Results Magnetite stimulated ethanol metabolism and methane production in defined co-cultures of G. metallireducens and M. barkeri; however, magnetite did not promote methane production in co-cultures initiated with a culture of G. metallireducens that could not produce electrically conductive pili (e-pili, unlike the conductive carbon materials that facilitate DIET in the absence of e-pili. Transmission electron microscopy revealed that G. metallireducens and M. barkeri were closely associated when magnetite was present, as previously observed in G. metallireducens/G. sulfurreducens co-cultures. These results show that magnetite can promote DIET between Geobacter and Methanosarcina species, but not as a substitute for e-pili, and probably functions to facilitate electron transfer from the e-pili to Methanosarcina. Conclusion In summary, the e-pili are necessary for the stimulation of not only G. metallireducens/G. sulfurreducens, but also methanogenic G. metallireducens/M. barkeri co-cultures with magnetite.

Long-range Electron Transport in Geobacter sulfurreducens Biofilms is Redox Gradient-Driven

Science.gov (United States)

2012-01-01

modified version of the Nernst Equation (Eq. 2): ðXOxÞz=0; j = exp g nF RT Ej − Eo′ avg 1+ exp g nF RT Ej − Eo′ avg : [2] j= 1...www.pnas.org/cgi/doi/10.1073/pnas.1209829109 Snider et al. that follows directly from equation 21 in the work by Strycharz- Glaven et al. (14, 63

Active transport, substrate specificity, and methylation of Hg(II) in anaerobic bacteria

Science.gov (United States)

Schaefer, Jeffra K.; Rocks, Sara S.; Zheng, Wang; Liang, Liyuan; Gu, Baohua; Morel, François M. M.

2011-01-01

The formation of methylmercury (MeHg), which is biomagnified in aquatic food chains and poses a risk to human health, is effected by some iron- and sulfate-reducing bacteria (FeRB and SRB) in anaerobic environments. However, very little is known regarding the mechanism of uptake of inorganic Hg by these organisms, in part because of the inherent difficulty in measuring the intracellular Hg concentration. By using the FeRB Geobacter sulfurreducens and the SRB Desulfovibrio desulfuricans ND132 as model organisms, we demonstrate that Hg(II) uptake occurs by active transport. We also establish that Hg(II) uptake by G. sulfurreducens is highly dependent on the characteristics of the thiols that bind Hg(II) in the external medium, with some thiols promoting uptake and methylation and others inhibiting both. The Hg(II) uptake system of D. desulfuricans has a higher affinity than that of G. sulfurreducens and promotes Hg methylation in the presence of stronger complexing thiols. We observed a tight coupling between Hg methylation and MeHg export from the cell, suggesting that these two processes may serve to avoid the build up and toxicity of cellular Hg. Our results bring up the question of whether cellular Hg uptake is specific for Hg(II) or accidental, occurring via some essential metal importer. Our data also point at Hg(II) complexation by thiols as an important factor controlling Hg methylation in anaerobic environments. PMID:21555571

Mercury methylation coupled to iron reduction by dissimilatory iron-reducing bacteria.

Science.gov (United States)

Si, Youbin; Zou, Yan; Liu, Xiaohong; Si, Xiongyuan; Mao, Jingdong

2015-03-01

Iron reduction and mercury methylation by dissimilatory iron-reducing bacteria (DIRB), Geobacter sulfurreducens and Shewanella oneidensis, were studied, and the relationship of mercury methylation coupled to iron reduction was determined. The ability of both bacteria for reducing iron was tested, and Fe(III) reduction occurred with the highest rate when ferric oxyhydroxide was used as a terminal electron acceptor. G. sulfurreducens had proven to mediate the production of methylmercury (MeHg), and a notable increase of MeHg following the addition of inorganic Hg was observed. When the initial concentration of HgCl2 was 500nM, about 177.03nM of MeHg was determined at 8d after G. sulfurreducens inoculation. S. oneidensis was tested negligible for Hg methylation and only 12.06nM of MeHg was determined. Iron reduction could potentially influence Hg methylation rates. The increase in MeHg was consistent with high rate of iron reduction, indicating that Fe(III) reduction stimulated the formation of MeHg. Furthermore, the net MeHg concentration increased at low Fe(III) additions from 1.78 to 3.57mM, and then decreased when the added Fe(III) was high from 7.14 to 17.85mM. The mercury methylation rate was suppressed with high Fe(III) additions, which might have been attributable to mercury complexation and low availability. Copyright © 2014 Elsevier Ltd. All rights reserved.

Geobacter Dominates the Inner Layers of a Stratified Biofilm on a Fluidized Anode During Brewery Wastewater Treatment

Directory of Open Access Journals (Sweden)

Sara Tejedor-Sanz

2018-03-01

Full Text Available In this study, we designed a microbial electrochemical fluidized bed reactor (ME-FBR, with an electroconductive anodic bed made of activated carbon particles for treating a brewery wastewater. Under a batch operating mode, acetate and propionate consumption rates were 13-fold and 2.4-fold higher, respectively, when the fluidized anode was polarized (0.2 V with respect to open circuit conditions. Operating in a continuous mode, this system could effectively treat the brewery effluent at organic loading rates (OLR over 1.7 kg m-3NRV d-1 and with removal efficiencies of 95 ± 1.4% (hydraulic retention time of 1 day and an influent of 1.7 g-COD L-1. The coulombic efficiency values highly depended upon the OLR applied, and varied from a 56 ± 15% to 10 ± 1%. Fluorescence in situ hybridization (FISH analysis revealed a relative high abundance of Geobacter species (ca. 20%, and clearly showed a natural microbial stratification. Interestingly, the Geobacter cluster was highly enriched in the innermost layers of the biofilm (thickness of 10 μm, which were in contact with the electroconductive particles of bed, whereas the rest of bacteria were located in the outermost layers. To our knowledge, this is the first time that such a clear microbial stratification has been observed on an anode-respiring biofilm. Our results revealed the relevant role of Geobacter in switching between the electrode and other microbial communities performing metabolic reactions in the outermost environment of the biofilm.

Geobacter daltonii sp. nov., an Fe(III)- and uranium(VI)-reducing bacterium isolated from a shallow subsurface exposed to mixed heavy metal and hydrocarbon contamination.

Science.gov (United States)

Prakash, Om; Gihring, Thomas M; Dalton, Dava D; Chin, Kuk-Jeong; Green, Stefan J; Akob, Denise M; Wanger, Greg; Kostka, Joel E

2010-03-01

An Fe(III)- and uranium(VI)-reducing bacterium, designated strain FRC-32(T), was isolated from a contaminated subsurface of the USA Department of Energy Oak Ridge Field Research Center (ORFRC) in Oak Ridge, Tennessee, where the sediments are exposed to mixed waste contamination of radionuclides and hydrocarbons. Analyses of both 16S rRNA gene and the Geobacteraceae-specific citrate synthase (gltA) mRNA gene sequences retrieved from ORFRC sediments indicated that this strain was abundant and active in ORFRC subsurface sediments undergoing uranium(VI) bioremediation. The organism belonged to the subsurface clade of the genus Geobacter and shared 92-98 % 16S rRNA gene and 75-81 % rpoB gene sequence similarities with other recognized species of the genus. In comparison to its closest relative, Geobacter uraniireducens Rf4(T), according to 16S rRNA gene sequence similarity, strain FRC-32(T) showed a DNA-DNA relatedness value of 21 %. Cells of strain FRC-32(T) were Gram-negative, non-spore-forming, curved rods, 1.0-1.5 microm long and 0.3-0.5 microm in diameter; the cells formed pink colonies in a semisolid cultivation medium, a characteristic feature of the genus Geobacter. The isolate was an obligate anaerobe, had temperature and pH optima for growth at 30 degrees C and pH 6.7-7.3, respectively, and could tolerate up to 0.7 % NaCl although growth was better in the absence of NaCl. Similar to other members of the Geobacter group, strain FRC-32(T) conserved energy for growth from the respiration of Fe(III)-oxyhydroxide coupled with the oxidation of acetate. Strain FRC-32(T) was metabolically versatile and, unlike its closest relative, G. uraniireducens, was capable of utilizing formate, butyrate and butanol as electron donors and soluble ferric iron (as ferric citrate) and elemental sulfur as electron acceptors. Growth on aromatic compounds including benzoate and toluene was predicted from preliminary genomic analyses and was confirmed through successive transfer with

Microbial Fuel Cells; Microbiele Fuel Cells

Energy Technology Data Exchange (ETDEWEB)

Louzada, K.

2012-03-15

Geobacter bacteria are able to transfer electrons to their environment and have a recovering effect on the environment. The US Office for Naval research (ONR) is conducting research on the application of bacteria in the development of natural batteries for under water applications such as lighting, chemical sensors, hydrophones and autonomous vehicles. [Dutch] Geobacter bacterien zijn in staat zijn om elektronen over te dragen aan hun omgeving en hebben een herstellende invloed op het milieu. Het US Office for Naval Research (ONR) voert onderzoek uit naar de toepassingen van de bacterien in de ontwikkeling van natuurlijke batterijen voor onderwater applicaties als verlichting, chemische sensoren, hydrofonen en autonome voertuigen.

Probing Single- to Multi-Cell Level Charge Transport in Geobacter sulfurreducens DL-1

Science.gov (United States)

2013-11-08

cell was housed in a Faraday cage , yielding a noise level of o40 fA. All experiments were performed with more than 20 independent measurements across...indicated by purple arrow in Fig. 3a) after recording the stable baseline. To minimize the effect of external voltages and non-invasively probe the

Convergent development of anodic bacterial communities in microbial fuel cells.

KAUST Repository

Yates, Matthew D

2012-05-10

Microbial fuel cells (MFCs) are often inoculated from a single wastewater source. The extent that the inoculum affects community development or power production is unknown. The stable anodic microbial communities in MFCs were examined using three inocula: a wastewater treatment plant sample known to produce consistent power densities, a second wastewater treatment plant sample, and an anaerobic bog sediment. The bog-inoculated MFCs initially produced higher power densities than the wastewater-inoculated MFCs, but after 20 cycles all MFCs on average converged to similar voltages (470±20 mV) and maximum power densities (590±170 mW m(-2)). The power output from replicate bog-inoculated MFCs was not significantly different, but one wastewater-inoculated MFC (UAJA3 (UAJA, University Area Joint Authority Wastewater Treatment Plant)) produced substantially less power. Denaturing gradient gel electrophoresis profiling showed a stable exoelectrogenic biofilm community in all samples after 11 cycles. After 16 cycles the predominance of Geobacter spp. in anode communities was identified using 16S rRNA gene clone libraries (58±10%), fluorescent in-situ hybridization (FISH) (63±6%) and pyrosequencing (81±4%). While the clone library analysis for the underperforming UAJA3 had a significantly lower percentage of Geobacter spp. sequences (36%), suggesting that a predominance of this microbe was needed for convergent power densities, the lower percentage of this species was not verified by FISH or pyrosequencing analyses. These results show that the predominance of Geobacter spp. in acetate-fed systems was consistent with good MFC performance and independent of the inoculum source.

Genomic and microarray analysis of aromatics degradation in Geobacter metallireducens and comparison to a Geobacter isolate from a contaminated field site

Directory of Open Access Journals (Sweden)

Zhou Jizhong

2007-06-01

Full Text Available Abstract Background Groundwater and subsurface environments contaminated with aromatic compounds can be remediated in situ by Geobacter species that couple oxidation of these compounds to reduction of Fe(III-oxides. Geobacter metallireducens metabolizes many aromatic compounds, but the enzymes involved are not well known. Results The complete G. metallireducens genome contained a 300 kb island predicted to encode enzymes for the degradation of phenol, p-cresol, 4-hydroxybenzaldehyde, 4-hydroxybenzoate, benzyl alcohol, benzaldehyde, and benzoate. Toluene degradation genes were encoded in a separate region. None of these genes was found in closely related species that cannot degrade aromatic compounds. Abundant transposons and phage-like genes in the island suggest mobility, but nucleotide composition and lack of synteny with other species do not suggest a recent transfer. The inferred degradation pathways are similar to those in species that anaerobically oxidize aromatic compounds with nitrate as an electron acceptor. In these pathways the aromatic compounds are converted to benzoyl-CoA and then to 3-hydroxypimelyl-CoA. However, in G. metallireducens there were no genes for the energetically-expensive dearomatizing enzyme. Whole-genome changes in transcript levels were identified in cells oxidizing benzoate. These supported the predicted pathway, identified induced fatty-acid oxidation genes, and identified an apparent shift in the TCA cycle to a putative ATP-yielding succinyl-CoA synthase. Paralogs to several genes in the pathway were also induced, as were several putative molybdo-proteins. Comparison of the aromatics degradation pathway genes to the genome of an isolate from a contaminated field site showed very similar content, and suggested this strain degrades many of the same compounds. This strain also lacked a classical dearomatizing enzyme, but contained two copies of an eight-gene cluster encoding redox proteins that was 30-fold

Spatial distribution of bacterial communities on volumetric and planar anodes in single-chamber air-cathode microbial fuel cells

KAUST Repository

Vargas, Ignacio T.

2013-05-29

Pyrosequencing was used to characterize bacterial communities in air-cathode microbial fuel cells across a volumetric (graphite fiber brush) and a planar (carbon cloth) anode, where different physical and chemical gradients would be expected associated with the distance between anode location and the air cathode. As expected, the stable operational voltage and the coulombic efficiency (CE) were higher for the volumetric anode than the planar anode (0.57V and CE=22% vs. 0.51V and CE=12%). The genus Geobacter was the only known exoelectrogen among the observed dominant groups, comprising 57±4% of recovered sequences for the brush and 27±5% for the carbon-cloth anode. While the bacterial communities differed between the two anode materials, results showed that Geobacter spp. and other dominant bacterial groups were homogenously distributed across both planar and volumetric anodes. This lends support to previous community analysis interpretations based on a single biofilm sampling location in these systems. © 2013 Wiley Periodicals, Inc.

Quantifying Temporal Autocorrelations for the Expression of Geobacter species mRNA Gene Transcripts at Variable Ammonium Levels during in situ U(VI) Bioremediation

Science.gov (United States)

Mouser, P. J.

2010-12-01

In order to develop decision-making tools for the prediction and optimization of subsurface bioremediation strategies, we must be able to link the molecular-scale activity of microorganisms involved in remediation processes with biogeochemical processes observed at the field-scale. This requires the ability to quantify changes in the in situ metabolic condition of dominant microbes and associate these changes to fluctuations in nutrient levels throughout the bioremediation process. It also necessitates a need to understand the spatiotemporal variability of the molecular-scale information to develop meaningful parameters and constraint ranges in complex bio-physio-chemical models. The expression of three Geobacter species genes (ammonium transporter (amtB), nitrogen fixation (nifD), and a housekeeping gene (recA)) were tracked at two monitoring locations that differed significantly in ammonium (NH4+) concentrations during a field-scale experiment where acetate was injected into the subsurface to simulate Geobacteraceae in a uranium-contaminated aquifer. Analysis of amtB and nifD mRNA transcript levels indicated that NH4+ was the primary form of fixed nitrogen during bioremediation. Overall expression levels of amtB were on average 8-fold higher at NH4+ concentrations of 300 μM or more than at lower NH4+ levels (average 60 μM). The degree of temporal correlation in Geobacter species mRNA expression levels was calculated at both locations using autocorrelation methods that describe the relationship between sample semi-variance and time lag. At the monitoring location with lower NH4+, a temporal correlation lag of 8 days was observed for both amtB and nifD transcript patterns. At the location where higher NH4+ levels were observed, no discernable temporal correlation lag above the sampling frequency (approximately every 2 days) was observed for amtB or nifD transcript fluctuations. Autocorrelation trends in recA expression levels at both locations indicated that

From Nanowires to Biofilms: An Exploration of Novel Mechanisms of Uranium Transformation Mediated by Geobacter Bacteria

Energy Technology Data Exchange (ETDEWEB)

REGUERA, GEMMA [Michigan State University

2014-01-16

One promising strategy for the in situ bioremediation of radioactive groundwater contaminants that has been identified by the SBR Program is to stimulate the activity of dissimilatory metal-reducing microorganisms to reductively precipitate uranium and other soluble toxic metals. The reduction of U(VI) and other soluble contaminants by Geobacteraceae is directly dependent on the reduction of Fe(III) oxides, their natural electron acceptor, a process that requires the expression of Geobacter’s conductive pili (pilus nanowires). Expression of conductive pili by Geobacter cells leads to biofilm development on surfaces and to the formation of suspended biogranules, which may be physiological closer to biofilms than to planktonic cells. Biofilm development is often assumed in the subsurface, particularly at the matrix-well screen interface, but evidence of biofilms in the bulk aquifer matrix is scarce. Our preliminary results suggest, however, that biofilms develop in the subsurface and contribute to uranium transformations via sorption and reductive mechanisms. In this project we elucidated the mechanism(s) for uranium immobilization mediated by Geobacter biofilms and identified molecular markers to investigate if biofilm development is happening in the contaminated subsurface. The results provided novel insights needed in order to understand the metabolic potential and physiology of microorganisms with a known role in contaminant transformation in situ, thus having a significant positive impact in the SBR Program and providing novel concept to monitor, model, and predict biological behavior during in situ treatments.

Electromicrobiology of Dissimilatory Sulfur Reducing Bacterium Desulfuromonas acetexigens

KAUST Repository

Bin Bandar, Khaled

2014-12-01

Bioelectrochmical systems (BES) are engineered electrochemical devices that harness hidden chemical energy of the wastewater in to the form of electricity or hydrogen. Unique microbial communities enrich in these systems for oxidation of organic matter as well as transfer of resulted electron to anode, known them as “electricigens” communities. Exploring novel electricigenesis microbial communities in the nature and understanding their electromicrobiology is one the important aspect for BES systems scale up. Herein, we report first time the electricigenesis property of an anaerobic, fresh water sediment, sulfur reducing bacterium Desulfuromona acetexigens. The electrochemical behavior of D. acetexigens biofilms grown on graphite-rod electrodes in batch-fed mode under an applied potential was investigated with traditional electroanalytical tools, and correlate the electron transfer from biofilms to electrode with a model electricigen Geobacter sulfurreducens electrochemical behavior. Research findings suggest that D. acetexigens has the ability to use electrode as electron acceptor in BES systems through establishing the direct contact with anode by expressing the membrane bound redox proteins, but not due to the secretion of soluble redox mediators. Preliminary results revealed that D. acetexigens express three distinct redox proteins in their membranes for turnover of the electrons from biofilm to electrode, and the 4 whole electricigenesis process observed to be unique in the D. acetexigens compared to that of well-studied model organism G. sulfurreducens.

Role of U(VI) adsorption in U(VI) Reduction by Geobacter species

International Nuclear Information System (INIS)

Lovely, Derrick

2008-01-01

Previous work had suggested that Acholeplasma palmae has a higher capacity for uranium sorption than other bacteria studied. Sorption studies were performed with cells in suspension in various solutions containing uranium, and results were used to generate uranium-biosorption isotherms. Results from this study showed that the U(VI) sorption capacity of G. uraniireducens was relatively similar in simple solutions, such as sodium chloride or bicarbonate. However, this ability to sorb uranium significantly decreased in groundwater. This suggested that certain chemicals present in the groundwater were inhibiting the ability of cell components of Geobacter to adsorb uranium. It was hypothesized that uranium removal would also be diminished in the bicarbonate solution. However, this did not seem to be the case, as uranium was as easily removed in the bicarbonate solution as in the sodium chloride solution.

Sustainable resource recovery and energy conversion processes using microbial electrochemical technologies

Science.gov (United States)

Yates, Matthew D.

Microbial Electrochemical Technologies (METs) are emerging technological platforms for the conversion of waste into usable products. METs utilize naturally occurring bacteria, called exoelectrogens, capable of transferring electrons to insoluble terminal electron acceptors. Electron transfer processes in the exoelectrogen Geobacter sulfurreducens were exploited here to develop sustainable processes for synthesis of industrially and socially relevant end products. The first process examined was the removal of soluble metals from solution to form catalytic nanoparticles and nanoporous structures. The second process examined was the biocatalytic conversion of electrons into hydrogen gas using electrons supplied directly to an electrode. Nanoparticle formation is desirable because materials on the nanoscale possess different physical, optical, electronic, and mechanical properties compared to bulk materials. In the first process, soluble palladium was used to form catalytic palladium nanoparticles using extracellular electron transfer (EET) processes of G. sulfurreducens, typically the dominant member of mixedculture METs. Geobacter cells reduced the palladium extracellularly using naturally produced pili, which provided extracellular adsorption and reduction sites to help delay the diffusion of soluble metals into the cell. The extracellular reduction prevented cell inactivation due to formation of intracellular particles, and therefore the cells could be reused in multiple palladium reduction cycles. A G. sulfurreducens biofilm was next investigated as a biotemplate for the formation of a nanoporous catalytic palladium structure. G. sulfurreducens biofilms have a dense network of pili and extracellular cytochromes capable of high rates of electron transfer directly to an electrode surface. These pili and cytochromes provide a dense number of reduction sites for nanoparticle formation without the need for any synthetic components. The cells within the biofilm also can

Metagenomic analyses reveal the involvement of syntrophic consortia in methanol/electricity conversion in microbial fuel cells.

Science.gov (United States)

Yamamuro, Ayaka; Kouzuma, Atsushi; Abe, Takashi; Watanabe, Kazuya

2014-01-01

Methanol is widely used in industrial processes, and as such, is discharged in large quantities in wastewater. Microbial fuel cells (MFCs) have the potential to recover electric energy from organic pollutants in wastewater; however, the use of MFCs to generate electricity from methanol has not been reported. In the present study, we developed single-chamber MFCs that generated electricity from methanol at the maximum power density of 220 mW m(-2) (based on the projected area of the anode). In order to reveal how microbes generate electricity from methanol, pyrosequencing of 16S rRNA-gene amplicons and Illumina shotgun sequencing of metagenome were conducted. The pyrosequencing detected in abundance Dysgonomonas, Sporomusa, and Desulfovibrio in the electrolyte and anode and cathode biofilms, while Geobacter was detected only in the anode biofilm. Based on known physiological properties of these bacteria, it is considered that Sporomusa converts methanol into acetate, which is then utilized by Geobacter to generate electricity. This speculation is supported by results of shotgun metagenomics of the anode-biofilm microbes, which reconstructed relevant catabolic pathways in these bacteria. These results suggest that methanol is anaerobically catabolized by syntrophic bacterial consortia with electrodes as electron acceptors.

Final Report Systems Level Analysis of the Function and Adaptive Responses of Methanogenic Consortia

Energy Technology Data Exchange (ETDEWEB)

Lovley, Derek R. [Univ. of Massachusetts, Amherst, MA (United States)

2015-03-09

The purpose of this research was to determine whether the syntrophic microbial associations that are central to the functioning of methane-producing terrestrial wetlands can be predictively modeled with coupled multi-species genome-scale metabolic models. Such models are important because methane is an important greenhouse gas and there is a need to predictively model how the methane-producing microbial communities will respond to environmental perturbations, such as global climate change. The research discovered that the most prodigious methane-producing microorganisms on earth participate in a previously unrecognized form of energy exchange. The methane-producers Methanosaeta and Methanosarcina forge biological electrical connections with other microbes in order to obtain electrons to reduce carbon dioxide to methane. This direct interspecies electron transfer (DIET) was demonstrated in complex microbial communities as well as in defined co-cultures. For example, metatranscriptomic analysis of gene expression in both natural communities and defined co-cultures demonstrated that Methanosaeta species highly expressed genes for the enzymes for the reduction of carbon dioxide to methane. Furthermore, Methanosaeta’s electron-donating partners highly expressed genes for the biological electrical connections known as microbial nanowires. A series of studies involving transcriptomics, genome resequencing, and analysis of the metabolism of a series of strains with targeted gene deletions, further elucidated the mechanisms and energetics of DIET in methane-producing co-cultures, as well as in a co-culture of Geobacter metallireducens and Geobacter sulfurreducens, which provided a system for studying DIET with two genetically tractable partners. Genome-scale modeling of DIET in the G. metallireducens/G. sulfurreducens co-culture suggested that DIET provides more energy to the electron-donating partner that electron exchange via interspecies hydrogen transfer, but that the

Identification of genes specifically required for the anaerobic metabolism of benzene in Geobacter metallireducens

DEFF Research Database (Denmark)

Zhang, Tian; Tremblay, Pier-Luc; Chaurasia, Akhilesh Kumar

2014-01-01

Although the biochemical pathways for the anaerobic degradation of many of the hydrocarbon constituents in petroleum reservoirs have been elucidated, the mechanisms for anaerobic activation of benzene, a very stable molecule, are not known. Previous studies have demonstrated that Geobacter...... metallireducens can anaerobically oxidize benzene to carbon dioxide with Fe(III) as the sole electron acceptor and that phenol is an intermediate in benzene oxidation. In an attempt to identify enzymes that might be involved in the conversion of benzene to phenol, whole-genome gene transcript abundance...... was compared in cells metabolizing benzene and cells metabolizing phenol. Eleven genes had significantly higher transcript abundance in benzene-metabolizing cells. Five of these genes had annotations suggesting that they did not encode proteins that could be involved in benzene metabolism and were not further...

Comparative Metagenomic Analysis of Electrogenic Microbial Communities in Differentially Inoculated Swine Wastewater-Fed Microbial Fuel Cells

Directory of Open Access Journals (Sweden)

Irina V. Khilyas

2017-01-01

Full Text Available Bioelectrochemical systems such as microbial fuel cells (MFCs are promising new technologies for efficient removal of organic compounds from industrial wastewaters, including that generated from swine farming. We inoculated two pairs of laboratory-scale MFCs with sludge granules from a beer wastewater-treating anaerobic digester (IGBS or from sludge taken from the bottom of a tank receiving swine wastewater (SS. The SS-inoculated MFC outperformed the IGBS-inoculated MFC with regard to COD and VFA removal and electricity production. Using a metagenomic approach, we describe the microbial diversity of the MFC planktonic and anodic communities derived from the different inocula. Proteobacteria (mostly Deltaproteobacteria became the predominant phylum in both MFC anodic communities with amplification of the electrogenic genus Geobacter being the most pronounced. Eight dominant and three minor species of Geobacter were found in both MFC anodic communities. The anodic communities of the SS-inoculated MFCs had a higher proportion of Clostridium and Bacteroides relative to those of the IGBS-inoculated MFCs, which were enriched with Pelobacter. The archaeal populations of the SS- and IGBS-inoculated MFCs were dominated by Methanosarcina barkeri and Methanothermobacter thermautotrophicus, respectively. Our results show a long-term influence of inoculum type on the performance and microbial community composition of swine wastewater-treating MFCs.

Metagenomic analyses reveal the involvement of syntrophic consortia in methanol/electricity conversion in microbial fuel cells.

Directory of Open Access Journals (Sweden)

Ayaka Yamamuro

Full Text Available Methanol is widely used in industrial processes, and as such, is discharged in large quantities in wastewater. Microbial fuel cells (MFCs have the potential to recover electric energy from organic pollutants in wastewater; however, the use of MFCs to generate electricity from methanol has not been reported. In the present study, we developed single-chamber MFCs that generated electricity from methanol at the maximum power density of 220 mW m(-2 (based on the projected area of the anode. In order to reveal how microbes generate electricity from methanol, pyrosequencing of 16S rRNA-gene amplicons and Illumina shotgun sequencing of metagenome were conducted. The pyrosequencing detected in abundance Dysgonomonas, Sporomusa, and Desulfovibrio in the electrolyte and anode and cathode biofilms, while Geobacter was detected only in the anode biofilm. Based on known physiological properties of these bacteria, it is considered that Sporomusa converts methanol into acetate, which is then utilized by Geobacter to generate electricity. This speculation is supported by results of shotgun metagenomics of the anode-biofilm microbes, which reconstructed relevant catabolic pathways in these bacteria. These results suggest that methanol is anaerobically catabolized by syntrophic bacterial consortia with electrodes as electron acceptors.

Current generation in microbial electrolysis cells with addition of amorphous ferric hydroxide, Tween 80, or DNA

KAUST Repository

Ren, Lijiao

2012-11-01

Iron-oxide nanoparticles and the Tween 80 have previously been shown to improve power generation in microbial fuel cells (MFCs), presumably by improving electron transfer from the bacteria to the anode. We examined whether several chemicals would affect current production in single-chamber microbial electrolysis cells (MECs), where hydrogen gas is produced at the cathode, using mixed cultures and Geobacter sulfurreducens. Tween 80 did not increase the current. Fe(OH) 3 addition increased the maximum current density of both the mixed cultures (from 6.1 ± 0.9 A/m 2 to 8.8 ± 0.3 A/m 2) and pure cultures (from 4.8 ± 0.5 A/m 2 to 7.4 ± 1.1 A/m 2). Improved current production was sustained even after iron was no longer added to the medium. It was demonstrated that increased current resulted from improved cathode performance. Analysis using electrochemical impedance spectroscopy (EIS) showed that the iron primarily reduced the diffusion resistances of the cathodes, and scanning electron microscopy (SEM) images showed the formation of highly porous structures on the cathode. The addition of DNA also did not improve MEC or MFC performance. These results demonstrated that among these treatments only Fe(OH) 3 addition was a viable method for enhancing current densities in MECs, primarily by improving cathode performance. Copyright © 2012, Hydrogen Energy Publications, LLC. Published by Elsevier Ltd. All rights.

Microbial transformations of actinides in the environment

Energy Technology Data Exchange (ETDEWEB)

Livens, F R [Centre for Radiochemistry Research, School of Chemistry, University of Manchester, Oxford Road, Manchester M13 9PL (United Kingdom); Al-Bokari, M [Institute of Atomic Energy Research, King Abdulaziz City for Science and Technology, P. O. Box 6086, Riyadh 11442 (Saudi Arabia); Fomina, M; Gadd, G M [College of Life Sciences, University of Dundee, Dundee DD1 5EH (United Kingdom); Geissler, A; Lloyd, J R; Vaughan, D J [School of Earth, Atmospheric and Environmental Sciences, and Williamson Research Centre for Molecular Environmental Science, University of Manchester, Oxford Road, Manchester M13 9PL (United Kingdom); Renshaw, J C, E-mail: francis.livens@manchester.ac.uk [School of Geography, Earth and Environmental Sciences, University of Birmingham, Edgbaston, Birmingham, B15 2TT (United Kingdom)

2010-03-15

The diversity of microorganisms is still far from understood, although many examples of the microbial biotransformation of stable, pollutant and radioactive elements, involving Bacteria, Archaea and Fungi, are known. In estuarine sediments from the Irish Sea basin, which have been labelled by low level effluent discharges, there is evidence of an annual cycle in Pu solubility, and microcosm experiments have demonstrated both shifts in the bacterial community and changes in Pu solubility as a result of changes in redox conditions. In the laboratory, redox transformation of both U and Pu by Geobacter sulfurreducens has been demonstrated and EXAFS spectroscopy has been used to understand the inability of G. sufurreducens to reduce Np(V). Fungi promote corrosion of metallic U alloy through production of a range of carboxylic acid metabolites, and are capable of translocating the dissolved U before precipitating it externally to the hyphae, as U(VI) phosphate phases. These examples illustrate the far-reaching but complex effects which microorganisms can have on actinide behaviour.

Use of atomic force microscopy and transmission electron microscopy for correlative studies of bacterial capsules.

Science.gov (United States)

Stukalov, Oleg; Korenevsky, Anton; Beveridge, Terry J; Dutcher, John R

2008-09-01

Bacteria can possess an outermost assembly of polysaccharide molecules, a capsule, which is attached to their cell wall. We have used two complementary, high-resolution microscopy techniques, atomic force microscopy (AFM) and transmission electron microscopy (TEM), to study bacterial capsules of four different gram-negative bacterial strains: Escherichia coli K30, Pseudomonas aeruginosa FRD1, Shewanella oneidensis MR-4, and Geobacter sulfurreducens PCA. TEM analysis of bacterial cells using different preparative techniques (whole-cell mounts, conventional embeddings, and freeze-substitution) revealed capsules for some but not all of the strains. In contrast, the use of AFM allowed the unambiguous identification of the presence of capsules on all strains used in the present study, including those that were shown by TEM to be not encapsulated. In addition, the use of AFM phase imaging allowed the visualization of the bacterial cell within the capsule, with a depth sensitivity that decreased with increasing tapping frequency.

The performance of a thermophilic microbial fuel cell fed with synthesis gas.

Science.gov (United States)

Hussain, A; Mehta, P; Raghavan, V; Wang, H; Guiot, S R; Tartakovsky, B

2012-08-10

This study demonstrated electricity generation in a thermophilic microbial fuel cell (MFC) operated on synthesis gas (syngas) as the sole electron donor. At 50°C, a volumetric power output of 30-35 mWL(R)(-1) and a syngas conversion efficiency of 87-98% was achieved. The observed pathway of syngas conversion to electricity primarily consisted of a two-step process, where the carbon monoxide and hydrogen were first converted to acetate, which was then consumed by the anodophilic bacteria to produce electricity. A denaturing gradient gel electrophoresis (DGGE) analysis of the 16S rDNA revealed the presence of Geobacter species, Acetobacter, methanogens and several uncultured bacteria and archaea in the anodic chamber. Crown Copyright © 2012. Published by Elsevier Inc. All rights reserved.

Multiple paths of electron flow to current in microbial electrolysis cells fed with low and high concentrations of propionate

KAUST Repository

Rao, Hari Ananda

2016-03-03

Microbial electrolysis cells (MECs) provide a viable approach for bioenergy generation from fermentable substrates such as propionate. However, the paths of electron flow during propionate oxidation in the anode of MECs are unknown. Here, the paths of electron flow involved in propionate oxidation in the anode of two-chambered MECs were examined at low (4.5 mM) and high (36 mM) propionate concentrations. Electron mass balances and microbial community analysis revealed that multiple paths of electron flow (via acetate/H2 or acetate/formate) to current could occur simultaneously during propionate oxidation regardless of the concentration tested. Current (57–96 %) was the largest electron sink and methane (0–2.3 %) production was relatively unimportant at both concentrations based on electron balances. At a low propionate concentration, reactors supplemented with 2-bromoethanesulfonate had slightly higher coulombic efficiencies than reactors lacking this methanogenesis inhibitor. However, an opposite trend was observed at high propionate concentration, where reactors supplemented with 2-bromoethanesulfonate had a lower coulombic efficiency and there was a greater percentage of electron loss (23.5 %) to undefined sinks compared to reactors without 2-bromoethanesulfonate (11.2 %). Propionate removal efficiencies were 98 % (low propionate concentration) and 78 % (high propionate concentration). Analysis of 16S rRNA gene pyrosequencing revealed the dominance of sequences most similar to Geobacter sulfurreducens PCA and G. sulfurreducens subsp. ethanolicus. Collectively, these results provide new insights on the paths of electron flow during propionate oxidation in the anode of MECs fed with low and high propionate concentrations.

Diversity and function of the microbial community on anodes of sediment microbial fuel cells fueled by root exudates

Energy Technology Data Exchange (ETDEWEB)

Cabezas da Rosa, Angela

2010-11-26

Anode microbial communities are essential for current production in microbial fuel cells. Anode reducing bacteria are capable of using the anode as final electron acceptor in their respiratory chain. The electrons delivered to the anode travel through a circuit to the cathode where they reduce oxygen to water generating an electric current. A novel type of sediment microbial fuel cell (SMFC) harvest energy from photosynthetically derived compounds released through the roots. Nothing is known about anode microbial communities of this type of microbial fuel cell. This work consists of three parts. The first part focuses on the study of bacterial and archaeal community compositions on anodes of SMFCs fueled by rice root exudates. By using terminal restriction fragment length polymorphism (T-RFLP), a profiling technique, and cloning / sequencing of 16S rRNA, we determined that the support type used for the plant (vermiculite, potting soil or rice field soil) is an important factor determining the composition of the microbial community. Finally, by comparing microbial communities of current producing anodes and non-current producing controls we determined that Desulfobulbus- and Geobacter-related populations were probably most important for current production in potting soil and rice field soil SMFCs, respectively. However, {delta}-proteobacterial Anaeromyxobacter spp., unclassified {delta}-proteobacteria and Anaerolineae were also part of the anode biofilm in rice field soil SMFCs and these populations might also play a role in current production. Moreover, distinct clusters of Geobacter and Anaeromyxobacter populations were stimulated by rice root exudates. Regarding Archaea, uncultured Euryarchaea were abundant on anodes of potting soil SMFCs indicating a potential role in current production. In both, rice field soil and potting soil SMFCs, a decrease of Methanosaeta, an acetotrophic methanogen, was detected on current producing anodes. In the second part we focused

A method for high throughput bioelectrochemical research based on small scale microbial electrolysis cells

KAUST Repository

Call, Douglas F.

2011-07-01

There is great interest in studying exoelectrogenic microorganisms, but existing methods can require expensive electrochemical equipment and specialized reactors. We developed a simple system for conducting high throughput bioelectrochemical research using multiple inexpensive microbial electrolysis cells (MECs) built with commercially available materials and operated using a single power source. MECs were small crimp top serum bottles (5mL) with a graphite plate anode (92m 2/m 3) and a cathode of stainless steel (SS) mesh (86m 2/m 3), graphite plate, SS wire, or platinum wire. The highest volumetric current density (240A/m 3, applied potential of 0.7V) was obtained using a SS mesh cathode and a wastewater inoculum (acetate electron donor). Parallel operated MECs (single power source) did not lead to differences in performance compared to non-parallel operated MECs, which can allow for high throughput reactor operation (>1000 reactors) using a single power supply. The utility of this method for cultivating exoelectrogenic microorganisms was demonstrated through comparison of buffer effects on pure (Geobacter sulfurreducens and Geobacter metallireducens) and mixed cultures. Mixed cultures produced current densities equal to or higher than pure cultures in the different media, and current densities for all cultures were higher using a 50mM phosphate buffer than a 30mM bicarbonate buffer. Only the mixed culture was capable of sustained current generation with a 200mM phosphate buffer. These results demonstrate the usefulness of this inexpensive method for conducting in-depth examinations of pure and mixed exoelectrogenic cultures. © 2011 Elsevier B.V.

Adaptation of the Biolog Phenotype MicroArrayTM Technology to Profile the Obligate Anaerobe Geobacter metallireducens

Energy Technology Data Exchange (ETDEWEB)

Joyner, Dominique; Fortney, Julian; Chakraborty, Romy; Hazen, Terry

2010-05-17

The Biolog OmniLog? Phenotype MicroArray (PM) plate technology was successfully adapted to generate a select phenotypic profile of the strict anaerobe Geobacter metallireducens (G.m.). The profile generated for G.m. provides insight into the chemical sensitivity of the organism as well as some of its metabolic capabilities when grown with a basal medium containing acetate and Fe(III). The PM technology was developed for aerobic organisms. The reduction of a tetrazolium dye by the test organism represents metabolic activity on the array which is detected and measured by the OmniLog(R) system. We have previously adapted the technology for the anaerobic sulfate reducing bacterium Desulfovibrio vulgaris. In this work, we have taken the technology a step further by adapting it for the iron reducing obligate anaerobe Geobacter metallireducens. In an osmotic stress microarray it was determined that the organism has higher sensitivity to impermeable solutes 3-6percent KCl and 2-5percent NaNO3 that result in osmotic stress by osmosis to the cell than to permeable non-ionic solutes represented by 5-20percent ethylene glycol and 2-3percent urea. The osmotic stress microarray also includes an array of osmoprotectants and precursor molecules that were screened to identify substrates that would provide osmotic protection to NaCl stress. None of the substrates tested conferred resistance to elevated concentrations of salt. Verification studies in which G.m. was grown in defined medium amended with 100mM NaCl (MIC) and the common osmoprotectants betaine, glycine and proline supported the PM findings. Further verification was done by analysis of transcriptomic profiles of G.m. grown under 100mM NaCl stress that revealed up-regulation of genes related to degradation rather than accumulation of the above-mentioned osmoprotectants. The phenotypic profile, supported by additional analysis indicates that the accumulation of these osmoprotectants as a response to salt stress does not

Metal-like transport in proteins: A new paradigm for biological electron transfer

Science.gov (United States)

Malvankar, Nikhil; Vargas, Madeline; Tuominen, Mark; Lovley, Derek

2012-02-01

Electron flow in biologically proteins generally occurs via tunneling or hopping and the possibility of electron delocalization has long been discounted. Here we report metal-like transport in protein nanofilaments, pili, of bacteria Geobacter sulfurreducens that challenges this long-standing belief [1]. Pili exhibit conductivities comparable to synthetic organic metallic nanostructures. The temperature, magnetic field and gate-voltage dependence of pili conductivity is akin to that of quasi-1D disordered metals, suggesting a metal-insulator transition. Magnetoresistance (MR) data provide evidence for quantum interference and weak localization at room temperature, as well as a temperature and field-induced crossover from negative to positive MR. Furthermore, pili can be doped with protons. Structural studies suggest the possibility of molecular pi stacking in pili, causing electron delocalization. Reducing the disorder increases the metallic nature of pili. These electronically functional proteins are a new class of electrically conductive biological proteins that can be used to generate future generation of inexpensive and environmentally-sustainable nanomaterials and nanolectronic devices such as transistors and supercapacitors. [1] Malvankar et al. Nature Nanotechnology, 6, 573-579 (2011)

Microbial community composition is unaffected by anode potential

KAUST Repository

Zhu, Xiuping

2014-01-21

There is great controversy on how different set anode potentials affect the performance of a bioelectrochemical system (BES). It is often reported that more positive potentials improve acclimation and performance of exoelectrogenic biofilms, and alter microbial community structure, while in other studies relatively more negative potentials were needed to achieve higher current densities. To address this issue, the biomass, electroactivity, and community structure of anodic biofilms were examined over a wide range of set anode potentials (-0.25, -0.09, 0.21, 0.51, and 0.81 V vs a standard hydrogen electrode, SHE) in single-chamber microbial electrolysis cells. Maximum currents produced using a wastewater inoculum increased with anode potentials in the range of -0.25 to 0.21 V, but decreased at 0.51 and 0.81 V. The maximum currents were positively correlated with increasing biofilm biomass. Pyrosequencing indicated biofilm communities were all similar and dominated by bacteria most similar to Geobacter sulfurreducens. Differences in anode performance with various set potentials suggest that the exoelectrogenic communities self-regulate their exocellular electron transfer pathways to adapt to different anode potentials. © 2013 American Chemical Society.

Microbial interspecies electron transfer via electric currents through conductive minerals

Science.gov (United States)

Kato, Souichiro; Hashimoto, Kazuhito; Watanabe, Kazuya

2012-01-01

In anaerobic biota, reducing equivalents (electrons) are transferred between different species of microbes [interspecies electron transfer (IET)], establishing the basis of cooperative behaviors and community functions. IET mechanisms described so far are based on diffusion of redox chemical species and/or direct contact in cell aggregates. Here, we show another possibility that IET also occurs via electric currents through natural conductive minerals. Our investigation revealed that electrically conductive magnetite nanoparticles facilitated IET from Geobacter sulfurreducens to Thiobacillus denitrificans, accomplishing acetate oxidation coupled to nitrate reduction. This two-species cooperative catabolism also occurred, albeit one order of magnitude slower, in the presence of Fe ions that worked as diffusive redox species. Semiconductive and insulating iron-oxide nanoparticles did not accelerate the cooperative catabolism. Our results suggest that microbes use conductive mineral particles as conduits of electrons, resulting in efficient IET and cooperative catabolism. Furthermore, such natural mineral conduits are considered to provide ecological advantages for users, because their investments in IET can be reduced. Given that conductive minerals are ubiquitously and abundantly present in nature, electric interactions between microbes and conductive minerals may contribute greatly to the coupling of biogeochemical reactions. PMID:22665802

Microbial community composition is unaffected by anode potential

KAUST Repository

Zhu, Xiuping; Yates, Matthew D.; Hatzell, Marta C.; Rao, Hari Ananda; Saikaly, Pascal; Logan, Bruce E.

2014-01-01

There is great controversy on how different set anode potentials affect the performance of a bioelectrochemical system (BES). It is often reported that more positive potentials improve acclimation and performance of exoelectrogenic biofilms, and alter microbial community structure, while in other studies relatively more negative potentials were needed to achieve higher current densities. To address this issue, the biomass, electroactivity, and community structure of anodic biofilms were examined over a wide range of set anode potentials (-0.25, -0.09, 0.21, 0.51, and 0.81 V vs a standard hydrogen electrode, SHE) in single-chamber microbial electrolysis cells. Maximum currents produced using a wastewater inoculum increased with anode potentials in the range of -0.25 to 0.21 V, but decreased at 0.51 and 0.81 V. The maximum currents were positively correlated with increasing biofilm biomass. Pyrosequencing indicated biofilm communities were all similar and dominated by bacteria most similar to Geobacter sulfurreducens. Differences in anode performance with various set potentials suggest that the exoelectrogenic communities self-regulate their exocellular electron transfer pathways to adapt to different anode potentials. © 2013 American Chemical Society.

Photochemical reactions between mercury (Hg) and dissolved organic matter decrease Hg bioavailability and methylation.

Science.gov (United States)

Luo, Hong-Wei; Yin, Xiangping; Jubb, Aaron M; Chen, Hongmei; Lu, Xia; Zhang, Weihua; Lin, Hui; Yu, Han-Qing; Liang, Liyuan; Sheng, Guo-Ping; Gu, Baohua

2017-01-01

Atmospheric deposition of mercury (Hg) to surface water is one of the dominant sources of Hg in aquatic environments and ultimately drives methylmercury (MeHg) toxin accumulation in fish. It is known that freshly deposited Hg is more readily methylated by microorganisms than aged or preexisting Hg; however the underlying mechanism of this process is unclear. We report that Hg bioavailability is decreased by photochemical reactions between Hg and dissolved organic matter (DOM) in water. Photo-irradiation of Hg-DOM complexes results in loss of Sn(II)-reducible (i.e. reactive) Hg and up to an 80% decrease in MeHg production by the methylating bacterium Geobacter sulfurreducens PCA. Loss of reactive Hg proceeded at a faster rate with a decrease in the Hg to DOM ratio and is attributed to the possible formation of mercury sulfide (HgS). These results suggest a new pathway of abiotic photochemical formation of HgS in surface water and provide a mechanism whereby freshly deposited Hg is readily methylated but, over time, progressively becomes less available for microbial uptake and methylation. Copyright © 2016 Elsevier Ltd. All rights reserved.

Tolerance of anaerobic bacteria to chlorinated solvents.

Science.gov (United States)

Koenig, Joanna C; Groissmeier, Kathrin D; Manefield, Mike J

2014-01-01

The aim of this research was to evaluate the effects of four chlorinated aliphatic hydrocarbons (CAHs), perchloroethene (PCE), carbon tetrachloride (CT), chloroform (CF) and 1,2-dichloroethane (1,2-DCA), on the growth of eight anaerobic bacteria: four fermentative species (Escherichia coli, Klebsiella sp., Clostridium sp. and Paenibacillus sp.) and four respiring species (Pseudomonas aeruginosa, Geobacter sulfurreducens, Shewanella oneidensis and Desulfovibrio vulgaris). Effective concentrations of solvents which inhibited growth rates by 50% (EC50) were determined. The octanol-water partition coefficient or log Po/w of a CAH proved a generally satisfactory measure of its toxicity. Most species tolerated approximately 3-fold and 10-fold higher concentrations of the two relatively more polar CAHs CF and 1,2-DCA, respectively, than the two relatively less polar compounds PCE and CT. EC50 values correlated well with growth rates observed in solvent-free cultures, with fast-growing organisms displaying higher tolerance levels. Overall, fermentative bacteria were more tolerant to CAHs than respiring species, with iron- and sulfate-reducing bacteria in particular appearing highly sensitive to CAHs. These data extend the current understanding of the impact of CAHs on a range of anaerobic bacteria, which will benefit the field of bioremediation.

Anolyte recycling enhanced bioelectricity generation of the buffer-free single-chamber air-cathode microbial fuel cell.

Science.gov (United States)

Ren, Yueping; Chen, Jinli; Shi, Yugang; Li, Xiufen; Yang, Na; Wang, Xinhua

2017-11-01

Anolyte acidification is an inevitable restriction for the bioelectricity generation of buffer-free microbial fuel cells (MFCs). In this work, acidification of the buffer-free KCl anolyte has been thoroughly eliminated through anolyte recycling. The accumulated HCO 3 - concentration in the recycled KCl anolyte was above 50mM, which played as natural buffer and elevated the anolyte pH to above 8. The maximum power density (P max ) increased from 322.9mWm -2 to 527.2mWm -2 , which is comparable with the phosphate buffered MFC. Besides Geobacter genus, the gradually increased anolyte pH and conductivity induced the growing of electrochemically active Geoalkalibacter genus, in the anode biofilm. Anolyte recycling is a feasible strategy to strengthen the self-buffering capacity of buffer-free MFCs, thoroughly eliminate the anolyte acidification and prominently enhance the electric power. Copyright © 2017 Elsevier Ltd. All rights reserved.

Graphite anode surface modification with controlled reduction of specific aryl diazonium salts for improved microbial fuel cells power output.

Science.gov (United States)

Picot, Matthieu; Lapinsonnière, Laure; Rothballer, Michael; Barrière, Frédéric

2011-10-15

Graphite electrodes were modified with reduction of aryl diazonium salts and implemented as anodes in microbial fuel cells. First, reduction of 4-aminophenyl diazonium is considered using increased coulombic charge density from 16.5 to 200 mC/cm(2). This procedure introduced aryl amine functionalities at the surface which are neutral at neutral pH. These electrodes were implemented as anodes in "H" type microbial fuel cells inoculated with waste water, acetate as the substrate and using ferricyanide reduction at the cathode and a 1000 Ω external resistance. When the microbial anode had developed, the performances of the microbial fuel cells were measured under acetate saturation conditions and compared with those of control microbial fuel cells having an unmodified graphite anode. We found that the maximum power density of microbial fuel cell first increased as a function of the extent of modification, reaching an optimum after which it decreased for higher degree of surface modification, becoming even less performing than the control microbial fuel cell. Then, the effect of the introduction of charged groups at the surface was investigated at a low degree of surface modification. It was found that negatively charged groups at the surface (carboxylate) decreased microbial fuel cell power output while the introduction of positively charged groups doubled the power output. Scanning electron microscopy revealed that the microbial anode modified with positively charged groups was covered by a dense and homogeneous biofilm. Fluorescence in situ hybridization analyses showed that this biofilm consisted to a large extent of bacteria from the known electroactive Geobacter genus. In summary, the extent of modification of the anode was found to be critical for the microbial fuel cell performance. The nature of the chemical group introduced at the electrode surface was also found to significantly affect the performance of the microbial fuel cells. The method used for

Application of a tetrazolium dye as an indicator of viability in anaerobic bacteria.

Science.gov (United States)

Bhupathiraju, V K; Hernandez, M; Landfear, D; Alvarez-Cohen, L

1999-09-01

The use of the redox dye 5-cyano-2,3,-ditolyl tetrazolium chloride (CTC) for evaluating the metabolic activity of aerobic bacteria has gained wide application in recent years. In this study, we examined the utility of CTC in capturing the metabolic activity of anaerobic bacteria. In addition, the factors contributing to abiotic reduction of CTC were also examined. CTC was used in conjunction with the fluorochrome 5-(4,6-dichlorotriazinyl) aminofluorescein (DTAF), that targets bacterial cell wall proteins, to quantitate the active fraction of total bacterial numbers. Facultative anaerobic bacteria, including Escherichia coli grown fermentatively, and Pseudomonas chlorophis, P. fluorescens, P. stutzeri, and P. pseudoalcalegenes subsp. pseudoalcalegenes grown under nitrate-reducing conditions, actively reduced CTC during all phases of growth. Greater than 95% of these cells accumulated intracellular CTC-formazan crystals during the exponential phase. Obligate anaerobic bacteria, including Syntrophus aciditrophicus grown fermentatively, Geobacter sulfurreducens grown with fumarate as the electron acceptor, Desulfovibrio desulfuricans subsp. desulfuricans and D. halophilus grown under sulfate-reducing conditions, Methanobacterium formicicum grown on formate, H2 and CO2, and Methanobacterium thermoautotrophicum grown autotrophically on H2 and CO2 all reduced CTC to intracellular CTC-formazan crystals. The optimal CTC concentration for all organisms examined was 5 mM. Anaerobic CTC incubations were not required for quantification of anaerobically grown cells. CTC-formazan production by all cultures examined was proportional to biomass production, and CTC reduction was observed even in the absence of added nutrients. CTC was reduced by culture fluids containing ferric citrate as electron acceptor following growth of either G. metallireducens or G. sulfurreducens. Abiotic reduction of CTC was observed in the presence of ascorbic acid, cysteine hydrochloride, dithiothreitol

Enhanced bioelectricity generation of air-cathode buffer-free microbial fuel cells through short-term anolyte pH adjustment.

Science.gov (United States)

Ren, Yueping; Chen, Jinli; Li, Xiufen; Yang, Na; Wang, Xinhua

2018-04-01

Short-term initial anolyte pH adjustment can relieve the performance deterioration of the single-chamber air-cathode buffer-free microbial fuel cell (BFMFC) caused by anolyte acidification. Adjusting the initial anolyte pH to 9 in 5 running cycles is the optimum strategy. The relative abundance of the electrochemically active Geobacter in the KCl-pH9-MFC anode biofilm increased from 59.01% to 75.13% after the short-term adjustment. The maximum power density (P max ) of the KCl-pH9-MFC was elevated from 316.4mW·m -2 to 511.6mW·m -2 , which was comparable with that of the PBS-MFC. And, after the short-term adjusting, new equilibrium between the anolyte pH and the anode biofilm electrochemical activity has been established in the BFMFC, which ensured the sustainability of the improved bioelectricity generation performance. Copyright © 2017 Elsevier B.V. All rights reserved.

A monetary comparison of energy recovered from microbial fuel cells and microbial electrolysis cells fed winery or domestic wastewaters

Energy Technology Data Exchange (ETDEWEB)

Cusick, Roland D.; Kiely, Patrick D.; Logan, Bruce E. [Department of Civil and Environmental Engineering, H2E Center, Penn State University, University Park, PA 16802 (United States)

2010-09-15

Microbial fuel (MFCs) and electrolysis cells (MECs) can be used to recover energy directly as electricity or hydrogen from organic matter. Organic removal efficiencies and values of the different energy products were compared for MFCs and MECs fed winery or domestic wastewater. TCOD removal (%) and energy recoveries (kWh/kg-COD) were higher for MFCs than MECs with both wastewaters. At a cost of 4.51/kg-H{sub 2} for winery wastewater and 3.01/kg-H{sub 2} for domestic wastewater, the hydrogen produced using MECs cost less than the estimated merchant value of hydrogen (6/kg-H{sub 2}). 16S rRNA clone libraries indicated the predominance of Geobacter species in anodic microbial communities in MECs for both wastewaters, suggesting low current densities were the result of substrate limitations. The results of this study show that energy recovery and organic removal from wastewater are more effective with MFCs than MECs, but that hydrogen production from wastewater fed MECs can be cost effective. (author)

Stimulation of electro-fermentation in single-chamber microbial electrolysis cells driven by genetically engineered anode biofilms

Science.gov (United States)

Awate, Bhushan; Steidl, Rebecca J.; Hamlischer, Thilo; Reguera, Gemma

2017-07-01

Unwanted metabolites produced during fermentations reduce titers and productivity and increase the cost of downstream purification of the targeted product. As a result, the economic feasibility of otherwise attractive fermentations is low. Using ethanol fermentation by the consolidated bioprocessing cellulolytic bacterium Cellulomonas uda, we demonstrate the effectiveness of anodic electro-fermentations at maximizing titers and productivity in a single-chamber microbial electrolysis cell (SCMEC) without the need for metabolic engineering of the fermentative microbe. The performance of the SCMEC platform relied on the genetic improvements of anode biofilms of the exoelectrogen Geobacter sulfurreducens that prevented the oxidation of cathodic hydrogen and improved lactate oxidation. Furthermore, a hybrid bioanode was designed that maximized the removal of organic acids in the fermentation broth. The targeted approach increased cellobiose consumption rates and ethanol titers, yields, and productivity three-fold or more, prevented pH imbalances and reduced batch-to-batch variability. In addition, the sugar substrate was fully consumed and ethanol was enriched in the broth during the electro-fermentation, simplifying its downstream purification. Such improvements and the possibility of scaling up SCMEC configurations highlight the potential of anodic electro-fermentations to stimulate fermentative bacteria beyond their natural capacity and to levels required for industrial implementation.

A biofilm microreactor system for simultaneous electrochemical and nuclear magnetic resonance techniques

International Nuclear Information System (INIS)

Renslow, Ryan S.; Babauta, Jerome T.; Majors, Paul D.; Mehta, Hardeep S.; Ewing, R. James; Ewing, Thomas; Mueller, Karl T.; Beyenal, Haluk

2014-01-01

In order to fully understand electrochemically active biofilms and the limitations to their scale-up in industrial biofilm reactors, a complete picture of the microenvironments inside the biofilm is needed. Nuclear magnetic resonance (NMR) techniques are ideally suited for the study of biofilms and for probing their microenvironments because these techniques allow for non-invasive interrogation and in situ monitoring with high resolution. By combining NMR with simultaneous electrochemical techniques, it is possible to sustain and study live electrochemically active biofilms. Here, we introduce a novel biofilm microreactor system that allows for simultaneous electrochemical and NMR techniques (EC-NMR) at the microscale. Microreactors were designed with custom radiofrequency resonator coils, which allowed for NMR measurements of biofilms growing on polarized gold electrodes. For an example application of this system, we grew Geobacter sulfurreducens biofilms. NMR was used to investigate growth media flow velocities, which were compared to simulated laminar flow, and electron donor concentrations inside the biofilms. We use Monte Carlo error analysis to estimate standard deviations of the electron donor concentration measurements within the biofilm. The EC-NMR biofilm microreactor system can ultimately be used to correlate extracellular electron transfer rates with metabolic reactions and explore extracellular electron transfer mechanisms

Flux analysis of central metabolic pathways in the Fe(III)-reducing organism Geobacter metallireducens via 13C isotopiclabeling

Energy Technology Data Exchange (ETDEWEB)

Tang, Yinjie J.; Chakraborty, Romy; Martin, Hector Garcia; Chu,Jeannie; Hazen, Terry C.; Keasling, Jay D.

2007-08-13

We analyzed the carbon fluxes in the central metabolism ofGeobacter metallireducens strain GS-15 using 13C isotopomer modeling.Acetate labeled in the 1st or 2nd position was the sole carbon source,and Fe-NTA was the sole terminal electron acceptor. The measured labeledacetate uptake rate was 21 mmol/gdw/h in the exponential growth phase.The resulting isotope labeling pattern of amino acids allowed an accuratedetermination of the in vivo global metabolic reaction rates (fluxes)through the central metabolic pathways using a computational isotopomermodel. The model indicated that over 90 percent of the acetate wascompletely oxidized to CO2 via a complete tricarboxylic acid (TCA) cyclewhile reducing iron. Pyruvate carboxylase and phosphoenolpyruvatecarboxykinase were present under these conditions, but enzymes in theglyoxylate shunt and malic enzyme were absent. Gluconeogenesis and thepentose phosphate pathway were mainly employed for biosynthesis andaccounted for less than 3 percent of total carbon consumption. The modelalso indicated surprisingly high reversibility in the reaction betweenoxoglutarate and succinate. This step operates close to the thermodynamicequilibrium possibly because succinate is synthesized via a transferasereaction, and its product, acetyl-CoA, inhibits the conversion ofoxoglutarate to succinate. These findings enable a better understandingof the relationship between genome annotation and extant metabolicpathways in G. metallireducens.

Fate of Cd during microbial Fe(III) mineral reduction by a novel and Cd-tolerant Geobacter species.

Science.gov (United States)

Muehe, E Marie; Obst, Martin; Hitchcock, Adam; Tyliszczak, Tolek; Behrens, Sebastian; Schröder, Christian; Byrne, James M; Michel, F Marc; Krämer, Ute; Kappler, Andreas

2013-12-17

Fe(III) (oxyhydr)oxides affect the mobility of contaminants in the environment by providing reactive surfaces for sorption. This includes the toxic metal cadmium (Cd), which prevails in agricultural soils and is taken up by crops. Fe(III)-reducing bacteria can mobilize such contaminants by Fe(III) mineral dissolution or immobilize them by sorption to or coprecipitation with secondary Fe minerals. To date, not much is known about the fate of Fe(III) mineral-associated Cd during microbial Fe(III) reduction. Here, we describe the isolation of a new Geobacter sp. strain Cd1 from a Cd-contaminated field site, where the strain accounts for 10(4) cells g(-1) dry soil. Strain Cd1 reduces the poorly crystalline Fe(III) oxyhydroxide ferrihydrite in the presence of at least up to 112 mg Cd L(-1). During initial microbial reduction of Cd-loaded ferrihydrite, sorbed Cd was mobilized. However, during continuous microbial Fe(III) reduction, Cd was immobilized by sorption to and/or coprecipitation within newly formed secondary minerals that contained Ca, Fe, and carbonate, implying the formation of an otavite-siderite-calcite (CdCO3-FeCO3-CaCO3) mixed mineral phase. Our data shows that microbially mediated turnover of Fe minerals affects the mobility of Cd in soils, potentially altering the dynamics of Cd uptake into food or phyto-remediating plants.

Enhanced phosphorus reduction in simulated eutrophic water: a comparative study of submerged macrophytes, sediment microbial fuel cells, and their combination.

Science.gov (United States)

Xu, Peng; Xiao, Enrong; Xu, Dan; Li, Juan; Zhang, Yi; Dai, Zhigang; Zhou, Qiaohong; Wu, Zhenbin

2018-05-01

The phosphorus reduction in water column was attempted by integrating sediment microbial fuel cells (SMFCs) with the submerged macrophyte Vallisneria spiralis. A comparative study was conducted to treat simulated water rich in phosphate with a control and three treatments: SMFC alone (SMFC), submerged macrophytes alone (macophyte), and combined macrophytes and fuel cells (M-SMFC). All treatments promoted phosphorus flux from the water column to sediments. Maximum phosphorus reduction was obtained in proportion to the highest stable phosphorus level in sediments in M-SMFC. For the initial phosphate concentrations of 0.2, 1, 2, and 4 mg/L, average phosphate values in the overlying water during four phases decreased by 33.3% (25.0%, 8.3%), 30.8% (5.1%, 17.9%), 36.5% (27.8%, 15.7%), and 36.2% (0.7%, 22.1%) for M-SMFC (macrophyte, SMFC), compared with the control. With macrophyte treatment, the obvious phosphorus release from sediments was observed during the declining period. However, such phenomenon was significantly inhibited with M-SMFC. The electrogenesis bacteria achieved stronger phosphorus adsorption and assimilation was significantly enriched on the closed-circuit anodes. The higher abundance of Geobacter and Pseudomonas in M-SMFC might in part explain the highest phosphorus reduction in the water column. M-SMFC treatment could be promising to control the phosphorus in eutrophic water bodies.

Use of Novel Reinforced Cation Exchange Membranes for Microbial Fuel Cells

International Nuclear Information System (INIS)

Kamaraj, Sathish-Kumar; Romano, Sergio Mollá; Moreno, Vicente Compañ; Poggi-Varaldo, H.M.; Solorza-Feria, O.

2015-01-01

This work has been focused on the synthesis and characterization of different blended membranes SPEEK-35PVA (Water), SPEEK-35PVA (DMAc) prepared by casting and nanofiber-reinforced proton exchange membranes Nafion-PVA-15, Nafion-PVA-23 and SPEEK/PVA-PVB. The two first reinforced membranes were made up of Nafion® polymer deposited between polyvinyl alcohol (PVA) nanofibers. The last composite membrane is considered because the PVA is a hydrophilic polymer which forms homogeneous blends with SPEEK suitable to obtain high proton conductivity, while the hydrophobic PVB can produce blends in a phase separation morphology in which very low water uptake can be found. The synthesized membranes showed an outstanding stability, high proton conductivity, and enhanced mechanical and barrier properties. The membranes were characterized in single chamber microbial fuel cells (SCMFCs) using electrochemically enriched high sodic saline hybrid H-inocula (Geobacter metallireducen, Desulfurivibrio alkaliphilus, and Marinobacter adhaerens) as biocatalyst. The best performance was obtained with Nafion-PVA-15 membrane, which achieved a maximum power density of 1053 mW/m 3 at a cell voltage of 340 mV and displayed the lowest total internal resistance (Rint ≈ 522 Ω). This result is in agreement with the low oxygen permeability and the moderate conductivity found in this kind of membranes. These results are encouraging towards obtaining high concentrated sodic saline model wastewater exploiting MFCs

Subsurface clade of Geobacteraceae that predominates in a diversity of Fe(III)-reducing subsurface environments

Science.gov (United States)

Holmes, Dawn E.; O'Neil, Regina A.; Vrionis, Helen A.; N'Guessan, Lucie A.; Ortiz-Bernad, Irene; Larrahondo, Maria J.; Adams, Lorrie A.; Ward, Joy A.; Nicoll , Julie S.; Nevin, Kelly P.; Chavan, Milind A.; Johnson, Jessica P.; Long, Philip E.; Lovely, Derek R.

2007-01-01

There are distinct differences in the physiology of Geobacter species available in pure culture. Therefore, to understand the ecology of Geobacter species in subsurface environments, it is important to know which species predominate. Clone libraries were assembled with 16S rRNA genes and transcripts amplified from three subsurface environments in which Geobacter species are known to be important members of the microbial community: (1) a uranium-contaminated aquifer located in Rifle, CO, USA undergoing in situ bioremediation; (2) an acetate-impacted aquifer that serves as an analog for the long-term acetate amendments proposed for in situ uranium bioremediation and (3) a petroleum-contaminated aquifer in which Geobacter species play a role in the oxidation of aromatic hydrocarbons coupled with the reduction of Fe(III). The majority of Geobacteraceae 16S rRNA sequences found in these environments clustered in a phylogenetically coherent subsurface clade, which also contains a number of Geobacter species isolated from subsurface environments. Concatamers constructed with 43 Geobacter genes amplified from these sites also clustered within this subsurface clade. 16S rRNA transcript and gene sequences in the sediments and groundwater at the Rifle site were highly similar, suggesting that sampling groundwater via monitoring wells can recover the most active Geobacter species. These results suggest that further study of Geobacter species in the subsurface clade is necessary to accurately model the behavior of Geobacter species during subsurface bioremediation of metal and organic contaminants.

Inhibition of bacterial U(VI) reduction by calcium

International Nuclear Information System (INIS)

Brooks, Scott C.; Fredrickson, Jim K.; Carroll, S. L.; Kennedy, David W.; Zachara, John M.; Plymale, Andrew E.; Kelly, S. D.; Kemner, K. M.; Fendorf, S.

2003-01-01

The rapid kinetics of bacterial U(VI) reduction and low solubility of uraninite (UO2,cr) make this process an attractive option for removing uranium from groundwater. Nevertheless, conditions that may promote or inhibit U(VI) reduction are not well-defined. Recent descriptions of Ca-UO2-CO3 complexes indicate that these species may dominate the aqueous speciation of U(VI) in many environments. We monitored the bacterial reduction of U(VI) in bicarbonate-buffered solution in the presence and absence of Ca. XAFS measurements confirmed the presence of a Ca-U(VI)-CO3 complex in the initial solutions containing calcium. Calcium, at millimolar concentrations (0.45-5 mM), caused a significant decrease in the rate and extent of bacterial U(VI) reduction. Both facultative (Shewanella putrefaciens strain CN32) and obligate (Desulfovibrio desulfuricans, Geobacter sulfurreducens) anaerobic bacteria were affected by the presence of calcium. Reduction of U(VI) ceased when the calculated system Eh re ached -0.046+/- 0.001 V, based on the Ca2UO2(CO3)(3) -- > UO2,cr couple. The results are consistent with the hypothesis that U is a less energetically favorable electron acceptor when the Ca-UO2-CO3 complexes are present. The results do not support Ca inhibition caused by direct interactions with the cells or with the electron donor as the reduction of fumarate or Tc(VII)O-4(-) under identical conditions was unaffected by the presence of Ca

Operational, design and microbial aspects related to power production with microbial fuel cells implemented in constructed wetlands.

Science.gov (United States)

Corbella, Clara; Guivernau, Miriam; Viñas, Marc; Puigagut, Jaume

2015-11-01

This work aimed at determining the amount of energy that can be harvested by implementing microbial fuel cells (MFC) in horizontal subsurface constructed wetlands (HSSF CWs) during the treatment of real domestic wastewater. To this aim, MFC were implemented in a pilot plant based on two HSSF CW, one fed with primary settled wastewater (Settler line) and the other fed with the effluent of a hydrolytic up-flow sludge blanket reactor (HUSB line). The eubacterial and archaeal community was profiled on wetland gravel, MFC electrodes and primary treated wastewater by means of 16S rRNA gene-based 454-pyrosequencing and qPCR of 16S rRNA and mcrA genes. Maximum current (219 mA/m(2)) and power (36 mW/m(2)) densities were obtained for the HUSB line. Power production pattern correlated well with water level fluctuations within the wetlands, whereas the type of primary treatment implemented had a significant impact on the diversity and relative abundance of eubacteria communities colonizing MFC. It is worth noticing the high predominance (13-16% of relative abundance) of one OTU belonging to Geobacter on active MFC of the HUSB line that was absent for the settler line MFC. Hence, MFC show promise for power production in constructed wetlands receiving the effluent of a HUSB reactor. Copyright © 2015 Elsevier Ltd. All rights reserved.

Pulse electromagnetic fields enhance extracellular electron transfer in magnetic bioelectrochemical systems.

Science.gov (United States)

Zhou, Huihui; Liu, Bingfeng; Wang, Qisong; Sun, Jianmin; Xie, Guojun; Ren, Nanqi; Ren, Zhiyong Jason; Xing, Defeng

2017-01-01

Microbial extracellular electron transfer (EET) is essential in driving the microbial interspecies interaction and redox reactions in bioelectrochemical systems (BESs). Magnetite (Fe 3 O 4 ) and magnetic fields (MFs) were recently reported to promote microbial EET, but the mechanisms of MFs stimulation of EET and current generation in BESs are not known. This study investigates the behavior of current generation and EET in a state-of-the-art pulse electromagnetic field (PEMF)-assisted magnetic BES (PEMF-MBES), which was equipped with magnetic carbon particle (Fe 3 O 4 @N-mC)-coated electrodes. Illumina Miseq sequencing of 16S rRNA gene amplicons was also conducted to reveal the changes of microbial communities and interactions on the anode in response to magnetic field. PEMF had significant influences on current generation. When reactors were operated in microbial fuel cell (MFC) mode with pulse electromagnetic field (PEMF-MMFCs), power densities increased by 25.3-36.0% compared with no PEMF control MFCs (PEMF-OFF-MMFCs). More interestingly, when PEMF was removed, the power density dropped by 25.7%, while when PEMF was reintroduced, the value was restored to the previous level. Illumina sequencing of 16S rRNA gene amplicon and principal component analysis (PCA) based on operational taxonomic units (OTUs) indicate that PEMFs led to the shifts in microbial community and changes in species evenness that decreased biofilm microbial diversity. Geobacter spp. were found dominant in all anode biofilms, but the relative abundance in PEMF-MMFCs (86.1-90.0%) was higher than in PEMF-OFF-MMFCs (82.5-82.7%), indicating that the magnetic field enriched Geobacter on the anode. The current generation of Geobacter -inoculated microbial electrolysis cells (MECs) presented the same change regularity, the accordingly increase or decrease corresponding with switch of PEMF, which confirmed the reversible stimulation of PEMFs on microbial electron transfer. The pulse electromagnetic

Characterization of bacterial and archaeal communities in air-cathode microbial fuel cells, open circuit and sealed-off reactors

KAUST Repository

Chehab, Noura A.

2013-06-18

A large percentage of organic fuel consumed in a microbial fuel cell (MFC) is lost as a result of oxygen transfer through the cathode. In order to understand how this oxygen transfer affects the microbial community structure, reactors were operated in duplicate using three configurations: closed circuit (CC; with current generation), open circuit (OC; no current generation), and sealed off cathodes (SO; no current, with a solid plate placed across the cathode). Most (98 %) of the chemical oxygen demand (COD) was removed during power production in the CC reactor (maximum of 640 ± 10 mW/m 2), with a low percent of substrate converted to current (coulombic efficiency of 26.5 ± 2.1 %). Sealing the cathode reduced COD removal to 7 %, but with an open cathode, there was nearly as much COD removal by the OC reactor (94.5 %) as the CC reactor. Oxygen transfer into the reactor substantially affected the composition of the microbial communities. Based on analysis of the biofilms using 16S rRNA gene pyrosequencing, microbes most similar to Geobacter were predominant on the anodes in the CC MFC (72 % of sequences), but the most abundant bacteria were Azoarcus (42 to 47 %) in the OC reactor, and Dechloromonas (17 %) in the SO reactor. Hydrogenotrophic methanogens were most predominant, with sequences most similar to Methanobacterium in the CC and SO reactor, and Methanocorpusculum in the OC reactors. These results show that oxygen leakage through the cathode substantially alters the bacterial anode communities, and that hydrogenotrophic methanogens predominate despite high concentrations of acetate. The predominant methanogens in the CC reactor most closely resembled those in the SO reactor, demonstrating that oxygen leakage alters methanogenic as well as general bacterial communities. © 2013 Springer-Verlag Berlin Heidelberg.

Characterization of bacterial and archaeal communities in air-cathode microbial fuel cells, open circuit and sealed-off reactors

KAUST Repository

Chehab, Noura A.; Li, Dong; Amy, Gary L.; Logan, Bruce E.; Saikaly, Pascal

2013-01-01

A large percentage of organic fuel consumed in a microbial fuel cell (MFC) is lost as a result of oxygen transfer through the cathode. In order to understand how this oxygen transfer affects the microbial community structure, reactors were operated in duplicate using three configurations: closed circuit (CC; with current generation), open circuit (OC; no current generation), and sealed off cathodes (SO; no current, with a solid plate placed across the cathode). Most (98 %) of the chemical oxygen demand (COD) was removed during power production in the CC reactor (maximum of 640 ± 10 mW/m 2), with a low percent of substrate converted to current (coulombic efficiency of 26.5 ± 2.1 %). Sealing the cathode reduced COD removal to 7 %, but with an open cathode, there was nearly as much COD removal by the OC reactor (94.5 %) as the CC reactor. Oxygen transfer into the reactor substantially affected the composition of the microbial communities. Based on analysis of the biofilms using 16S rRNA gene pyrosequencing, microbes most similar to Geobacter were predominant on the anodes in the CC MFC (72 % of sequences), but the most abundant bacteria were Azoarcus (42 to 47 %) in the OC reactor, and Dechloromonas (17 %) in the SO reactor. Hydrogenotrophic methanogens were most predominant, with sequences most similar to Methanobacterium in the CC and SO reactor, and Methanocorpusculum in the OC reactors. These results show that oxygen leakage through the cathode substantially alters the bacterial anode communities, and that hydrogenotrophic methanogens predominate despite high concentrations of acetate. The predominant methanogens in the CC reactor most closely resembled those in the SO reactor, demonstrating that oxygen leakage alters methanogenic as well as general bacterial communities. © 2013 Springer-Verlag Berlin Heidelberg.

ORF Sequence: NC_002939 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available eobacter sulfurreducens PCA] MRRHSNKTNPVAAGILFITLACWAGNAMGWGTSGDSRSTWGGSGSSLNLNLAFTDCAKCHTSTNNVNRHHDLITKKGKQ...CLACHTMTADNSGQYTVQVQRDCQACHTSSVHDNVQHNVSTCSRCHGSDVINIHSGWRSYTSTLSVCYLCHTSTNAKVKATIAKGVSGQTVYCTDCHGSNPHSWGGTWGR

Evaluation of a Genome-Scale In Silico Metabolic Model for Geobacter metallireducens by Using Proteomic Data from a Field Biostimulation Experiment

Science.gov (United States)

Fang, Yilin; Yabusaki, Steven B.; Lipton, Mary S.; Long, Philip E.

2012-01-01

Accurately predicting the interactions between microbial metabolism and the physical subsurface environment is necessary to enhance subsurface energy development, soil and groundwater cleanup, and carbon management. This study was an initial attempt to confirm the metabolic functional roles within an in silico model using environmental proteomic data collected during field experiments. Shotgun global proteomics data collected during a subsurface biostimulation experiment were used to validate a genome-scale metabolic model of Geobacter metallireducens—specifically, the ability of the metabolic model to predict metal reduction, biomass yield, and growth rate under dynamic field conditions. The constraint-based in silico model of G. metallireducens relates an annotated genome sequence to the physiological functions with 697 reactions controlled by 747 enzyme-coding genes. Proteomic analysis showed that 180 of the 637 G. metallireducens proteins detected during the 2008 experiment were associated with specific metabolic reactions in the in silico model. When the field-calibrated Fe(III) terminal electron acceptor process reaction in a reactive transport model for the field experiments was replaced with the genome-scale model, the model predicted that the largest metabolic fluxes through the in silico model reactions generally correspond to the highest abundances of proteins that catalyze those reactions. Central metabolism predicted by the model agrees well with protein abundance profiles inferred from proteomic analysis. Model discrepancies with the proteomic data, such as the relatively low abundances of proteins associated with amino acid transport and metabolism, revealed pathways or flux constraints in the in silico model that could be updated to more accurately predict metabolic processes that occur in the subsurface environment. PMID:23042184

Fuel Exhaling Fuel Cell.

Science.gov (United States)

Manzoor Bhat, Zahid; Thimmappa, Ravikumar; Devendrachari, Mruthyunjayachari Chattanahalli; Kottaichamy, Alagar Raja; Shafi, Shahid Pottachola; Varhade, Swapnil; Gautam, Manu; Thotiyl, Musthafa Ottakam

2018-01-18

State-of-the-art proton exchange membrane fuel cells (PEMFCs) anodically inhale H 2 fuel and cathodically expel water molecules. We show an unprecedented fuel cell concept exhibiting cathodic fuel exhalation capability of anodically inhaled fuel, driven by the neutralization energy on decoupling the direct acid-base chemistry. The fuel exhaling fuel cell delivered a peak power density of 70 mW/cm 2 at a peak current density of 160 mA/cm 2 with a cathodic H 2 output of ∼80 mL in 1 h. We illustrate that the energy benefits from the same fuel stream can at least be doubled by directing it through proposed neutralization electrochemical cell prior to PEMFC in a tandem configuration.

Effect of short-term alkaline intervention on the performance of buffer-free single-chamber microbial fuel cell.

Science.gov (United States)

Yang, Na; Ren, Yueping; Li, Xiufen; Wang, Xinhua

2017-06-01

Anolyte acidification is a drawback restricting the electricity generation performance of the buffer-free microbial fuel cells (MFC). In this paper, a small amount of alkali-treated anion exchange resin (AER) was placed in front of the anode in the KCl mediated single-chamber MFC to slowly release hydroxyl ions (OH - ) and neutralize the H + ions that are generated by the anodic reaction in two running cycles. This short-term alkaline intervention to the KCl anolyte has promoted the proliferation of electroactive Geobacter sp. and enhanced the self-buffering capacity of the KCl-AER-MFC. The pH of the KCl anolyte in the KCl-AER-MFC increased and became more stable in each running cycle compared with that of the KCl-MFC after the short-term alkaline intervention. The maximum power density (P max ) of the KCl-AER-MFC increased from 307.5mW·m -2 to 542.8mW·m -2 , slightly lower than that of the PBS-MFC (640.7mW·m -2 ). The coulombic efficiency (CE) of the KCl-AER-MFC increased from 54.1% to 61.2% which is already very close to that of the PBS-MFC (61.9%). The results in this paper indicate that short-term alkaline intervention to the anolyte is an effective strategy to further promote the performance of buffer-free MFCs. Copyright © 2017 Elsevier B.V. All rights reserved.

NCBI nr-aa BLAST: CBRC-GACU-16-0048 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GACU-16-0048 ref|YP_001231116.1| lipopolysaccharide biosynthesis protein [Geobacter uranium...reducens Rf4] gb|ABQ26543.1| lipopolysaccharide biosynthesis protein [Geobacter uraniumreducens Rf4] YP_001231116.1 0.14 18% ...

Fuel cell generator with fuel electrodes that control on-cell fuel reformation

Science.gov (United States)

Ruka, Roswell J [Pittsburgh, PA; Basel, Richard A [Pittsburgh, PA; Zhang, Gong [Murrysville, PA

2011-10-25

A fuel cell for a fuel cell generator including a housing including a gas flow path for receiving a fuel from a fuel source and directing the fuel across the fuel cell. The fuel cell includes an elongate member including opposing first and second ends and defining an interior cathode portion and an exterior anode portion. The interior cathode portion includes an electrode in contact with an oxidant flow path. The exterior anode portion includes an electrode in contact with the fuel in the gas flow path. The anode portion includes a catalyst material for effecting fuel reformation along the fuel cell between the opposing ends. A fuel reformation control layer is applied over the catalyst material for reducing a rate of fuel reformation on the fuel cell. The control layer effects a variable reformation rate along the length of the fuel cell.

NCBI nr-aa BLAST: CBRC-XTRO-01-0152 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-XTRO-01-0152 ref|YP_001230889.1| inner-membrane translocator [Geobacter uranium...reducens Rf4] gb|ABQ26316.1| inner-membrane translocator [Geobacter uraniumreducens Rf4] YP_001230889.1 3e-34 36% ...

Fuel and nuclear fuel cycle

International Nuclear Information System (INIS)

Prunier, C.

1998-01-01

The nuclear fuel is studied in detail, the best choice and why in relation with the type of reactor, the properties of the fuel cans, the choice of fuel materials. An important part is granted to the fuel assembly of PWR type reactor and the performances of nuclear fuels are tackled. The different subjects for research and development are discussed and this article ends with the particular situation of mixed oxide fuels ( materials, behavior, efficiency). (N.C.)

Cathodic microbial community adaptation to the removal of chlorinated herbicide in soil microbial fuel cells.

Science.gov (United States)

Li, Yue; Li, Xiaojing; Sun, Yang; Zhao, Xiaodong; Li, Yongtao

2018-04-05

The microbial fuel cell (MFC) that uses a solid electrode as the inexhaustible electron acceptor is an innovative remediation technology that simultaneously generates bioelectricity. Chlorinated pollutants are better metabolized by reductive dechlorination in proximity to the cathode. Here, the removal efficiency of the herbicide metolachlor (ML) increased by 262 and 176% in soil MFCs that were spiked with 10 (C10) and 20 mg/kg (C20) of ML, respectively, relative to the non-electrode controls. The bioelectricity output of the C10 and C20 increased by over two- and eightfold, respectively, compared to that of the non-ML control, with maximum current densities of 49.6 ± 2.5 (C10) and 78.9 ± 0.6 mA/m 2 (C20). Based on correlations between ML concentrations and species abundances in the MFCs, it was inferred that Azohydromonas sp., Sphingomonas sp., and Pontibacter sp. play a major role in ML removal around the cathode, with peak removal efficiencies of 56 ± 1% (C10) and 58 ± 1% (C20). Moreover, Clostridium sp., Geobacter sp., Bacillus sp., Romboutsia sp., and Terrisporobacter sp. may be electricigens or closely related microbes due to the significant positive correlation between the bioelectricity generation levels and their abundances around the anode. This study suggests that a directional adaptation of the microbial community has taken place to increase both the removal of chlorinated herbicides around the cathode and the generation of bioelectricity around the anode in bioelectrochemical remediation systems.

NCBI nr-aa BLAST: CBRC-LAFR-01-0322 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-LAFR-01-0322 ref|YP_001231537.1| carbon starvation protein CstA [Geobacter uranium...reducens Rf4] gb|ABQ26964.1| carbon starvation protein CstA [Geobacter uraniumreducens Rf4] YP_001231537.1 0.96 31% ...

HTGR fuel and fuel cycle technology

International Nuclear Information System (INIS)

Lotts, A.L.; Homan, F.J.; Balthesen, E.; Turner, R.F.

1977-01-01

Significant advances have occurred in the development of HTGR fuel and fuel cycle. These accomplishments permit a wide choice of fuel designs, reactor concepts, and fuel cycles. Fuels capable of providing helium outlet temperatures of 750 0 C are available, and fuels capable of 1000 0 C outlet temperatures may be expected from extension of present technology. Fuels have been developed for two basic HTGR designs, one using a spherical (pebble bed) element and the other a prismatic element. Within each concept a number of variations of geometry, fuel composition, and structural materials are permitted. Potential fuel cycles include both low-enriched and high-enriched Th- 235 U, recycle Th- 233 U, and Th-Pu or U-Pu cycles. This flexibility offered by the HTGR is of great practical benefit considering the rapidly changing economics of power production. The inflation of ore prices has increased optimum conversion ratios, and increased the necessity of fuel recycle at an early date. Fuel element makeup is very similar for prismatic and spherical designs. Both use spherical fissile and fertile particles coated with combinations of pyrolytic carbon and silicon carbide. Both use carbonaceous binder materials, and graphite as the structural material. Weak-acid resin (WAR) UO 2 -UC 2 fissile fuels and sol-gel-derived ThO 2 fertile fuels have been selected for the Th- 233 U cycle in the prismatic design. Sol-gel-derived UO 2 UC 2 is the reference fissile fuel for the low-enriched pebble bed design. Both the United States and Federal Republic of Germany are developing technology for fuel cycle operations including fabrication, reprocessing, refabrication, and waste handling. Feasibility of basic processes has been established and designs developed for full-scale equipment. Fuel and fuel cycle technology provide the basis for a broad range of applications of the HTGR. Extension of the fuels to higher operating temperatures and development and commercial demonstration of fuel

Constant strength fuel-fuel cell

International Nuclear Information System (INIS)

Vaseen, V.A.

1980-01-01

A fuel cell is an electrochemical apparatus composed of both a nonconsumable anode and cathode; and electrolyte, fuel oxidant and controls. This invention guarantees the constant transfer of hydrogen atoms and their respective electrons, thus a constant flow of power by submergence of the negative electrode in a constant strength hydrogen furnishing fuel; when said fuel is an aqueous absorbed hydrocarbon, such as and similar to ethanol or methnol. The objective is accomplished by recirculation of the liquid fuel, as depleted in the cell through specific type membranes which pass water molecules and reject the fuel molecules; thus concentrating them for recycle use

NCBI nr-aa BLAST: CBRC-DMEL-04-0042 [SEVENS

Lifescience Database Archive (English)

Full Text Available ike protein [Geobacter uraniumreducens Rf4] gb|ABQ26219.1| Uncharacterized membrane-associated protein-like protein [Geobacter uraniumreducens Rf4] YP_001230792.1 4.3 28% ... ...CBRC-DMEL-04-0042 ref|YP_001230792.1| Uncharacterized membrane-associated protein-l

NCBI nr-aa BLAST: CBRC-DYAK-02-0022 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DYAK-02-0022 ref|YP_001232964.1| ATP synthase F0, A subunit [Geobacter uranium...reducens Rf4] gb|ABQ28391.1| ATP synthase F0, A subunit [Geobacter uraniumreducens Rf4] YP_001232964.1 0.85 25% ...

Fuels processing for transportation fuel cell systems

Science.gov (United States)

Kumar, R.; Ahmed, S.

Fuel cells primarily use hydrogen as the fuel. This hydrogen must be produced from other fuels such as natural gas or methanol. The fuel processor requirements are affected by the fuel to be converted, the type of fuel cell to be supplied, and the fuel cell application. The conventional fuel processing technology has been reexamined to determine how it must be adapted for use in demanding applications such as transportation. The two major fuel conversion processes are steam reforming and partial oxidation reforming. The former is established practice for stationary applications; the latter offers certain advantages for mobile systems and is presently in various stages of development. This paper discusses these fuel processing technologies and the more recent developments for fuel cell systems used in transportation. The need for new materials in fuels processing, particularly in the area of reforming catalysis and hydrogen purification, is discussed.

NCBI nr-aa BLAST: CBRC-DNOV-01-1221 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DNOV-01-1221 ref|YP_001230970.1| UBA/THIF-type NAD/FAD binding protein [Geobacter uranium...reducens Rf4] gb|ABQ26397.1| UBA/THIF-type NAD/FAD binding protein [Geobacter uraniumreducens Rf4] YP_001230970.1 3.9 50% ...

NCBI nr-aa BLAST: CBRC-BTAU-01-2822 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-BTAU-01-2822 ref|YP_001230511.1| lipolytic enzyme, G-D-S-L family [Geobacter uranium...reducens Rf4] gb|ABQ25938.1| lipolytic enzyme, G-D-S-L family [Geobacter uraniumreducens Rf4] YP_001230511.1 0.001 40% ...

NCBI nr-aa BLAST: CBRC-HSAP-11-0402 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-HSAP-11-0402 ref|YP_001232090.1| heavy metal efflux pump, CzcA family [Geobacter uranium...reducens Rf4] gb|ABQ27517.1| heavy metal efflux pump, CzcA family [Geobacter uraniumreducens Rf4] YP_001232090.1 1.2 30% ...

ORF Alignment: NC_002939 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available sulfurreducens PCA] ... Length = 111 ... Query: 1 ... MNLKIETKNDILIIFVREERLDAHNSGDLKTKMQELFTSGTKNILVDLNEVRFID...SSGLG 60 ... MNLKIETKNDILIIFVREERLDAHNSGDLKTKMQELFTSGTKNILVDLNEVRFIDSSG...LG Sbjct: 1 ... MNLKIETKNDILIIFVREERLDAHNSGDLKTKMQELFTSGTKNILVDLNEVRFIDSSGLG 60 ...

ORF Alignment: NC_002939 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... sulfurreducens PCA] ... Length = 72 ... Query: 436 QLEEANEDLRQFSSSLSHDIRTPLSSIAGYVQLARAECDGTESELLPDLF...TAIELATARM 495 ... QLEEANEDLRQFSSSLSHDIRTPLSSIAGYVQLARAECDGTESELLPDLFTAIEL...ATARM Sbjct: 1 ... QLEEANEDLRQFSSSLSHDIRTPLSSIAGYVQLARAECDGTESELLPDLFTAIELATARM 60 ...

ORF Alignment: NC_002939 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available cter ... sulfurreducens PCA] ... Length = 113 ... Query: 27 ... IGLKAEFVTDPHERRAETRVRIPEVFQGWQGVTHGG...IISALLDEICAQACMASGLQIVTS 86 ... IGLKAEFVTDPHERRAETRVRIPEVFQGWQGVTHGGIISALL...DEICAQACMASGLQIVTS Sbjct: 1 ... IGLKAEFVTDPHERRAETRVRIPEVFQGWQGVTHGGIISALLDEICAQACMASGLQIVTS 60 ...

Fuel performance and operation experience of WWER-440 fuel in improved fuel cycle

International Nuclear Information System (INIS)

Gagarinski, A.; Proselkov, V.; Semchenkov, Yu.

2007-01-01

The paper summarizes WWER-440 second-generation fuel operation experience in improved fuel cycles using the example of Kola NPP units 3 and 4. Basic parameters of fuel assemblies, fuel rods and uranium-gadolinium fuel rods, as well as the principal neutronic parameters and burn-up achieved in fuel assemblies are presented. The paper also contains some data concerning the activity of coolant during operation (Authors)

Advanced fuel development at AECL: What does the future hold for CANDU fuels/fuel cycles?

Energy Technology Data Exchange (ETDEWEB)

Kupferschmidt, W.C.H. [Atomic Energy of Canada Limited, Chalk River, Ontario (Canada)

2013-07-01

This paper outlines advanced fuel development at AECL. It discusses expanding the limits of fuel utilization, deploy alternate fuel cycles, increase fuel flexibility, employ recycled fuels; increase safety and reliability, decrease environmental impact and develop proliferation resistant fuel and fuel cycle.

HTGR fuel and fuel cycle technology

International Nuclear Information System (INIS)

Lotts, A.L.; Coobs, J.H.

1976-08-01

The status of fuel and fuel cycle technology for high-temperature gas-cooled reactors (HTGRs) is reviewed. The all-ceramic core of the HTGRs permits high temperatures compared with other reactors. Core outlet temperatures of 740 0 C are now available for the steam cycle. For advanced HTGRs such as are required for direct-cycle power generation and for high-temperature process heat, coolant temperatures as high as 1000 0 C may be expected. The paper discusses the variations of HTGR fuel designs that meet the performance requirements and the requirements of the isotopes to be used in the fuel cycle. Also discussed are the fuel cycle possibilities, which include the low-enrichment cycle, the Th- 233 U cycle, and plutonium utilization in either cycle. The status of fuel and fuel cycle development is summarized

76 FR 37703 - Regulation of Fuels and Fuel Additives: 2012 Renewable Fuel Standards; Public Hearing

Science.gov (United States)

2011-06-28

... Regulation of Fuels and Fuel Additives: 2012 Renewable Fuel Standards; Public Hearing AGENCY: Environmental... hearing to be held for the proposed rule ``Regulation of Fuels and Fuel Additives: 2012 Renewable Fuel... be proposing amendments to the renewable fuel standard program regulations to establish annual...

In-Situ Survival Mechanisms of U and Tc Reducing Bacteria in Contaminated Sediments

International Nuclear Information System (INIS)

Krumholz, Lee R.

2005-01-01

periplasmic space and outer membrane associated proteins. Through blast search analysis, we also showed that 81 out of 94 proteins shown to be important in sediment survival have homologs in D. vulgaris, 70 have homologs in Geobacter metallireducens, and 69 have homologs in Geobacter sulfurreducens PCA. Some interesting proteins include ribonucleotide reductase and chemotaxis related proteins. Ribonucleotide reductase catalyzes the reductive synthesis of deoxyribonucleotides from their corresponding ribonucleotides, providing the precursors necessary for DNA synthesis. Two ribonucleotide reductase genes (nrdE, nrdD) were found to be essential for G20 survival in the sediment, but not essential for growth in the lactate-sulfate medium. Bacterial methyl-accepting chemotaxis proteins (MCP) respond to changes in the concentration of attractants and repellents in the environment

Multi-fuel reformers for fuel cells used in transportation. Phase 1: Multi-fuel reformers

Science.gov (United States)

1994-05-01

DOE has established the goal, through the Fuel Cells in Transportation Program, of fostering the rapid development and commercialization of fuel cells as economic competitors for the internal combustion engine. Central to this goal is a safe feasible means of supplying hydrogen of the required purity to the vehicular fuel cell system. Two basic strategies are being considered: (1) on-board fuel processing whereby alternative fuels such as methanol, ethanol or natural gas stored on the vehicle undergo reformation and subsequent processing to produce hydrogen, and (2) on-board storage of pure hydrogen provided by stationary fuel processing plants. This report analyzes fuel processor technologies, types of fuel and fuel cell options for on-board reformation. As the Phase 1 of a multi-phased program to develop a prototype multi-fuel reformer system for a fuel cell powered vehicle, the objective of this program was to evaluate the feasibility of a multi-fuel reformer concept and to select a reforming technology for further development in the Phase 2 program, with the ultimate goal of integration with a DOE-designated fuel cell and vehicle configuration. The basic reformer processes examined in this study included catalytic steam reforming (SR), non-catalytic partial oxidation (POX) and catalytic partial oxidation (also known as Autothermal Reforming, or ATR). Fuels under consideration in this study included methanol, ethanol, and natural gas. A systematic evaluation of reforming technologies, fuels, and transportation fuel cell applications was conducted for the purpose of selecting a suitable multi-fuel processor for further development and demonstration in a transportation application.

Fuel assembly

International Nuclear Information System (INIS)

Chaki, Masao; Nishida, Koji; Karasawa, Hidetoshi; Kanazawa, Toru; Orii, Akihito; Nagayoshi, Takuji; Kashiwai, Shin-ichi; Masuhara, Yasuhiro

1998-01-01

The present invention concerns a fuel assembly, for a BWR type nuclear reactor, comprising fuel rods in 9 x 9 matrix. The inner width of the channel box is about 132mm and the length of the fuel rods which are not short fuel rods is about 4m. Two water rods having a circular cross section are arranged on a diagonal line in a portion of 3 x 3 matrix at the center of the fuel assembly, and two fuel rods are disposed at vacant spaces, and the number of fuel rods is 74. Eight fuel rods are determined as short fuel rods among 74 fuel rods. Assuming the fuel inventory in the short fuel rod as X(kg), and the fuel inventory in the fuel rods other than the short fuel rods as Y(kg), X and Y satisfy the relation: X + Y ≥ 173m, Y ≤ - 9.7X + 292, Y ≤ - 0.3X + 203 and X > 0. Then, even when the short fuel rods are used, the fuel inventory is increased and fuel economy can be improved. (I.N.)

Fuel assemblies

International Nuclear Information System (INIS)

Mukai, Hideyuki

1987-01-01

Purpose: To prevent bending of fuel rods caused by the difference of irradiation growth between coupling fuel rods and standards fuel rods thereby maintain the fuel rod integrity. Constitution: The f value for a fuel can (the ratio of pole of zirconium crystals in the entire crystals along the axial direction of the fuel can) of a coupling fuel rod secured by upper and lower tie plates is made smaller than the f value for the fuel can of a standard fuel rod not secured by the upper and the lower tie plates. This can make the irradiation growth of the fuel can of the coupling fuel rod greater than the irradiation growth of the fuel can of the standard fuel rod and, accordingly, since the elongation of the standard fuel rod can always by made greater, bending of the standard fuel rod can be prevented. (Yoshihara, M.)

Features of fuel performance at high fuel burnups

International Nuclear Information System (INIS)

Proselkov, V.N.; Scheglov, A.S.; Smirnov, A.V.; Smirnov, V.P.

2001-01-01

Some features of fuel behavior at high fuel burnups, in particular, initiation and development of rim-layer, increase in the rate of fission gas release from the fuel and increase in the inner gas pressure in the fuel rod are briefly described. Basing on the analysis of the data of post-irradiation examinations of fuel rods of WWER-440 working FA and CR fuel followers, that have been operated for five fuel cycles and got the average fuel burnup or varies as 50MW-day/kgU, a conclusion is made that the WWER-440 fuel burnup can be increased at least to average burnups of 55-58 MW-day/kgU per fuel assembly (Authors)

Fuel Handbook[Wood and other renewable fuels

Energy Technology Data Exchange (ETDEWEB)

Stroemberg, Birgitta [TPS Termiska Processer AB, Nykoeping (SE)] (ed.)

2006-03-15

This handbook on renewable fuels is intended for power and heat producers in Sweden. This fuel handbook provides, from a plant owner's perspective, a method to evaluate different fuels on the market. The fuel handbook concerns renewable fuels (but does not include household waste) that are available on the Swedish market today or fuels that have potential to be available within the next ten years. The handbook covers 26 different fuels. Analysis data, special properties, operating experiences and literature references are outlined for each fuel. [Special properties, operating experiences and literature references are not included in this English version] The handbook also contains: A proposed methodology for introduction of new fuels. A recommendation of analyses and tests to perform in order to reduce the risk of problems is presented. [The recommendation of analyses and tests is not included in the English version] A summary of relevant laws and taxes for energy production, with references to relevant documentation. [Only laws and taxes regarding EU are included] Theory and background to evaluate a fuel with respect to combustion, ash and corrosion properties and methods that can be used for such evaluations. Summary of standards, databases and handbooks on biomass fuels and other solid fuels, and links to web sites where further information about the fuels can be found. The appendices includes: A methodology for trial firing of fuels. Calculations procedures for, amongst others, heating value, flue gas composition, key number and free fall velocity [Free fall velocity is not included in the English version]. In addition, conversion routines between different units for a number of different applications are provided. Fuel analyses are presented in the appendix. (The report is a translation of parts of the report VARMEFORSK--911 published in 2005)

Benefits of barrier fuel on fuel cycle economics

International Nuclear Information System (INIS)

Crowther, R.L.; Kunz, C.L.

1988-01-01

Barrier fuel rod cladding was developed to eliminate fuel rod failures from pellet/cladding stress/corrosion interaction and to eliminate the associated need to restrict the rate at which fuel rod power can be increased. The performance of barrier cladding has been demonstrated through extensive testing and through production application to many boiling water reactors (BWRs). Power reactor data have shown that barrier fuel rod cladding has a significant beneficial effect on plant capacity factor and plant operating costs and significantly increases fuel reliability. Independent of the fuel reliability benefit, it is less obvious that barrier fuel has a beneficial effect of fuel cycle costs, since barrier cladding is more costly to fabricate. Evaluations, measurements, and development activities, however, have shown that the fuel cycle cost benefits of barrier fuel are large. This paper is a summary of development activities that have shown that application of barrier fuel significantly reduces BWR fuel cycle costs

Fuel assembly

International Nuclear Information System (INIS)

Yamazaki, Hajime.

1995-01-01

In a fuel assembly having fuel rods of different length, fuel pellets of mixed oxides of uranium and plutonium are loaded to a short fuel rod. The volume ratio of a pellet-loaded portion to a plenum portion of the short fuel rod is made greater than the volume ratio of a fuel rod to which uranium fuel pellets are loaded. In addition, the volume of the plenum portion of the short fuel rod is set greater depending on the plutonium content in the loaded fuel pellets. MOX fuel pellets are loaded on the short fuel rods having a greater degree of freedom relevant to the setting for the volume of the plenum portion compared with that of a long rod fuel, and the volume of the plenum portion is ensured greater depending on the plutonium content. Even if a large amount of FP gas and He gas are discharged from the MOX fuels compared with that from the uranium fuels, the internal pressure of the MOX fuel rod during operation is maintained substantially identical with that of the uranium fuel rod, so that a risk of generating excess stresses applied to the fuel cladding tubes and rupture of fuels are greatly reduced. (N.H.)

Framing car fuel efficiency : linearity heuristic for fuel consumption and fuel-efficiency ratings

NARCIS (Netherlands)

Schouten, T.M.; Bolderdijk, J.W.; Steg, L.

2014-01-01

People are sensitive to the way information on fuel efficiency is conveyed. When the fuel efficiency of cars is framed in terms of fuel per distance (FPD; e.g. l/100 km), instead of distance per units of fuel (DPF; e.g. km/l), people have a more accurate perception of potential fuel savings. People

Used fuel packing plant for CANDU fuel

Energy Technology Data Exchange (ETDEWEB)

Menzies, I.; Thayer, B.; Bains, N., E-mail: imenzies@atsautomation.com [ATS Automation, Cambridge, ON (Canada); Murchison, A., E-mail: amurchison@nwmo.ca [NWMO, Toronto, ON (Canada)

2015-07-01

Large forgings have been selected to containerize Light Water Reactor used nuclear fuel. CANDU fuel, which is significantly smaller in size, allows novel approaches for containerization. For example, by utilizing commercially available extruded ASME pipe a conceptual design of a Used Fuel Packing Plant for containerization of used CANDU fuel in a long lived metallic container has been developed. The design adopts a modular approach with multiple independent work cells to transfer and containerize the used fuel. Based on current technologies and concepts from proven industrial systems, the Used Fuel Packing Plant can assemble twelve used fuel containers per day considering conservative levels of process availability. (author)

Fuel assembly

International Nuclear Information System (INIS)

Sakuyama, Tadashi; Mukai, Hideyuki.

1988-01-01

Purpose: To prevent the bending of a fuel rod caused by the difference in the elongation between a joined fuel rod and a standard fuel rod thereby maintain the fuel rod integrity. Constitution: A joined fuel rod is in a thread engagement at its lower end plug thereof with a lower plate, while passed through at its upper end plug into an upper tie plate and secured with a nut. Further, a standard fuel rod is engaged at its upper end plug and lower end plug with the upper tie plate and the lower tie plate respectively. Expansion springs are mounted to the upper end plugs of these bonded fuel rods and the standard fuel rods for preventing this lifting. Each of the fuel rods comprises a plurality of sintered pellets of nuclear fuel materials laminated in a zircaloy fuel can. The content of the alloy ingredient in the fuel can of the bonded fuel rod is made greater than that of the alloy ingredient of the standard fuel rod. this can increase the elongation for the bonded fuel rod, and the spring of the standard fuel rod is tightly bonded to prevent the bending. (Yoshino, Y.)

Fuel performance of DOE fuels in water storage

International Nuclear Information System (INIS)

Hoskins, A.P.; Scott, J.G.; Shelton-Davis, C.V.; McDannel, G.E.

1993-01-01

Westinghouse Idaho Nuclear Company operates the Idaho Chemical Processing Plant (ICPP) at the Idaho National Engineering Laboratory. In April of 1992, the U.S. Department of Energy (DOE) decided to end the fuel reprocessing mission at ICPP. Fuel performance in storage received increased emphasis as the fuel now needs to be stored until final dispositioning is defined and implemented. Fuels are stored in four main areas: an original underwater storage facility, a modern underwater storage facility, and two dry fuel storage facilities. As a result of the reactor research mission of the DOE and predecessor agencies, the Energy Research and Development Administration and the Atomic Energy Commission, many types of nuclear fuel have been developed, used, and assigned to storage at the ICPP. Fuel clad with stainless steel, zirconium, aluminum, and graphite are represented. Fuel matrices include uranium oxide, hydride, carbide, metal, and alloy fuels, resulting in 55 different fuel types in storage. Also included in the fuel storage inventory is canned scrap material

Fuel Supply Defaults for Regional Fuels and Fuel Wizard Tool in MOVES201X

Science.gov (United States)

The fuel supply report documents the data and methodology used to derive the default gasoline, diesel and fuel-blend fuel properties, and their respective fuel market share in MOVES. The default market share of the individual fuels varies by calendar year, seasons, and several do...

78 FR 12005 - Regulation of Fuels and Fuel Additives: 2013 Renewable Fuel Standards; Public Hearing

Science.gov (United States)

2013-02-21

... Regulation of Fuels and Fuel Additives: 2013 Renewable Fuel Standards; Public Hearing AGENCY: Environmental... EPA is announcing a public hearing to be held for the proposed rule ``Regulation of Fuels and Fuel Additives: 2013 Renewable Fuel Standards,'' which was published separately in the Federal Register on...

Solid TRU fuels and fuel cycle technology

International Nuclear Information System (INIS)

Ogawa, Toru; Suzuki, Yasufumi

1997-01-01

Alloys and nitrides are candidate solid fuels for transmutation. However, the nitride fuels are preferred to the alloys because they have more favorable thermal properties which allows to apply a cold-fuel concept. The nitride fuel cycle technology is briefly presented

Nuclear fuels

International Nuclear Information System (INIS)

Beauvy, M.; Berthoud, G.; Defranceschi, M.; Ducros, G.; Guerin, Y.; Limoge, Y.; Madic, Ch.; Santarini, G.; Seiler, J.M.; Sollogoub, P.; Vernaz, E.; Guillet, J.L.; Ballagny, A.; Bechade, J.L.; Bonin, B.; Brachet, J.Ch.; Delpech, M.; Dubois, S.; Ferry, C.; Freyss, M.; Gilbon, D.; Grouiller, J.P.; Iracane, D.; Lansiart, S.; Lemoine, P.; Lenain, R.; Marsault, Ph.; Michel, B.; Noirot, J.; Parrat, D.; Pelletier, M.; Perrais, Ch.; Phelip, M.; Pillon, S.; Poinssot, Ch.; Vallory, J.; Valot, C.; Pradel, Ph.; Bonin, B.; Bouquin, B.; Dozol, M.; Lecomte, M.; Vallee, A.; Bazile, F.; Parisot, J.F.; Finot, P.; Roberts, J.F.

2009-01-01

Fuel is one of the essential components in a reactor. It is within that fuel that nuclear reactions take place, i.e. fission of heavy atoms, uranium and plutonium. Fuel is at the core of the reactor, but equally at the core of the nuclear system as a whole. Fuel design and properties influence reactor behavior, performance, and safety. Even though it only accounts for a small part of the cost per kilowatt-hour of power provided by current nuclear power plants, good utilization of fuel is a major economic issue. Major advances have yet to be achieved, to ensure longer in-reactor dwell-time, thus enabling fuel to yield more energy; and improve ruggedness. Aside from economics, and safety, such strategic issues as use of plutonium, conservation of resources, and nuclear waste management have to be addressed, and true technological challenges arise. This Monograph surveys current knowledge regarding in-reactor behavior, operating limits, and avenues for R and D. It also provides illustrations of ongoing research work, setting out a few noteworthy results recently achieved. Content: 1 - Introduction; 2 - Water reactor fuel: What are the features of water reactor fuel? 9 (What is the purpose of a nuclear fuel?, Ceramic fuel, Fuel rods, PWR fuel assemblies, BWR fuel assemblies); Fabrication of water reactor fuels (Fabrication of UO 2 pellets, Fabrication of MOX (mixed uranium-plutonium oxide) pellets, Fabrication of claddings); In-reactor behavior of UO 2 and MOX fuels (Irradiation conditions during nominal operation, Heat generation, and removal, The processes involved at the start of irradiation, Fission gas behavior, Microstructural changes); Water reactor fuel behavior in loss of tightness conditions (Cladding, the first containment barrier, Causes of failure, Consequences of a failure); Microscopic morphology of fuel ceramic and its evolution under irradiation; Migration and localization of fission products in UOX and MOX matrices (The ceramic under irradiation

Nuclear fuels

Energy Technology Data Exchange (ETDEWEB)

Beauvy, M.; Berthoud, G.; Defranceschi, M.; Ducros, G.; Guerin, Y.; Limoge, Y.; Madic, Ch.; Santarini, G.; Seiler, J.M.; Sollogoub, P.; Vernaz, E.; Guillet, J.L.; Ballagny, A.; Bechade, J.L.; Bonin, B.; Brachet, J.Ch.; Delpech, M.; Dubois, S.; Ferry, C.; Freyss, M.; Gilbon, D.; Grouiller, J.P.; Iracane, D.; Lansiart, S.; Lemoine, P.; Lenain, R.; Marsault, Ph.; Michel, B.; Noirot, J.; Parrat, D.; Pelletier, M.; Perrais, Ch.; Phelip, M.; Pillon, S.; Poinssot, Ch.; Vallory, J.; Valot, C.; Pradel, Ph.; Bonin, B.; Bouquin, B.; Dozol, M.; Lecomte, M.; Vallee, A.; Bazile, F.; Parisot, J.F.; Finot, P.; Roberts, J.F

2009-07-01

Fuel is one of the essential components in a reactor. It is within that fuel that nuclear reactions take place, i.e. fission of heavy atoms, uranium and plutonium. Fuel is at the core of the reactor, but equally at the core of the nuclear system as a whole. Fuel design and properties influence reactor behavior, performance, and safety. Even though it only accounts for a small part of the cost per kilowatt-hour of power provided by current nuclear power plants, good utilization of fuel is a major economic issue. Major advances have yet to be achieved, to ensure longer in-reactor dwell-time, thus enabling fuel to yield more energy; and improve ruggedness. Aside from economics, and safety, such strategic issues as use of plutonium, conservation of resources, and nuclear waste management have to be addressed, and true technological challenges arise. This Monograph surveys current knowledge regarding in-reactor behavior, operating limits, and avenues for R and D. It also provides illustrations of ongoing research work, setting out a few noteworthy results recently achieved. Content: 1 - Introduction; 2 - Water reactor fuel: What are the features of water reactor fuel? 9 (What is the purpose of a nuclear fuel?, Ceramic fuel, Fuel rods, PWR fuel assemblies, BWR fuel assemblies); Fabrication of water reactor fuels (Fabrication of UO{sub 2} pellets, Fabrication of MOX (mixed uranium-plutonium oxide) pellets, Fabrication of claddings); In-reactor behavior of UO{sub 2} and MOX fuels (Irradiation conditions during nominal operation, Heat generation, and removal, The processes involved at the start of irradiation, Fission gas behavior, Microstructural changes); Water reactor fuel behavior in loss of tightness conditions (Cladding, the first containment barrier, Causes of failure, Consequences of a failure); Microscopic morphology of fuel ceramic and its evolution under irradiation; Migration and localization of fission products in UOX and MOX matrices (The ceramic under

Fuel economy of hybrid fuel-cell vehicles

Science.gov (United States)

Ahluwalia, Rajesh K.; Wang, X.; Rousseau, A.

The potential improvement in fuel economy of a mid-size fuel-cell vehicle by combining it with an energy storage system has been assessed. An energy management strategy is developed and used to operate the direct hydrogen, pressurized fuel-cell system in a load-following mode and the energy storage system in a charge-sustaining mode. The strategy places highest priority on maintaining the energy storage system in a state where it can supply unanticipated boost power when the fuel-cell system alone cannot meet the power demand. It is found that downsizing a fuel-cell system decreases its efficiency on a drive cycle which is compensated by partial regenerative capture of braking energy. On a highway cycle with limited braking energy the increase in fuel economy with hybridization is small but on the stop-and-go urban cycle the fuel economy can improve by 27%. On the combined highway and urban drive cycles the fuel economy of the fuel-cell vehicle is estimated to increase by up to 15% by hybridizing it with an energy storage system.

Ammonia as a Suitable Fuel for Fuel Cells

International Nuclear Information System (INIS)

Lan, Rong; Tao, Shanwen

2014-01-01

Ammonia, an important basic chemical, is produced at a scale of 150 million tons per year. Half of hydrogen produced in chemical industry is used for ammonia production. Ammonia containing 17.5 wt% hydrogen is an ideal carbon-free fuel for fuel cells. Compared to hydrogen, ammonia has many advantages. In this mini-review, the suitability of ammonia as fuel for fuel cells, the development of different types of fuel cells using ammonia as the fuel and the potential applications of ammonia fuel cells are briefly reviewed.

Ammonia as a suitable fuel for fuel cells

Directory of Open Access Journals (Sweden)

Rong eLan

2014-08-01

Full Text Available Ammonia, an important basic chemical, is produced at a scale of 150 million tons per year. Half of hydrogen produced in chemical industry is used for ammonia production. Ammonia containing 17.5wt% hydrogen is an ideal carbon-free fuel for fuel cells. Compared to hydrogen, ammonia has many advantages. In this mini-review, the suitability of ammonia as fuel for fuel cells, the development of different types of fuel cells using ammonia as the fuel and the potential applications of ammonia fuel cells are briefly reviewed.

Safety analysis of MOX fuels by fuel performance code

Energy Technology Data Exchange (ETDEWEB)

Suzuki, Motoe [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

2002-12-01

Performance of plutonium rick mixed oxide fuels specified for the Reduced-Moderation Water Reactor (RMWR) has been analysed by modified fuel performance code. Thermodynamic properties of these fuels up to 120 GWd/t burnup have not been measured and estimated using existing uranium fuel models. Fission product release, pressure rise inside fuel rods and mechanical loads of fuel cans due to internal pressure have been preliminarily assessed based on assumed axial power distribution history, which show the integrity of fuel performance. Detailed evaluation of fuel-cladding interactions due to thermal expansion or swelling of fuel pellets due to high burnup will be required for safety analysis of mixed oxide fuels. Thermal conductivity and swelling of plutonium rich mixed oxide fuels shall be taken into consideration. (T. Tanaka)

Influence of heterogeneous ammonium availability on bacterial community structure and the expression of nitrogen fixation and ammonium transporter genes during in situ bioremediation of uranium-contaminated groundwater

Energy Technology Data Exchange (ETDEWEB)

Mouser, P.J.; N' Guessan, A.L.; Elifantz, H.; Holmes, D.E.; Williams, K.H.; Wilkins, M.J.; Long, P.E.; Lovley, D.R.

2009-04-01

The impact of ammonium availability on microbial community structure and the physiological status and activity of Geobacter species during in situ bioremediation of uranium-contaminated groundwater was evaluated. Ammonium concentrations varied by as much as two orders of magnitude (<4 to 400 {micro}M) across the study site. Analysis of 16S rRNA gene sequences suggested that ammonium influenced the composition of the microbial community prior to acetate addition with Rhodoferax species predominating over Geobacter species at the site with the highest ammonium, and Dechloromonas species dominating at sites with lowest ammonium. However, once acetate was added, and dissimilatory metal reduction was stimulated, Geobacter species became the predominant organisms at all locations. Rates of U(VI) reduction appeared to be more related to the concentration of acetate that was delivered to each location rather than the amount of ammonium available in the groundwater. In situ mRNA transcript abundance of the nitrogen fixation gene, nifD, and the ammonium importer gene, amtB, in Geobacter species indicated that ammonium was the primary source of nitrogen during in situ uranium reduction, and that the abundance of amtB transcripts was inversely correlated to ammonium levels across all sites examined. These results suggest that nifD and amtB expression by subsurface Geobacter species are closely regulated in response to ammonium availability to ensure an adequate supply of nitrogen while conserving cell resources. Thus, quantifying nifD and amtB expression appears to be a useful approach for monitoring the nitrogen-related physiological status of Geobacter species in subsurface environments during bioremediation. This study also emphasizes the need for more detailed analysis of geochemical/physiological interactions at the field scale, in order to adequately model subsurface microbial processes.

Reactor fuel element and fuel assembly

International Nuclear Information System (INIS)

Okada, Seiji; Ishida, Tsuyoshi; Ikeda, Atsuko.

1997-01-01

A mixture of fission products and burnable poisons is disposed at least to a portion between MOX pellets to form a burnable poison-incorporated fuel element without mixing burnable poisons to the MOX pellets. Alternatively, a mixture of materials other than the fission products and burnable poisons is formed into disks, a fuel lamination portion is divided into at least to two regions, and the ratio of number of the disks of the mixture relative to the volume of the region is increased toward the lower portion of the fuel lamination portion. With such a constitution, the axial power distribution of fuels can be made flat easily. Alternatively, the thickness of the disk of the mixture is increased toward the lower region of the fuel lamination portion to flatten the axial power distribution of the fuels in the same manner easily. The time and the cost required for the manufacture are reduced, and MOX fuels filled with burnable poisons with easy maintenance and control can be realized. (N.H.)

Emergency fuels utilization guidebook. Alternative Fuels Utilization Program

Energy Technology Data Exchange (ETDEWEB)

1980-08-01

The basic concept of an emergency fuel is to safely and effectively use blends of specification fuels and hydrocarbon liquids which are free in the sense that they have been commandeered or volunteered from lower priority uses to provide critical transportation services for short-duration emergencies on the order of weeks, or perhaps months. A wide variety of liquid hydrocarbons not normally used as fuels for internal combustion engines have been categorized generically, including limited information on physical characteristics and chemical composition which might prove useful and instructive to fleet operators. Fuels covered are: gasoline and diesel fuel; alcohols; solvents; jet fuels; kerosene; heating oils; residual fuels; crude oils; vegetable oils; gaseous fuels.

77 FR 13009 - Regulation of Fuels and Fuel Additives: Identification of Additional Qualifying Renewable Fuel...

Science.gov (United States)

2012-03-05

... Regulation of Fuels and Fuel Additives: Identification of Additional Qualifying Renewable Fuel Pathways Under the Renewable Fuel Standard Program AGENCY: Environmental Protection Agency (EPA). ACTION: Withdrawal... Renewable Fuel Standard program regulations. Because EPA received adverse comment, we are withdrawing the...

Nuclear fuels

International Nuclear Information System (INIS)

2008-01-01

The nuclear fuel is one of the key component of a nuclear reactor. Inside it, the fission reactions of heavy atoms, uranium and plutonium, take place. It is located in the core of the reactor, but also in the core of the whole nuclear system. Its design and properties influence the behaviour, the efficiency and the safety of the reactor. Even if it represents a weak share of the generated electricity cost, its proper use represents an important economic stake. Important improvements remain to be made to increase its residence time inside the reactor, to supply more energy, and to improve its robustness. Beyond the economical and safety considerations, strategical questions have to find an answer, like the use of plutonium, the management of resources and the management of nuclear wastes and real technological challenges have to be taken up. This monograph summarizes the existing knowledge about the nuclear fuel, its behaviour inside the reactor, its limits of use, and its R and D tracks. It illustrates also the researches in progress and presents some key results obtained recently. Content: 1 - Introduction; 2 - The fuel of water-cooled reactors: aspect, fabrication, behaviour of UO 2 and MOX fuels inside the reactor, behaviour in loss of tightness situation, microscopic morphology of fuel ceramics and evolution under irradiation - migration and localisation of fission products in UOX and MOX matrices, modeling of fuels behaviour - modeling of defects and fission products in the UO 2 ceramics by ab initio calculations, cladding and assembly materials, pellet-cladding interaction, advanced UO 2 and MOX ceramics, mechanical behaviour of the fuel assembly, fuel during a loss of coolant accident, fuel during a reactivity accident, fuel during a serious accident, fuel management inside reactor cores, fuel cycle materials balance, long-term behaviour of the spent fuel, fuel of boiling water reactors; 3 - the fuel of liquid metal fast reactors: fast neutrons radiation

Apparatus for loading fuel pellets in fuel rods

International Nuclear Information System (INIS)

Tedesco, R.J.

1976-01-01

An apparatus is disclosed for loading fuel pellets into fuel rods for a nuclear reactor including a base supporting a table having grooves therein for holding a multiplicity of pellets. Multiple fuel rods are placed in alignment with grooves in the pellet table and a guide member channels pellets from the table into the corresponding fuel rods. To effect movement of pellets inside the fuel rods without jamming, a number of electromechanical devices mounted on the base have arms connected to the lower surface of the fuel rod table which cyclically imparts a reciprocating arc motion to the table for moving the fuel pellets longitudinally of and inside the fuel rods. These electromechanical devices include a solenoid having a plunger therein connected to a leaf type spring, the arrangement being such that upon energization of the solenoid coil, the leaf spring moves the fuel rod table rearwardly and downwardly, and upon deenergization of the coil, the spring imparts an upward-forward movement to the table which results in physical displacement of fuel pellets in the fuel rods clamped to the table surface. 8 claims, 6 drawing figures

Hardened over-coating fuel particle and manufacture of nuclear fuel using its fuel particle

International Nuclear Information System (INIS)

Yoshimuda, Hideharu.

1990-01-01

Coated-fuel particles comprise a coating layer formed by coating ceramics such as silicon carbide or zirconium carbide and carbons, etc. to a fuel core made of nuclear fuel materials. The fuel core generally includes oxide particles such as uranium, thorium and plutonium, having 400 to 600 μm of average grain size. The average grain size of the coated-fuel particle is usually from 800 to 900 μm. The thickness of the coating layer is usually from 150 to 250 μm. Matrix material comprising a powdery graphite and a thermosetting resin such as phenol resin, etc. is overcoated to the surface of the coated-fuel particle and hardened under heating to form a hardened overcoating layer to the coated-fuel particle. If such coated-fuel particles are used, cracks, etc. are less caused to the coating layer of the coated-fuel particles upon production, thereby enabling to prevent the damages to the coating layer. (T.M.)

Fuel and fuel cycles with high burnup for WWER reactors

International Nuclear Information System (INIS)

Chernushev, V.; Sokolov, F.

2002-01-01

The paper discusses the status and trends in development of nuclear fuel and fuel cycles for WWER reactors. Parameters and main stages of implementation of new fuel cycles will be presented. At present, these new fuel cycles are offered to NPPs. Development of new fuel and fuel cycles based on the following principles: profiling fuel enrichment in a cross section of fuel assemblies; increase of average fuel enrichment in fuel assemblies; use of refuelling schemes with lower neutron leakage ('in-in-out'); use of integrated fuel gadolinium-based burnable absorber (for a five-year fuel cycle); increase of fuel burnup in fuel assemblies; improving the neutron balance by using structural materials with low neutron absorption; use of zirconium alloy claddings which are highly resistant to irradiation and corrosion. The paper also presents the results of fuel operation. (author)

Fuel Cell Power Plants Renewable and Waste Fuels

Science.gov (United States)

2011-01-13

logo, Direct FuelCell and “DFC” are all registered trademarks (®) of FuelCell Energy, Inc. Applications •On-site self generation of combined heat... of FuelCell Energy, Inc. Fuels Resources for DFC • Natural Gas and LNG • Propane • Biogas (by Anaerobicnaerobic Digestion) - Municipal Waste...FUEL RESOURCES z NATURAL GAS z PROPANE z DFC H2 (50-60%) z ETHANOL zWASTE METHANE z BIOGAS z COAL GAS Diversity of Fuels plus High Efficiency

Fuel-cycle cost comparisons with oxide and silicide fuels

International Nuclear Information System (INIS)

Matos, J.E.; Freese, K.E.

1982-01-01

This paper addresses fuel cycle cost comparisons for a generic 10 MW reactor with HEU aluminide fuel and with LEU oxide and silicide fuels in several fuel element geometries. The intention of this study is to provide a consistent assessment of various design options from a cost point of view. Fuel cycle cost benefits could result if a number of reactors were to utilize fuel elements with the same number or different numbers of the same standard fuel plate. Data are presented to quantify these potential cost benefits. This analysis shows that there are a number of fuel element designs using LEU oxide or silicide fuels that have either the same or lower total fuel cycle costs than the HEU design. Use of these fuels with the uranium densities considered requires that they are successfully demonstrated and licensed

Fuel temperature characteristics of the 37-element and CANFLEX fuel bundle

International Nuclear Information System (INIS)

Bae, Jun Ho; Rho, Gyu Hong; Park, Joo Hwan

2009-10-01

This report describes the fuel temperature characteristics of CANFLEX fuel bundles and 37-element fuel bundles for a different burnup of fuel. The program was consisted for seeking the fuel temperature of fuel bundles of CANFLEX fuel bundles and 37-element fuel bundles by using the method in NUCIRC. Fuel temperature has an increasing pattern with the burnup of fuel for CANFLEX fuel bundles and 37-element fuel bundles. For all the case of burnup, the fuel temperature of CANFLEX fuel bundles has a lower value than that of 37-element fuel bundles. Especially, for the high power channel, the CANFLEX fuel bundles show a lower fuel temperature as much as about 75 degree, and the core averaged fuel temperature has a lower fuel temperature of about 50 degree than that of 37-element fuel bundles. The lower fuel temperature of CANFLEX fuel bundles is expected to enhance the safety by reducing the fuel temperature coefficient. Finally, for each burnup of CANFLEX fuel bundles and 37-element fuel bundles, the equation was present for predicting the fuel temperature of a bundle in terms of a coolant temperature and bundle power

Nuclear fuels

International Nuclear Information System (INIS)

Gangwani, Saloni; Chakrabortty, Sumita

2011-01-01

Nuclear fuel is a material that can be consumed to derive nuclear energy, by analogy to chemical fuel that is burned for energy. Nuclear fuels are the most dense sources of energy available. Nuclear fuel in a nuclear fuel cycle can refer to the fuel itself, or to physical objects (for example bundles composed of fuel rods) composed of the fuel material, mixed with structural, neutron moderating, or neutron reflecting materials. Long-lived radioactive waste from the back end of the fuel cycle is especially relevant when designing a complete waste management plan for SNF. When looking at long-term radioactive decay, the actinides in the SNF have a significant influence due to their characteristically long half-lives. Depending on what a nuclear reactor is fueled with, the actinide composition in the SNF will be different. The following paper will also include the uses. advancements, advantages, disadvantages, various processes and behavior of nuclear fuels

Checklist for transition to new highway fuel(s).

Energy Technology Data Exchange (ETDEWEB)

Risch, C.; Santini, D.J. (Energy Systems)

2011-12-15

Transportation is vital to the U.S. economy and society. As such, U.S. Presidents have repeatedly stated that the nation needs to reduce dependence on petroleum, especially for the highway transportation sector. Throughout history, highway transportation fuel transitions have been completed successfully both in United States and abroad. Other attempts have failed, as described in Appendix A: Historical Highway Fuel Transitions. Planning for a transition is critical because the changes can affect our nation's ability to compete in the world market. A transition will take many years to complete. While it is tempting to make quick decisions about the new fuel(s) of choice, it is preferable and necessary to analyze all the pertinent criteria to ensure that correct decisions are made. Doing so will reduce the number of changes in highway fuel(s). Obviously, changes may become necessary because of occurrences such as significant technology breakthroughs or major world events. With any and all of the possible transitions to new fuel(s), the total replacement of gasoline and diesel fuels is not expected. These conventional fuels are envisioned to coexist with the new fuel(s) for decades, while the revised fuel and vehicle infrastructures are implemented. The transition process must analyze the needs of the primary 'players,' which consist of the customers, the government, the fuel industry, and the automotive industry. To maximize the probability of future successes, the prime considerations of these groups must be addressed. Section 2 presents a succinct outline of the Checklist. Section 3 provides a brief discussion about the groupings on the Checklist.

75 FR 37733 - Regulation of Fuels and Fuel Additives: Modifications to Renewable Fuel Standard Program

Science.gov (United States)

2010-06-30

... Regulation of Fuels and Fuel Additives: Modifications to Renewable Fuel Standard Program AGENCY... direct final rule to amend the Renewable Fuel Standard program requirements on May 10, 2010. Because EPA... Fuel Standard program requirements, published on May 10, 2010. We stated in that direct final rule that...

77 FR 72746 - Regulation of Fuels and Fuel Additives: Modifications to Renewable Fuel Standard and Diesel...

Science.gov (United States)

2012-12-06

... Fuels and Fuel Additives: Modifications to Renewable Fuel Standard and Diesel Sulfur Programs AGENCY... Fuel Standard (``RFS'') program under section 211(o) of the Clean Air Act. The direct final rule also... marine diesel fuel produced by transmix processors, and the fuel marker requirements for 500 ppm sulfur...

Alternate-Fueled Flight: Halophytes, Algae, Bio-, and Synthetic Fuels

Science.gov (United States)

Hendricks, R. C.

2012-01-01

Synthetic and biomass fueling are now considered to be near-term aviation alternate fueling. The major impediment is a secure sustainable supply of these fuels at reasonable cost. However, biomass fueling raises major concerns related to uses of common food crops and grasses (some also called "weeds") for processing into aviation fuels. These issues are addressed, and then halophytes and algae are shown to be better suited as sources of aerospace fuels and transportation fueling in general. Some of the history related to alternate fuels use is provided as a guideline for current and planned alternate fuels testing (ground and flight) with emphasis on biofuel blends. It is also noted that lessons learned from terrestrial fueling are applicable to space missions. These materials represent an update (to 2009) and additions to the Workshop on Alternate Fueling Sustainable Supply and Halophyte Summit at Twinsburg, Ohio, October 17 to 18, 2007.

Increased fuel burn-up and fuel cycle equilibrium

International Nuclear Information System (INIS)

Debes, M.

2001-01-01

Improvement of nuclear competitiveness will rely mainly on increased fuel performance, with higher burn-up, and reactors sustained life. Regarding spent fuel management, the EDF current policy relies on UO 2 fuel reprocessing (around 850 MTHM/year at La Hague) and MOX recycling to ensure plutonium flux adequacy (around 100 MTHM/year, with an electricity production equivalent to 30 TWh). This policy enables to reuse fuel material, while maintaining global kWh economy with existing facilities. It goes along with current perspective to increase fuel burn-up up to 57 GWday/t mean in 2010. The following presentation describes the consequences of higher fuel burn-up on fuel cycle and waste management and implementation of a long term and global equilibrium for decades in spent fuel management resulting from this strategy. (author)

Abiotic versus biotic iron mineral transformation studied by a miniaturized backscattering Mössbauer spectrometer (MIMOS II), X-ray diffraction and Raman spectroscopy

Science.gov (United States)

Markovski, C.; Byrne, J. M.; Lalla, E.; Lozano-Gorrín, A. D.; Klingelhöfer, G.; Rull, F.; Kappler, A.; Hoffmann, T.; Schröder, C.

2017-11-01

Searching for biomarkers or signatures of microbial transformations of minerals is a critical aspect for determining how life evolved on Earth, and whether or not life may have existed in other planets, including Mars. In order to solve such questions, several missions to Mars have sought to determine the geochemistry and mineralogy on the Martian surface. This research includes the two miniaturized Mössbauer spectrometers (MIMOS II) on board the Mars Exploration Rovers Spirit and Opportunity, which have detected a variety of iron minerals on Mars, including magnetite (Fe2+Fe3+2O4) and goethite (α-FeO(OH)). On Earth, both minerals can derive from microbiological activity (e.g. through dissimilatory iron reduction of ferrihydrite by Fe(III)-reducing bacteria). Here we used a lab based MIMOS II to characterize the mineral products of biogenic transformations of ferrihydrite to magnetite by the Fe(III)-reducing bacteria Geobacter sulfurreducens. In combination with Raman spectroscopy and X-ray diffraction (XRD), we observed the formation of magnetite, goethite and siderite. We compared the material produced by biogenic transformations to abiotic samples in order to distinguish abiotic and biotic iron minerals by techniques that are or will be available onboard Martian based laboratories. The results showed the possibility to distinguish the abiotic and biotic origin of the minerals. Mossbauer was able to distinguish the biotic/abiotic magnetite with the interpretation of the geological context (Fe content mineral assemblages and accompanying minerals) and the estimation of the particle size in a non-destructive way. The Raman was able to confirm the biotic/abiotic principal peaks of the magnetite, as well as the organic principal vibration bands attributed to the bacteria. Finally, the XRD confirmed the particle size and mineralogy.

Transport of poly(acrylic acid) coated 2-line ferrihydrite nanoparticles in saturated aquifer sediments for environmental remediation

Science.gov (United States)

Xiang, Aishuang; Zhou, Sheng; Koel, Bruce E.; Jaffé, Peter R.

2014-04-01

Groundwater remediation using iron oxide and zero-valent iron nanoparticles (NPs) can be effective, but is limited in many applications due to the NP strong retention in groundwater-saturated porous media after injection, the passivation of the porous surface, and the high cost of nanomaterials versus macro scale iron. In this study, we investigated transport of bare and polymer-coated 2-line ferrihydrite NPs (30-300 nm) in saturated aquifer sediments. The influence of poly(acrylic acid) (PAA) polymer coatings was studied on the colloidal stability and transport in sediments packed column tests simulating groundwater flow in saturated sediments. In addition, the influence of calcium cations was investigated by transport measurements using sediments with calcium concentrations in the aqueous phase ranging from 0.5 (typical for most sediments) to 2 mM. Measurements were also made of zeta potential, hydrodynamic diameter, polymer adsorption and desorption properties, and bio-availability of PAA-coated NPs. We found that NP transport through the saturated aquifer sediments was improved by PAA coating and that the transport properties could be tuned by adjusting the polymer concentration. We further discovered that PAA coatings enhanced NP transport, compared to bare NPs, in all calcium-containing experiments tested, however, the presence of calcium always exhibited a negative effect on NP transport. In tests of bioavailability, the iron reduction rate of the coated and bare NPs by Geobacter sulfurreducens was the same, which shows that the PAA coating does not significantly reduce NP Fe(III) bioavailability. Our results demonstrate that much improved transport of iron oxide NP can be achieved in saturated aquifer sediments by introducing negatively charged polyelectrolytes and optimizing polymer concentrations, and furthermore, these coated NPs retain their bioavailability that is needed for applications in bio-environmental remediation.

Optimizing Cr(VI) and Tc(VII) remediation through nano-scale biomineral engineering

International Nuclear Information System (INIS)

Cutting, R.S.; Coker, V.S.; Telling, N.D.; Kimber, R.L.; Pearce, C.I.; Ellis, B.; Lawson, R; van der Laan, G.; Pattrick, R.A.D.; Vaughan, D.J.; Arenholz, E.; Lloyd, J.R.

2009-01-01

To optimize the production of biomagnetite for the bioremediation of metal oxyanion contaminated waters, the reduction of aqueous Cr(VI) to Cr(III) by two biogenic magnetites and a synthetic magnetite was evaluated under batch and continuous flow conditions. Results indicate that nano-scale biogenic magnetite produced by incubating synthetic schwertmannite powder in cell suspensions of Geobacter sulfurreducens is more efficient at reducing Cr(VI) than either biogenic nano-magnetite produced from a suspension of ferrihydrite 'gel' or synthetic nano-scale Fe 3 O 4 powder. Although X-ray Photoelectron Spectroscopy (XPS) measurements obtained from post-exposure magnetite samples reveal that both Cr(III) and Cr(VI) are associated with nanoparticle surfaces, X-ray Magnetic Circular Dichroism (XMCD) studies indicate that some Cr(III) has replaced octahedrally coordinated Fe in the lattice of the magnetite. Inductively Coupled Plasma-Atomic Emission Spectrometry (ICP-AES) measurements of total aqueous Cr in the associated solution phase indicated that, although the majority of Cr(III) was incorporated within or adsorbed to the magnetite samples, a proportion (∼10-15 %) was released back into solution. Studies of Tc(VII) uptake by magnetites produced via the different synthesis routes also revealed significant differences between them as regards effectiveness for remediation. In addition, column studies using a γ-camera to obtain real time images of a 99m Tc(VII) radiotracer were performed to visualize directly the relative performances of the magnetite sorbents against ultra-trace concentrations of metal oxyanion contaminants. Again, the magnetite produced from schwertmannite proved capable of retaining more (∼20%) 99m Tc(VII) than the magnetite produced from ferrihydrite, confirming that biomagnetite production for efficient environmental remediation can be fine-tuned through careful selection of the initial Fe(III) mineral substrate supplied to Fe

Fast microbial reduction of ferrihydrite colloids from a soil effluent

Science.gov (United States)

Fritzsche, Andreas; Bosch, Julian; Rennert, Thilo; Heister, Katja; Braunschweig, Juliane; Meckenstock, Rainer U.; Totsche, Kai U.

2012-01-01

Recent studies on the microbial reduction of synthetic iron oxide colloids showed their superior electron accepting property in comparison to bulk iron oxides. However, natural colloidal iron oxides differ in composition from their synthetic counterparts. Besides a potential effect of colloid size, microbial iron reduction may be accelerated by electron-shuttling dissolved organic matter (DOM) as well as slowed down by inhibitors such as arsenic. We examined the microbial reduction of OM- and arsenic-containing ferrihydrite colloids. Four effluent fractions were collected from a soil column experiment run under water-saturated conditions. Ferrihydrite colloids precipitated from the soil effluent and exhibited stable hydrodynamic diameters ranging from 281 (±146) nm in the effluent fraction that was collected first and 100 (±43) nm in a subsequently obtained effluent fraction. Aliquots of these oxic effluent fractions were added to anoxic low salt medium containing diluted suspensions of Geobacter sulfurreducens. Independent of the initial colloid size, the soil effluent ferrihydrite colloids were quickly and completely reduced. The rates of Fe2+ formation ranged between 1.9 and 3.3 fmol h-1 cell-1, and are in the range of or slightly exceeding previously reported rates of synthetic ferrihydrite colloids (1.3 fmol h-1 cell-1), but greatly exceeding previously known rates of macroaggregate-ferrihydrite reduction (0.07 fmol h-1 cell-1). The inhibition of microbial Fe(III) reduction by arsenic is unlikely or overridden by the concurrent enhancement induced by soil effluent DOM. These organic species may have increased the already high intrinsic reducibility of colloidal ferrihydrite owing to quinone-mediated electron shuttling. Additionally, OM, which is structurally associated with the soil effluent ferrihydrite colloids, may also contribute to the higher reactivity due to increasing solubility and specific surface area of ferrihydrite. In conclusion, ferrihydrite

Optimizing Cr(VI) and Tc(VII) remediation through nano-scale biomineral engineering

Energy Technology Data Exchange (ETDEWEB)

Cutting, R. S.; Coker, V. S.; Telling, N. D.; Kimber, R. L.; Pearce, C. I.; Ellis, B.; Lawson, R; van der Laan, G.; Pattrick, R.A.D.; Vaughan, D.J.; Arenholz, E.; Lloyd, J. R.

2009-09-09

To optimize the production of biomagnetite for the bioremediation of metal oxyanion contaminated waters, the reduction of aqueous Cr(VI) to Cr(III) by two biogenic magnetites and a synthetic magnetite was evaluated under batch and continuous flow conditions. Results indicate that nano-scale biogenic magnetite produced by incubating synthetic schwertmannite powder in cell suspensions of Geobacter sulfurreducens is more efficient at reducing Cr(VI) than either biogenic nano-magnetite produced from a suspension of ferrihydrite 'gel' or synthetic nano-scale Fe{sub 3}O{sub 4} powder. Although X-ray Photoelectron Spectroscopy (XPS) measurements obtained from post-exposure magnetite samples reveal that both Cr(III) and Cr(VI) are associated with nanoparticle surfaces, X-ray Magnetic Circular Dichroism (XMCD) studies indicate that some Cr(III) has replaced octahedrally coordinated Fe in the lattice of the magnetite. Inductively Coupled Plasma-Atomic Emission Spectrometry (ICP-AES) measurements of total aqueous Cr in the associated solution phase indicated that, although the majority of Cr(III) was incorporated within or adsorbed to the magnetite samples, a proportion ({approx}10-15 %) was released back into solution. Studies of Tc(VII) uptake by magnetites produced via the different synthesis routes also revealed significant differences between them as regards effectiveness for remediation. In addition, column studies using a {gamma}-camera to obtain real time images of a {sup 99m}Tc(VII) radiotracer were performed to visualize directly the relative performances of the magnetite sorbents against ultra-trace concentrations of metal oxyanion contaminants. Again, the magnetite produced from schwertmannite proved capable of retaining more ({approx}20%) {sup 99m}Tc(VII) than the magnetite produced from ferrihydrite, confirming that biomagnetite production for efficient environmental remediation can be fine-tuned through careful selection of the initial Fe(III) mineral

High density fuels using dispersion and monolithic fuel

Energy Technology Data Exchange (ETDEWEB)

Gomes, Daniel S.; Silva, Antonio T.; Abe, Alfredo Y.; Muniz, Rafael O.R.; Giovedi, Claudia, E-mail: dsgomes@ipen.br, E-mail: teixeira@ipen.br, E-mail: alfredo@ctmsp.mar.mil.br, E-mail: rafael.orm@gmail.com, E-mail: claudia.giovedi@ctmsp.mar.mil.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Universidade de São Paulo (USP), SP (Brazil). Departamento de Engenharia Naval e Oceânica

2017-07-01

Fuel plates used in high-performance research reactors need to be converted to low-enrichment uranium fuel; the fuel option based on a monolithic formulation requires alloys to contain 6 - 10 wt% Mo. In this case, the fuel plates are composed of the metallic alloy U-10Mo surrounded by a thin zirconium layer encapsulated in aluminum cladding. This study reviewed the physical properties of monolithic forms. The constraints produced during the manufacturing process were analyzed and compared to those of dispersed fuel. The bonding process used for dispersion fuels differs from the techniques applied to foil bonding used for pure alloys. The quality of monolithic plates depends on the fabrication method, which usually involves hot isostatic pressing and the thermal annealing effect of residual stress, which degrades the uranium cubic phase. The preservation of the metastable phase has considerable influence on fuel performance. The physical properties of the foil fuel under irradiation are superior to those of aluminum-dispersed fuels. The fuel meat, using zirconium as the diffusion barrier, prevents the interaction layer from becoming excessively thick. The problem with dispersed fuel is breakaway swelling with a medium fission rate. It has been observed that the fuel dispersed in aluminum was minimized in monolithic forms. The pure alloys exhibited a suitable response from a rate at least twice as much as the fission rate of dispersions. The foils can support fissile material concentration combined with a reduced swelling rate. (author)

High density fuels using dispersion and monolithic fuel

International Nuclear Information System (INIS)

Gomes, Daniel S.; Silva, Antonio T.; Abe, Alfredo Y.; Muniz, Rafael O.R.; Giovedi, Claudia; Universidade de São Paulo

2017-01-01

Fuel plates used in high-performance research reactors need to be converted to low-enrichment uranium fuel; the fuel option based on a monolithic formulation requires alloys to contain 6 - 10 wt% Mo. In this case, the fuel plates are composed of the metallic alloy U-10Mo surrounded by a thin zirconium layer encapsulated in aluminum cladding. This study reviewed the physical properties of monolithic forms. The constraints produced during the manufacturing process were analyzed and compared to those of dispersed fuel. The bonding process used for dispersion fuels differs from the techniques applied to foil bonding used for pure alloys. The quality of monolithic plates depends on the fabrication method, which usually involves hot isostatic pressing and the thermal annealing effect of residual stress, which degrades the uranium cubic phase. The preservation of the metastable phase has considerable influence on fuel performance. The physical properties of the foil fuel under irradiation are superior to those of aluminum-dispersed fuels. The fuel meat, using zirconium as the diffusion barrier, prevents the interaction layer from becoming excessively thick. The problem with dispersed fuel is breakaway swelling with a medium fission rate. It has been observed that the fuel dispersed in aluminum was minimized in monolithic forms. The pure alloys exhibited a suitable response from a rate at least twice as much as the fission rate of dispersions. The foils can support fissile material concentration combined with a reduced swelling rate. (author)

Fuel rod behaviour at high burnup WWER fuel cycles

International Nuclear Information System (INIS)

Medvedev, A.; Bogatyr, S.; Kouznetsov, V.; Khvostov, G.; Lagovsky; Korystin, L.; Poudov, V.

2003-01-01

The modernisation of WWER fuel cycles is carried out on the base of complete modelling and experimental justification of fuel rods up to 70 MWd/kgU. The modelling justification of the reliability of fuel rod and fuel rod with gadolinium is carried out with the use of certified START-3 code. START-3 code has a continuous experimental support. The thermophysical and strength reliability of WWER-440 fuel is justified for fuel rod and pellet burnups 65 MWd/kgU and 74 MWd/U, accordingly. Results of analysis are demonstrated by the example of uranium-gadolinium fuel assemblies of second generation under 5-year cycle with a portion of 6-year assemblies and by the example of successfully completed pilot operation of 5-year cycle fuel assemblies during 6 years at unit 3 of Kolskaja NPP. The thermophysical and strength reliability of WWER-1000 fuel is justified for a fuel rod burnup 66 MWd/kgU by the example of fuel operation under 4-year cycles and 6-year test operation of fuel assemblies at unit 1 of Kalininskaya NPP. By the example of 5-year cycle at Dukovany NPP Unit 2 it was demonstrated that WWER fuel rod of a burnup 58 MWd/kgU ensure reliable operation under load following conditions. The analysis has confirmed sufficient reserves of Russian fuel to implement program of JSC 'TVEL' in order to improve technical and economical parameters of WWER fuel cycles

78 FR 62462 - Regulation of Fuels and Fuel Additives: Modifications to Renewable Fuel Standard Program

Science.gov (United States)

2013-10-22

... renewable fuel is defined as fuel produced from renewable biomass that is used to replace or reduce the quantity of fossil fuel present in home heating oil or jet fuel.\\3\\ In essence, additional renewable fuel... of ``home heating oil.'' EPA determined that this term was ambiguous, and defined it by incorporating...

Initial development and structure of biofilms on microbial fuel cell anodes

Directory of Open Access Journals (Sweden)

Keller Jürg

2010-04-01

Full Text Available Abstract Background Microbial fuel cells (MFCs rely on electrochemically active bacteria to capture the chemical energy contained in organics and convert it to electrical energy. Bacteria develop biofilms on the MFC electrodes, allowing considerable conversion capacity and opportunities for extracellular electron transfer (EET. The present knowledge on EET is centred around two Gram-negative models, i.e. Shewanella and Geobacter species, as it is believed that Gram-positives cannot perform EET by themselves as the Gram-negatives can. To understand how bacteria form biofilms within MFCs and how their development, structure and viability affects electron transfer, we performed pure and co-culture experiments. Results Biofilm viability was maintained highest nearer the anode during closed circuit operation (current flowing, in contrast to when the anode was in open circuit (soluble electron acceptor where viability was highest on top of the biofilm, furthest from the anode. Closed circuit anode Pseudomonas aeruginosa biofilms were considerably thinner compared to the open circuit anode (30 ± 3 μm and 42 ± 3 μm respectively, which is likely due to the higher energetic gain of soluble electron acceptors used. The two Gram-positive bacteria used only provided a fraction of current produced by the Gram-negative organisms. Power output of co-cultures Gram-positive Enterococcus faecium and either Gram-negative organisms, increased by 30-70% relative to the single cultures. Over time the co-culture biofilms segregated, in particular, Pseudomonas aeruginosa creating towers piercing through a thin, uniform layer of Enterococcus faecium. P. aeruginosa and E. faecium together generated a current of 1.8 ± 0.4 mA while alone they produced 0.9 ± 0.01 and 0.2 ± 0.05 mA respectively. Conclusion We postulate that this segregation may be an essential difference in strategy for electron transfer and substrate capture between the Gram-negative and the Gram

Fuel processing

International Nuclear Information System (INIS)

Allardice, R.H.

1990-01-01

The technical and economic viability of the fast breeder reactor as an electricity generating system depends not only upon the reactor performance but also on a capability to recycle plutonium efficiently, reliably and economically through the reactor and fuel cycle facilities. Thus the fuel cycle is an integral and essential part of the system. Fuel cycle research and development has focused on demonstrating that the challenging technical requirements of processing plutonium fuel could be met and that the sometimes conflicting requirements of the fuel developer, fuel fabricator and fuel reprocessor could be reconciled. Pilot plant operation and development and design studies have established both the technical and economic feasibility of the fuel cycle but scope for further improvement exists through process intensification and flowsheet optimization. These objectives and the increasing processing demands made by the continuing improvement to fuel design and irradiation performance provide an incentive for continuing fuel cycle development work. (author)

Low contaminant formic acid fuel for direct liquid fuel cell

Science.gov (United States)

Masel, Richard I [Champaign, IL; Zhu, Yimin [Urbana, IL; Kahn, Zakia [Palatine, IL; Man, Malcolm [Vancouver, CA

2009-11-17

A low contaminant formic acid fuel is especially suited toward use in a direct organic liquid fuel cell. A fuel of the invention provides high power output that is maintained for a substantial time and the fuel is substantially non-flammable. Specific contaminants and contaminant levels have been identified as being deleterious to the performance of a formic acid fuel in a fuel cell, and embodiments of the invention provide low contaminant fuels that have improved performance compared to known commercial bulk grade and commercial purified grade formic acid fuels. Preferred embodiment fuels (and fuel cells containing such fuels) including low levels of a combination of key contaminants, including acetic acid, methyl formate, and methanol.

Fuel gases

International Nuclear Information System (INIS)

Anon.

1996-01-01

This paper gives a brief presentation of the context, perspectives of production, specificities, and the conditions required for the development of NGV (Natural Gas for Vehicle) and LPG-f (Liquefied Petroleum Gas fuel) alternative fuels. After an historical presentation of 80 years of LPG evolution in vehicle fuels, a first part describes the economical and environmental advantages of gaseous alternative fuels (cleaner combustion, longer engines life, reduced noise pollution, greater natural gas reserves, lower political-economical petroleum dependence..). The second part gives a comparative cost and environmental evaluation between the available alternative fuels: bio-fuels, electric power and fuel gases, taking into account the processes and constraints involved in the production of these fuels. (J.S.)

Fuel quality issues in stationary fuel cell systems.

Energy Technology Data Exchange (ETDEWEB)

Papadias, D.; Ahmed, S.; Kumar, R. (Chemical Sciences and Engineering Division)

2012-02-07

Fuel cell systems are being deployed in stationary applications for the generation of electricity, heat, and hydrogen. These systems use a variety of fuel cell types, ranging from the low temperature polymer electrolyte fuel cell (PEFC) to the high temperature solid oxide fuel cell (SOFC). Depending on the application and location, these systems are being designed to operate on reformate or syngas produced from various fuels that include natural gas, biogas, coal gas, etc. All of these fuels contain species that can potentially damage the fuel cell anode or other unit operations and processes that precede the fuel cell stack. These detrimental effects include loss in performance or durability, and attenuating these effects requires additional components to reduce the impurity concentrations to tolerable levels, if not eliminate the impurity entirely. These impurity management components increase the complexity of the fuel cell system, and they add to the system's capital and operating costs (such as regeneration, replacement and disposal of spent material and maintenance). This project reviewed the public domain information available on the impurities encountered in stationary fuel cell systems, and the effects of the impurities on the fuel cells. A database has been set up that classifies the impurities, especially in renewable fuels, such as landfill gas and anaerobic digester gas. It documents the known deleterious effects on fuel cells, and the maximum allowable concentrations of select impurities suggested by manufacturers and researchers. The literature review helped to identify the impurity removal strategies that are available, and their effectiveness, capacity, and cost. A generic model of a stationary fuel-cell based power plant operating on digester and landfill gas has been developed; it includes a gas processing unit, followed by a fuel cell system. The model includes the key impurity removal steps to enable predictions of impurity breakthrough

Fuel cells for electricity generation from carbonaceous fuels

Energy Technology Data Exchange (ETDEWEB)

Ledjeff-Hey, K; Formanski, V; Roes, J [Gerhard-Mercator- Universitaet - Gesamthochschule Duisburg, Fachbereich Maschinenbau/Fachgebiet Energietechnik, Duisburg (Germany); Heinzel, A [Fraunhofer Inst. for Solar Energy Systems (ISE), Freiburg (Germany)

1998-09-01

Fuel cells, which are electrochemical systems converting chemical energy directly into electrical energy with water and heat as by-products, are of interest as a means of generating electricity which is environmentally friendly, clean and highly efficient. They are classified according to the electrolyte used. The main types of cell in order of operating temperature are described. These are: alkaline fuel cells, the polymer electrolyte membrane fuel cell (PEMFC); the phosphoric acid fuel cell (PAFC); the molten carbonate fuel cell (MCFC); the solid oxide fuel cell (SOFC). Applications depend on the type of cell and may range from power generation on a large scale to mobile application in cars or portable systems. One of the most promising options is the PEM-fuel cell stack where there has been significant improvement in power density in recent years. The production from carbonaceous fuels and purification of the cell fuel, hydrogen, is considered. Of the purification methods available, hydrogen separation by means of palladium alloy membranes seems particular effective in reducing CO concentrations to the low levels required for PEM cells. (UK)

Fuel cells : a viable fossil fuel alternative

Energy Technology Data Exchange (ETDEWEB)

Paduada, M.

2007-02-15

This article presented a program initiated by Natural Resources Canada (NRCan) to develop proof-of-concept of underground mining vehicles powered by fuel cells in order to eliminate emissions. Recent studies on American and Canadian underground mines provided the basis for estimating the operational cost savings of switching from diesel to fuel cells. For the Canadian mines evaluated, the estimated ventilation system operating cost reductions ranged from 29 per cent to 75 per cent. In order to demonstrate the viability of a fuel cell-powered vehicle, NRCan has designed a modified Caterpillar R1300 loader with a 160 kW hybrid power plant in which 3 stacks of fuel cells deliver up to 90 kW continuously, and a nickel-metal hydride battery provides up to 70 kW. The battery subsystem transiently boosts output to meet peak power requirements and also accommodates regenerative braking. Traction for the loader is provided by a brushless permanent magnet traction motor. The hydraulic pump motor is capable of a 55 kW load continuously. The loader's hydraulic and traction systems are operated independently. Future fuel cell-powered vehicles designed by the program may include a locomotive and a utility vehicle. Future mines running their operations with hydrogen-fueled equipment may also gain advantages by employing fuel cells in the operation of handheld equipment such as radios, flashlights, and headlamps. However, the proton exchange membrane (PEM) fuel cells used in the project are prohibitively expensive. The catalytic content of a fuel cell can add hundreds of dollars per kW of electric output. Production of catalytic precious metals will be strongly connected to the scale of use and acceptance of fuel cells in vehicles. In addition, the efficiency of hydrogen production and delivery is significantly lower than the well-to-tank efficiency of many conventional fuels. It was concluded that an adequate hydrogen infrastructure will be required for the mining industry

Fuel cracking in relation to fuel oxidation in support of an out-reactor instrumented defected fuel experiment

Energy Technology Data Exchange (ETDEWEB)

Quastel, A.; Thiriet, C. [Atomic Energy of Canada Limited, Chalk River, ON (Canada); Lewis, B., E-mail: brent.lewis@uoit.ca [Univ. of Ontario Inst. of Tech., Oshawa, ON (Canada); Corcoran, E., E-mail: emily.corcoran@rmc.ca [Royal Military College of Canada, Kingston, ON (Canada)

2014-07-01

An experimental program funded by the CANDU Owners Group (COG) is studying an out-reactor instrumented defected fuel experiment in Stern Laboratories (Hamilton, Ontario) with guidance from Atomic Energy of Canada Limited (AECL). The objective of this test is to provide experimental data for validation of a mechanistic fuel oxidation model. In this experiment a defected fuel element with UO{sub 2} pellets will be internally heated with an electrical heater element, causing the fuel to crack. By defecting the sheath in-situ the fuel will be exposed to light water coolant near normal reactor operating conditions (pressure 10 MPa and temperature 265-310{sup o}C) causing fuel oxidation, especially near the hotter regions of the fuel in the cracks. The fuel thermal conductivity will change, resulting in a change in the temperature distribution of the fuel element. This paper provides 2D r-θ plane strain solid mechanics models to simulate fuel thermal expansion, where conditions for fuel crack propagation are investigated with the thermal J integral to predict fuel crack stress intensity factors. Finally since fuel crack geometry can affect fuel oxidation this paper shows that the solid mechanics model with pre-set radial cracks can be coupled to a 2D r-θ fuel oxidation model. (author)

Fuel characteristics pertinent to the design of aircraft fuel systems

Science.gov (United States)

Barnett, Henry C; Hibbard, R R

1953-01-01

Because of the importance of fuel properties in design of aircraft fuel systems the present report has been prepared to provide information on the characteristics of current jet fuels. In addition to information on fuel properties, discussions are presented on fuel specifications, the variations among fuels supplied under a given specification, fuel composition, and the pertinence of fuel composition and physical properties to fuel system design. In some instances the influence of variables such as pressure and temperature on physical properties is indicated. References are cited to provide fuel system designers with sources of information containing more detail than is practicable in the present report.

On the nuclear fuel and fossil fuel reserves

International Nuclear Information System (INIS)

Fettweis, G.

1978-01-01

A short discussion of the nuclear fuel and fossil fuel reserves and the connected problem of prices evolution is presented. The need to regard fuel production under an economic aspect is emphasized. Data about known and assessed fuel reserves, world-wide and with special consideration of Austria, are reviewed. It is concluded that in view of the fuel reserves situation an energy policy which allows for a maximum of options seems adequate. (G.G.)

Fuel R and D to improve fuel reliability

International Nuclear Information System (INIS)

Yang, Rosa; Cheng, Bo; Deshon, Jeff; Edsinger, Kurt; Ozer, Odelli

2006-01-01

Light water reactor fuel is operating in an increasingly challenging environment. Fuel burnup extension and cycle length increase both can increase the local duty. Reactor water chemistry modifications for the purpose of protection the plant system materials have the potential of increasing fuel surface deposition and cladding corrosion and hydriding. The status of fuel performance in US reactors is summarized and an update of the Fuel Reliability Program' established by the utility industry to ensure reliability is provided. (author)

Instrumentation of fuel elements and fuel plates

International Nuclear Information System (INIS)

Durand, J.P.; Fanjas, Y.

1993-01-01

When controlling the behaviour of a reactor or developing a new fuel concept, it is of utmost interest to have the possibility to confirm the thermohydraulic calculations by actual measurements in the fuel elements or in the fuel plates. For years, CERCA has developed the technology and supplied its customers with fuel elements equipped with pressure or temperature measuring devices according to the requirements. Recent customer projects have led to the development of a new method to introduce thermocouples directly into the fuel plate meat instead of the cladding. The purpose of this paper is to review the various instrumentation possibilities available at CERCA. (author)

Instrumentation of fuel elements and fuel plates

International Nuclear Information System (INIS)

Durand, J.P.; Fanjas, Y.

1994-01-01

When controlling the behaviour of a reactor or developing a new fuel concept, it is of utmost interest to have the possibility to confirm the thermohydraulic calculations by actual measurements in the fuel elements or in the fuel plates. For years, CERCA has developed the technology and supplied its customers with fuel elements equipped with pressure or temperature measuring devices according to the requirements. Recent customer projects have lead to the development of a new method to introduce thermocouples directly into the fuel plate meat instead of the cladding. The purpose of this paper is to review the various instrumentation possibilities available at CERCA. (author)

Alternative Fuels Data Center: Biodiesel Fueling Stations

Science.gov (United States)

Locations Infrastructure Development Vehicles Laws & Incentives Biodiesel Fueling Stations Photo of a location or along a route. Infrastructure Development Learn about biodiesel fueling infrastructure codes Case Studies California Ramps Up Biofuels Infrastructure Green Fueling Station Powers Fleets in Upstate

Fuel assembly

International Nuclear Information System (INIS)

Nomata, Terumitsu.

1993-01-01

Among fuel pellets to be loaded to fuel cans of a fuel assembly, fuel pellets having a small thermal power are charged in a region from the end of each of spacers up to about 50mm on the upstream of coolants that flow vertically at the periphery of fuel rods. Coolants at the periphery of fuel rods are heated by the heat generation, to result in voids. However, since cooling effect on the upstream of the spacers is low due to influences of the spacers. Further, since the fuel pellets disposed in the upstream region have small thermal power, a void coefficient is not increased. Even if a thermal power exceeding cooling performance should be generated, there is no worry of causing burnout in the upstream region. Even if burnout should be caused, safety margin and reliability relative to burnout are improved, to increase an allowable thermal power, thereby enabling to improve integrity and reliability of fuel rods and fuel assemblies. (N.H.)

Fuel assembly

International Nuclear Information System (INIS)

Gjertsen, R.K.; Bassler, E.A.; Huckestein, E.A.; Salton, R.B.; Tower, S.N.

1988-01-01

A fuel assembly adapted for use with a pressurized water nuclear reactor having capabilities for fluid moderator spectral shift control is described comprising: parallel arranged elongated nuclear fuel elements; means for providing for axial support of the fuel elements and for arranging the fuel elements in a spaced array; thimbles interspersed among the fuel elements adapted for insertion of a rod control cluster therewithin; means for structurally joining the fuel elements and the guide thimbles; fluid moderator control means for providing a volume of low neutron absorbing fluid within the fuel assembly and for removing a substantially equivalent volume of reactor coolant water therefrom, a first flow manifold at one end of the fuel assembly sealingly connected to a first end of the moderator control tubes whereby the first ends are commonly flow connected; and a second flow manifold, having an inlet passage and an outlet passage therein, sealingly connected to a second end of the moderator control tubes at a second end of the fuel assembly

Alternative Fuels Data Center: Ethanol Fueling Stations

Science.gov (United States)

... More in this section... Ethanol Basics Benefits & Considerations Stations Locations Infrastructure fueling stations by location or along a route. Infrastructure Development Learn about ethanol fueling infrastructure; codes, standards, and safety; and ethanol equipment options. Maps & Data E85 Fueling Station

Apparatus and method for grounding compressed fuel fueling operator

Science.gov (United States)

Cohen, Joseph Perry; Farese, David John; Xu, Jianguo

2002-06-11

A safety system for grounding an operator at a fueling station prior to removing a fuel fill nozzle from a fuel tank upon completion of a fuel filling operation is provided which includes a fuel tank port in communication with the fuel tank for receiving and retaining the nozzle during the fuel filling operation and a grounding device adjacent to the fuel tank port which includes a grounding switch having a contact member that receives physical contact by the operator and where physical contact of the contact member activates the grounding switch. A releasable interlock is included that provides a lock position wherein the nozzle is locked into the port upon insertion of the nozzle into the port and a release position wherein the nozzle is releasable from the port upon completion of the fuel filling operation and after physical contact of the contact member is accomplished.

Nuclear fuel

International Nuclear Information System (INIS)

D Hondt, P.

1998-01-01

The research and development programme on nuclear fuel at the Belgian Nuclear Research Centre SCK/CEN is described. The objective of this programme is to enhance the quantitative prediction of the operational limits of nuclear fuel and to assess the behaviour of fuel under incidental and accidental conditions. Progress is described in different domains including the modelling of fission gas release in LWR fuel, thermal conductivity, basic physical phenomena, post-irradiation examination for fuel performance assessment, and conceptual studies of incidental and accidental fuel experiments

Automotive Fuel Processor Development and Demonstration with Fuel Cell Systems

Energy Technology Data Exchange (ETDEWEB)

Nuvera Fuel Cells

2005-04-15

The potential for fuel cell systems to improve energy efficiency and reduce emissions over conventional power systems has generated significant interest in fuel cell technologies. While fuel cells are being investigated for use in many applications such as stationary power generation and small portable devices, transportation applications present some unique challenges for fuel cell technology. Due to their lower operating temperature and non-brittle materials, most transportation work is focusing on fuel cells using proton exchange membrane (PEM) technology. Since PEM fuel cells are fueled by hydrogen, major obstacles to their widespread use are the lack of an available hydrogen fueling infrastructure and hydrogen's relatively low energy storage density, which leads to a much lower driving range than conventional vehicles. One potential solution to the hydrogen infrastructure and storage density issues is to convert a conventional fuel such as gasoline into hydrogen onboard the vehicle using a fuel processor. Figure 2 shows that gasoline stores roughly 7 times more energy per volume than pressurized hydrogen gas at 700 bar and 4 times more than liquid hydrogen. If integrated properly, the fuel processor/fuel cell system would also be more efficient than traditional engines and would give a fuel economy benefit while hydrogen storage and distribution issues are being investigated. Widespread implementation of fuel processor/fuel cell systems requires improvements in several aspects of the technology, including size, startup time, transient response time, and cost. In addition, the ability to operate on a number of hydrocarbon fuels that are available through the existing infrastructure is a key enabler for commercializing these systems. In this program, Nuvera Fuel Cells collaborated with the Department of Energy (DOE) to develop efficient, low-emission, multi-fuel processors for transportation applications. Nuvera's focus was on (1) developing fuel

Fluid pressure method for recovering fuel pellets from nuclear fuel elements

International Nuclear Information System (INIS)

John, C.D. Jr.

1979-01-01

A method is described for removing fuel pellets from a nuclear fuel element without damaging the fuel pellets or fuel element sheath so that both may be reused. The method comprises holding the fuel element while a high pressure stream internally pressurizes the fuel element to expand the fuel element sheath away from the fuel pellets therein so that the fuel pellets may be easily removed

Nuclear Fuel elements

International Nuclear Information System (INIS)

Hirakawa, Hiromasa.

1979-01-01

Purpose: To reduce the stress gradient resulted in the fuel can in fuel rods adapted to control the axial power distribution by the combination of fuel pellets having different linear power densities. Constitution: In a fuel rod comprising a first fuel pellet of a relatively low linear power density and a second fuel pellet of a relatively high linear power density, the second fuel pellet is cut at its both end faces by an amount corresponding to the heat expansion of the pellet due to the difference in the linear power density to the adjacent first fuel pellet. Thus, the second fuel pellet takes a smaller space than the first fuel pellet in the fuel can. This can reduce the stress produced in the portion of the fuel can corresponding to the boundary between the adjacent fuel pellets. (Kawakami, Y.)

77 FR 61313 - Regulation of Fuels and Fuel Additives: Modifications to Renewable Fuel Standard and Diesel...

Science.gov (United States)

2012-10-09

... transportation fuels, including gasoline and diesel fuel, or renewable fuels such as ethanol and biodiesel, as... that which arose under RFS1 for certain renewable fuels (in particular biodiesel) that were produced...

Fuel assembly

International Nuclear Information System (INIS)

Fujibayashi, Toru.

1970-01-01

Herein disclosed is a fuel assembly in which a fuel rod bundle is easily detachable by rotating a fuel rod fastener rotatably mounted to the upper surface of an upper tie-plate supporting a fuel bundle therebelow. A locking portion at the leading end of each fuel rod protrudes through the upper tie-plate and is engaged with or separated from the tie-plate by the rotation of the fastener. The removal of a desired fuel rod can therefore be remotely accomplished without the necessity of handling pawls, locking washers and nuts. (Owens, K.J.)

75 FR 14669 - Regulation of Fuels and Fuel Additives: Changes to Renewable Fuel Standard Program

Science.gov (United States)

2010-03-26

... RINs from producers of the renewable fuel. The obligated parties do not need lead time for construction... fuels and new limits on renewable biomass feedstocks. This rulemaking marks the first time that... advanced biofuel and multiple cellulosic-based fuels with their 60% threshold. Additional fuel pathways...

Fuel property effects on Navy aircraft fuel systems

Science.gov (United States)

Moses, C. A.

1984-01-01

Problems of ensuring compatibility of Navy aircraft with fuels that may be different than the fuels for which the equipment was designed and qualified are discussed. To avoid expensive requalification of all the engines and airframe fuel systems, methodologies to qualify future fuels by using bench-scale and component testing are being sought. Fuel blends with increasing JP5-type aromatic concentration were seen to produce less volume swell than an equivalent aromatic concentration in the reference fuel. Futhermore, blends with naphthenes, decalin, tetralin, and naphthalenes do not deviate significantly from the correlation line of aromatic blends, Similar results are found with tensile strenth and elongation. Other elastomers, sealants, and adhesives are also being tested.

Characterization of fuel swelling in helium-bonded carbide fuel pins

International Nuclear Information System (INIS)

Louie, D.L.Y.

1987-08-01

This work is not only the first attempt at characterizing the swelling of (U,Pu)C fuel pellets, but it also represents the only detailed examinations on carbide fuel swelling at high fuel burnups (4 to 16 at. %). This characterization includes the contributions of fission gases, cracks and solid fission products to fuel swelling. Significantly, the contributions of fission gases and cracks were determined by using the image analysis technique (IAT) which allows researchers to take areal measurements of the irradiated fuel porosity and cracks from the photographs of metallographic fuel samples. However, because areal measurements for varying depths in the fuel pellet could not be obtained, the crack areal measurements could not be converted into volumetric quantities. Consequently, in this situation, an areal fuel swelling analysis was used. The macroscopic fission-gas induced fuel swelling (MAS) caused by fission-gas bubbles and pores > 1 μm was determined using the measured irradiated fuel porosity because the measuring range of IAT is limited to bubbles and pores >1 μm. Conversely, for fuel swelling induced by fission-gas bubbles < 1 μm, the microscopic fission-gas induced fuel swelling (MIS) was estimated using an areal fuel swelling model

KMRR fuel design

International Nuclear Information System (INIS)

Son, D.S.; Sim, B.S.; Kim, T.R.; Hwang, W.; Kim, B.G.; Ku, Y.H.; Lee, C.B.; Lim, I.C.

1992-06-01

KMRR fuel rod design criteria on fuel swelling, blistering and oxide spallation have been reexamined. Fuel centerline temperature limit of 250deg C in normal operation condition and fuel swelling limit of 12 % at the end of life have been proposed to prevent fuel failure due to excessive fuel swelling. Fuel temperature limit of 485deg C has been proposed to exclude the possibility of fuel failures during transients or under accident condition. Further analyses are needed to decide the fuel cladding temperature limit to preclude the oxide spallation. Design changes in fuel assembly structure and their effects on related systems have been reviewed from a structural integrity viewpoint. The remained works in fuel mechanical design area have been identified and further efforts of fuel design group will be focused on these aspects. (Author)

Fuel cycle cost comparisons with oxide and silicide fuels

Energy Technology Data Exchange (ETDEWEB)

Matos, J E; Freese, K E [RERTR Program, Argonne National Laboratory (United States)

1983-09-01

This paper addresses fuel cycle cost comparisons for a generic 10 MW reactor with HEU aluminide fuel and with LEU oxide and silicide fuels in several fuel element geometries. The intention of this study is to provide a consistent assessment of various design options from a cost point of view. The status of the development and demonstration of the oxide and silicide fuels are presented in several papers in these proceedings. Routine utilization of these fuels with the uranium densities considered here requires that they are successfully demonstrated and licensed. Thermal-hydraulic safety margins, shutdown margins, mixed cores, and transient analyses are not addressed here, but analyses of these safety issues are in progress for a limited number of the most promising design options. Fuel cycle cost benefits could result if a number of reactors were to utilize fuel elements with the same number or different numbers of the same standard fuel plate. Data is presented to quantify these potential cost benefits. This analysis shows that there are a number of fuel element designs using LEU oxide or silicide fuels that have either the same or lower total fuel cycle costs than the HEU design. Use of these fuels with the uranium densities considered requires that they are successfully demonstrated and licensed. All safety criteria for the reactor with these fuel element designs need to be satisfied as well. With LEU oxide fuel, 31 g U/cm{sup 3} 1 and 0.76 mm--thick fuel meat, elements with 18-22 plates 320-391 g {sup 235}U) result in the same or lower total costs than with the HEU element 23 plates, 280 g {sup 235}U). Higher LEU loadings (more plates per element) are needed for larger excess reactivity requirements. However, there is little cost advantage to using more than 20 of these plates per element. Increasing the fuel meat thickness from 0.76 mm to 1.0 mm with 3.1 g U/cm{sup 3} in the design with 20 plates per element could result in significant cost reductions if the

76 FR 18066 - Regulation of Fuels and Fuel Additives: Changes to Renewable Fuel Standard Program

Science.gov (United States)

2011-04-01

... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 80 Regulation of Fuels and Fuel Additives: Changes to Renewable Fuel Standard Program CFR Correction In Title 40 of the Code of Federal Regulations, Parts 72 to...-generating foreign producers and importers of renewable fuels for which RINs have been generated by the...

Review of the IAEA nuclear fuel cycle and material section activities connected with nuclear fuel including WWER fuel

International Nuclear Information System (INIS)

Sokolov, F.

2001-01-01

Program activities on Nuclear Fuel Cycle and Materials cover the areas of: 1) raw materials (B.1.01); 2) fuel performance and technology (B.1.02); 3) pent fuel (B.1.03); 4) fuel cycle issues and information system (B.1.04); 5) support to technical cooperation activities (B.1.05). The IAEA activities in fuel performance and technology in 2001 include organization of the fuel experts meetings and completion of the Co-ordinate Research Projects (CRP). The special attention is given to the advanced post-irradiation examination techniques for water reactor fuel and fuel behavior under transients and LOCA conditions. An international research program on modeling of activity transfer in primary circuit of NPP is finalized in 2001. A new CRP on fuel modeling at extended burnup (FUMEX II) has planed to be carried out during the period 2002-2006. In the area of spent fuel management the implementation of burnup credit (BUC) in spent fuel management systems has motivated to be used in criticality safety applications, based on economic consideration. An overview of spent fuel storage policy accounting new fuel features as higher enrichment and final burnup, usage of MOX fuel and prolongation of the term of spent fuel storage is also given

Increasing TRIGA fuel lifetime with 12 wt.% U TRIGA fuel

Energy Technology Data Exchange (ETDEWEB)

Naughton, W F; Cenko, M J; Levine, S H; Witzig, W F [Pennsylvania State University (United States)

1974-07-01

In-core fuel management studies have been performed for the Penn State Breazeale Reactor (PSBR) wherein 12 wt % U fuel elements are used to replace the standard 8.5 wt % U TRIGA fuel. The core configuration used to develop a calculational model was a 90-element hexagonal array, which is representative of the PSBR core, and consists of five hexagonal rings surrounding a central thimble containing water. The technique employed for refueling the core fully loaded with 8.5 wt % U fuel involves replacing 8.5 wt % U fuel with 12 wt % U fuel using an in-out reloading scheme. A batch reload consists of 6 new 12 wt % U fuel elements. Placing the 12 wt % U fuel in the B ring produces fuel temperatures ({approx}450 {sup o}C) that are well below the 800{sup o}C maximum limitation when the PSBR is operating at its maximum allowed power of 1 Megawatt. The advantages of using new 12 wt % U fuel to replace the burned up 8.5 wt % U fuel in the B ring over refueling strictly with 8.5 wt % U-Zr TRIGA fuel are clearly delineated in Table 1 where cost calculations used the General Atomic pre-1972 prices for TRIGA fuel, i.e., $1500 and $1650 for an 8.5 and 12 wt % U fuel element, respectively. Experimental results obtained to date utilizing the 12 wt % U fuel elements agree with the computed results. (author)

Progress of the DUPIC Fuel Compatibility Analysis (IV) - Fuel Performance

International Nuclear Information System (INIS)

Choi, Hang Bok; Ryu, Ho Jin; Roh, Gyu Hong; Jeong, Chang Joon; Park, Chang Je; Song, Kee Chan; Lee, Jung Won

2005-10-01

This study describes the mechanical compatibility of the direct use of spent pressurized water reactor (PWR) fuel in Canada deuterium uranium (CANDU) reactors (DUPIC) fuel, when it is loaded into a CANDU reactor. The mechanical compatibility can be assessed for the fuel management, primary heat transport system, fuel channel, and the fuel handling system in the reactor core by both the experimental and analytic methods. Because the physical dimensions of the DUPIC fuel bundle adopt the CANDU flexible (CANFLEX) fuel bundle design which has already been demonstrated for a commercial use in CANDU reactors, the experimental compatibility analyses focused on the generation of material property data and the irradiation tests of the DUPIC fuel, which are used for the computational analysis. The intermediate results of the mechanical compatibility analysis have shown that the integrity of the DUPIC fuel is mostly maintained under the high power and high burnup conditions even though some material properties like the thermal conductivity is a little lower compared to the uranium fuel. However it is required to slightly change the current DUPIC fuel design to accommodate the high internal pressure of the fuel element. It is also strongly recommended to perform more irradiation tests of the DUPIC fuel to accumulate a database for the demonstration of the DUPIC fuel performance in the CANDU reactor

Progress of the DUPIC Fuel Compatibility Analysis (IV) - Fuel Performance

Energy Technology Data Exchange (ETDEWEB)

Choi, Hang Bok; Ryu, Ho Jin; Roh, Gyu Hong; Jeong, Chang Joon; Park, Chang Je; Song, Kee Chan; Lee, Jung Won

2005-10-15

This study describes the mechanical compatibility of the direct use of spent pressurized water reactor (PWR) fuel in Canada deuterium uranium (CANDU) reactors (DUPIC) fuel, when it is loaded into a CANDU reactor. The mechanical compatibility can be assessed for the fuel management, primary heat transport system, fuel channel, and the fuel handling system in the reactor core by both the experimental and analytic methods. Because the physical dimensions of the DUPIC fuel bundle adopt the CANDU flexible (CANFLEX) fuel bundle design which has already been demonstrated for a commercial use in CANDU reactors, the experimental compatibility analyses focused on the generation of material property data and the irradiation tests of the DUPIC fuel, which are used for the computational analysis. The intermediate results of the mechanical compatibility analysis have shown that the integrity of the DUPIC fuel is mostly maintained under the high power and high burnup conditions even though some material properties like the thermal conductivity is a little lower compared to the uranium fuel. However it is required to slightly change the current DUPIC fuel design to accommodate the high internal pressure of the fuel element. It is also strongly recommended to perform more irradiation tests of the DUPIC fuel to accumulate a database for the demonstration of the DUPIC fuel performance in the CANDU reactor.

Fuel cycle cost study with HEU and LEU fuels

International Nuclear Information System (INIS)

Matos, J.E.; Freese, K.E.

1984-01-01

Fuel cycle costs are compared for a range of 235 U loadings with HEU and LEU fuels using the IAEA generic 10 MW reactor as an example. If LEU silicide fuels are successfully demonstrated and licensed, the results indicate that total fuel cycle costs can be about the same or lower than those with the HEU fuels that are currently used in most research reactors

Influence of ammonium availability on expression of nifD and amtB genes during biostimulation of a U(VI) contaminated aquifer: implications for U(VI) removal and monitoring the metabolic state of Geobacteraceae

Energy Technology Data Exchange (ETDEWEB)

Mouser, Paula J.; N' Guessan, A. Lucie; Elifantz, Hila; Holmes, Dawn E.; Williams, Kenneth H; Wilkins, Michael J.; Long, Philip E.; Lovley, Derek R.

2009-03-25

The influence of ammonium availability on bacterial community structure and the physiological status of Geobacter species during in situ bioremediation of uranium-contaminated groundwater was evaluated. Ammonium concentrations varied by 2 orders of magnitude (<4 to 400 ?M) across the study site. Analysis of 16S rRNA sequences suggested that ammonium may have been one factor influencing the community composition prior to acetate amendment with Rhodoferax species predominating over Geobacter species with higher ammonium and Dechloromonas species dominating at the site with lowest ammonium. However, once acetate was added and dissimilatory metal reduction was stimulated, Geobacter species became the predominant organisms at all locations. Rates of U(VI) reduction appeared to be more related to acetate concentrations rather than ammonium levels. In situ mRNA transcript abundance of the nitrogen fixation gene, nifD, and the ammonium transporter gene, amtB, in Geobacter species indicated that ammonium was the primary source of nitrogen during uranium reduction. The abundance of amtB was inversely correlated to ammonium levels, whereas nifD transcript levels were similar across all sites examined. These results suggest that nifD and amtB expression are closely regulated in response to ammonium availability to ensure an adequate supply of nitrogen while conserving cell resources. Thus, quantifying nifD and amtB transcript expression appears to be a useful approach for monitoring the nitrogen-related physiological status of subsurface Geobacter species. This study also emphasizes the need for more detailed analysis of geochemical and physiological interactions at the field scale in order to adequately model subsurface microbial processes during bioremediation.

Inert matrix fuel in dispersion type fuel elements

Energy Technology Data Exchange (ETDEWEB)

Savchenko, A.M. [A.A. Bochvar All-Russia Research Institute of Inorganic Materials (VNIINM) 123060, P.O. Box 369, Rogova Street, 5A, Moscow (Russian Federation)]. E-mail: sav@bochvar.ru; Vatulin, A.V. [A.A. Bochvar All-Russia Research Institute of Inorganic Materials (VNIINM) 123060, P.O. Box 369, Rogova Street, 5A, Moscow (Russian Federation); Morozov, A.V. [A.A. Bochvar All-Russia Research Institute of Inorganic Materials (VNIINM) 123060, P.O. Box 369, Rogova Street, 5A, Moscow (Russian Federation); Sirotin, V.L. [A.A. Bochvar All-Russia Research Institute of Inorganic Materials (VNIINM) 123060, P.O. Box 369, Rogova Street, 5A, Moscow (Russian Federation); Dobrikova, I.V. [A.A. Bochvar All-Russia Research Institute of Inorganic Materials (VNIINM) 123060, P.O. Box 369, Rogova Street, 5A, Moscow (Russian Federation); Kulakov, G.V. [A.A. Bochvar All-Russia Research Institute of Inorganic Materials (VNIINM) 123060, P.O. Box 369, Rogova Street, 5A, Moscow (Russian Federation); Ershov, S.A. [A.A. Bochvar All-Russia Research Institute of Inorganic Materials (VNIINM) 123060, P.O. Box 369, Rogova Street, 5A, Moscow (Russian Federation); Kostomarov, V.P. [A.A. Bochvar All-Russia Research Institute of Inorganic Materials (VNIINM) 123060, P.O. Box 369, Rogova Street, 5A, Moscow (Russian Federation); Stelyuk, Y.I. [A.A. Bochvar All-Russia Research Institute of Inorganic Materials (VNIINM) 123060, P.O. Box 369, Rogova Street, 5A, Moscow (Russian Federation)

2006-06-30

The advantages of using inert matrix fuel (IMF) as a dispersion fuel in an aluminium alloy matrix are considered, in particular, low temperatures in the fuel centre, achievable high burn-ups, serviceability in transients and an environmentally friendly process of fuel rod fabrication. Two main versions of IMF are under development at A.A. Bochvar Institute, i.e. heterogeneous or isolated distribution of plutonium. The out-of-pile results on IMF loaded with uranium dioxide as plutonium simulator are presented. Fuel elements with uranium dioxide composition fabricated at A.A. Bochvar Institute are currently under MIR tests (RIAR, Dimitrovgrad). The fuel elements reached a burn-up of 88 MW d kg{sup -1} (equivalent to the burn up of the standard uranium dioxide pelletized fuel) without loss of leak-tightness of the cladding. The feasibility of fabricating IMF of these particular types with plutonium dioxide is considered with a view to in-pile irradiation.

Inert matrix fuel in dispersion type fuel elements

Science.gov (United States)

Savchenko, A. M.; Vatulin, A. V.; Morozov, A. V.; Sirotin, V. L.; Dobrikova, I. V.; Kulakov, G. V.; Ershov, S. A.; Kostomarov, V. P.; Stelyuk, Y. I.

2006-06-01

The advantages of using inert matrix fuel (IMF) as a dispersion fuel in an aluminium alloy matrix are considered, in particular, low temperatures in the fuel centre, achievable high burn-ups, serviceability in transients and an environmentally friendly process of fuel rod fabrication. Two main versions of IMF are under development at A.A. Bochvar Institute, i.e. heterogeneous or isolated distribution of plutonium. The out-of-pile results on IMF loaded with uranium dioxide as plutonium simulator are presented. Fuel elements with uranium dioxide composition fabricated at A.A. Bochvar Institute are currently under MIR tests (RIAR, Dimitrovgrad). The fuel elements reached a burn-up of 88 MW d kg-1 (equivalent to the burn up of the standard uranium dioxide pelletized fuel) without loss of leak-tightness of the cladding. The feasibility of fabricating IMF of these particular types with plutonium dioxide is considered with a view to in-pile irradiation.

Fuel Cell and Hydrogen Technology Validation | Hydrogen and Fuel Cells |

Science.gov (United States)

NREL Fuel Cell and Hydrogen Technology Validation Fuel Cell and Hydrogen Technology Validation The NREL technology validation team works on validating hydrogen fuel cell electric vehicles; hydrogen fueling infrastructure; hydrogen system components; and fuel cell use in early market applications such as

Advanced fuel cycles and burnup increase of WWER-440 fuel

International Nuclear Information System (INIS)

Proselkov, V.; Saprykin, V.; Scheglov, A.

2003-01-01

Analyses of operational experience of 4.4% enriched fuel in the 5-year fuel cycle at Kola NPP Unit 3 and fuel assemblies with Uranium-Gadolinium fuel at Kola NPP Unit 4 are made. The operability of WWER-440 fuel under high burnup is studied. The obtained results indicate that the fuel rods of WWER-440 assemblies intended for operation within six years of the reviewed fuel cycle totally preserve their operability. Performed analyses have demonstrated the possibility of the fuel rod operability during the fuel cycle. 12 assemblies were loaded into the reactor unit of Kola 3 in 2001. The predicted burnup in six assemblies was 59.2 MWd/kgU. Calculated values of the burnup after operation for working fuel assemblies were ∼57 MWd/kgU, for fuel rods - up to ∼61 MWd/kgU. Data on the coolant activity, specific activity of the benchmark iodine radionuclides of the reactor primary circuit, control of the integrity of fuel rods of the assemblies that were operated for six years indicate that not a single assembly has reached the criterion for the early discharge

Nuclear fuel management via fuel quality factor averaging

International Nuclear Information System (INIS)

Mingle, J.O.

1978-01-01

The numerical procedure of prime number averaging is applied to the fuel quality factor distribution of once and twice-burned fuel in order to evolve a fuel management scheme. The resulting fuel shuffling arrangement produces a near optimal flat power profile both under beginning-of-life and end-of-life conditions. The procedure is easily applied requiring only the solution of linear algebraic equations. (author)

Alternative Fuels Data Center: Krug Energy Opens Natural Gas Fueling

Science.gov (United States)

Station in Arkansas Krug Energy Opens Natural Gas Fueling Station in Arkansas to someone by E -mail Share Alternative Fuels Data Center: Krug Energy Opens Natural Gas Fueling Station in Arkansas on Facebook Tweet about Alternative Fuels Data Center: Krug Energy Opens Natural Gas Fueling Station in

Romanian nuclear fuel fabrication and in-reactor fuel operational experience

International Nuclear Information System (INIS)

Budan, O.

2003-01-01

A review of the Romanian nuclear program since mid 60's is made. After 1990, the new Romanian nuclear power authority, RENEL-GEN, elaborated a realistic Nuclear Fuel Program. This program went through the Romanian nuclear fuel plant qualification with the Canadian (AECL and ZPI) support, restarting in January 1995 of the industrial nuclear fuel production, quality evaluation of the fuel produced before 1990 and the recovery of this fuel. This new policy produced good results. FCN is since 1995 the only CANDU fuel supplier from outside Canada recognised by AECL as an authorised CANDU fuel manufacturer. The in-reactor performances and behaviour of the fuel manufactured by FCN after its qualification have been excellent. Very low - more then five times lesser than the design value - fuel defect rate has been recorded up to now and the average discharge of this fuel was with about 9% greater than the design value. Since mid 1998 when SNN took charge of the production of nuclear generated electricity, FCN made significant progresses in development and procurement of new and more efficient equipment and is now very close to double its fuel production capacity. After the completion of the recovery of the fuel produced before June 1990, FCN is already prepared to shift its fuel production to the so-called 'heavy' bundle containing about 19.3 kg of Uranium per bundle

Potential for Methanosarcina to contribute to uranium reduction during acetate-promoted groundwater bioremediation

DEFF Research Database (Denmark)

Holmes, Dawn E; Orellana, Roberto; Giloteaux, Ludovic

2018-01-01

Previous studies of acetate-promoted bioremediation of uranium-contaminated aquifers focused on Geobacter because no other microorganisms that can couple the oxidation of acetate with U(VI) reduction had been detected in situ. Monitoring the levels of methyl CoM reductase subunit A (mcrA) transcr......Previous studies of acetate-promoted bioremediation of uranium-contaminated aquifers focused on Geobacter because no other microorganisms that can couple the oxidation of acetate with U(VI) reduction had been detected in situ. Monitoring the levels of methyl CoM reductase subunit A (mcr......(VI) reduction was observed in inactive controls. These results demonstrate that Methanosarcina species could play an important role in the long-term bioremediation of uranium-contaminated aquifers after depletion of Fe(III) oxides limits the growth of Geobacter species. The results also suggest...

Specialists' meeting on gas-cooled reactor fuel development and spent fuel treatment

Energy Technology Data Exchange (ETDEWEB)

NONE

1985-07-01

Topics covered during the 'Specialists' meeting on gas-cooled reactor fuel development and spent fuel treatment' were as follows: Selection of constructions and materials, fuel element development concepts; Fabrication of spherical coated fuel particles and fuel element on their base; investigation of fuel properties; Spent fuel treatment and storage; Head-end processing of HTGR fuel elements; investigation of HTGR fuel regeneration process; applicability of gas-fluorine technology of regeneration of spent HTGR fuel elements.

Specialists' meeting on gas-cooled reactor fuel development and spent fuel treatment

International Nuclear Information System (INIS)

1985-01-01

Topics covered during the 'Specialists' meeting on gas-cooled reactor fuel development and spent fuel treatment' were as follows: Selection of constructions and materials, fuel element development concepts; Fabrication of spherical coated fuel particles and fuel element on their base; investigation of fuel properties; Spent fuel treatment and storage; Head-end processing of HTGR fuel elements; investigation of HTGR fuel regeneration process; applicability of gas-fluorine technology of regeneration of spent HTGR fuel elements

Fuel assembly

International Nuclear Information System (INIS)

Watanabe, Shoichi; Hirano, Yasushi.

1998-01-01

A one-half or more of entire fuel rods in a fuel assembly comprises MOX fuel rods containing less than 1wt% of burnable poisons, and at least a portion of the burnable poisons comprises gadolinium. Then, surplus reactivity at an initial stage of operation cycle is controlled to eliminate burnable poisons remained unburnt at a final stage, as well as increase thermal reactivity. In addition, the content of fission plutonium is determined to greater than the content of uranium 235, and fuel rods at corner portions are made not to incorporate burnable poisons. Fuel rods not containing burnable poisons are disposed at positions in adjacent with fuel rods facing to a water rod at one or two directions. Local power at radial center of the fuel assembly is increased to flatten the distortion of radial power distribution. (N.H.)

Fuels Combustion Research: Supercritical Fuel Pyrolysis

National Research Council Canada - National Science Library

Glassman, Irvin

2001-01-01

.... The focus during the subject period was directed to understanding the pyrolysis and combustion of endothermic fuels under subcritical conditions and the pyrolysis of these fuels under supercritical conditions...

Fuels Combustion Research: Supercritical Fuel Pyrolysis

National Research Council Canada - National Science Library

Glassman, Irvin

2000-01-01

.... The focus during the subject period was directed to understanding the pyrolysis and combustion of endothermic fuels under subcritical conditions and the pyrolysis of these fuels under supercritical conditions...

CERDEC Fuel Cell Team: Military Transitions for Soldier Fuel Cells

Science.gov (United States)

2008-10-27

Fuel Cell (DMFC) (PEO Soldier) Samsung: 20W DMFC (CRADA) General Atomics & Jadoo: 50W Ammonia Borane Fueled PEMFC Current Fuel Cell Team Efforts...Continued Ardica: 20W Wearable PEMFC operating on Chemical Hydrides Spectrum Brands w/ Rayovac: Hydrogen Generators and Alkaline Fuel Cells for AA...100W Ammonia Borane fueled PEMFC Ultralife: 150W sodium borohydride fueled PEMFC Protonex: 250W RMFC and Power Manager (ARO) NanoDynamics: 250W SOFC

Feasibility study on AFR-100 fuel conversion from uranium-based fuel to thorium-based fuel

Energy Technology Data Exchange (ETDEWEB)

Heidet, F.; Kim, T.; Grandy, C. (Nuclear Engineering Division)

2012-07-30

Although thorium has long been considered as an alternative to uranium-based fuels, most of the reactors built to-date have been fueled with uranium-based fuel with the exception of a few reactors. The decision to use uranium-based fuels was initially made based on the technology maturity compared to thorium-based fuels. As a result of this experience, lot of knowledge and data have been accumulated for uranium-based fuels that made it the predominant nuclear fuel type for extant nuclear power. However, following the recent concerns about the extent and availability of uranium resources, thorium-based fuels have regained significant interest worldwide. Thorium is more abundant than uranium and can be readily exploited in many countries and thus is now seen as a possible alternative. As thorium-based fuel technologies mature, fuel conversion from uranium to thorium is expected to become a major interest in both thermal and fast reactors. In this study the feasibility of fuel conversion in a fast reactor is assessed and several possible approaches are proposed. The analyses are performed using the Advanced Fast Reactor (AFR-100) design, a fast reactor core concept recently developed by ANL. The AFR-100 is a small 100 MW{sub e} reactor developed under the US-DOE program relying on innovative fast reactor technologies and advanced structural and cladding materials. It was designed to be inherently safe and offers sufficient margins with respect to the fuel melting temperature and the fuel-cladding eutectic temperature when using U-10Zr binary metal fuel. Thorium-based metal fuel was preferred to other thorium fuel forms because of its higher heavy metal density and it does not need to be alloyed with zirconium to reduce its radiation swelling. The various approaches explored cover the use of pure thorium fuel as well as the use of thorium mixed with transuranics (TRU). Sensitivity studies were performed for the different scenarios envisioned in order to determine the

40 CFR 600.206-93 - Calculation and use of fuel economy values for gasoline-fueled, diesel-fueled, electric, alcohol...

Science.gov (United States)

2010-07-01

... EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1977 and Later Model Year Automobiles-Procedures... equivalent petroleum-based fuel economy value exists for an electric vehicle configuration, all values for... values for gasoline-fueled, diesel-fueled, electric, alcohol-fueled, natural gas-fueled, alcohol dual...

Overview of the CANDU fuel handling system for advanced fuel cycles

International Nuclear Information System (INIS)

Koivisto, D.J.; Brown, D.R.

1997-01-01

Because of its neutron economies and on-power re-fuelling capabilities the CANDU system is ideally suited for implementing advanced fuel cycles because it can be adapted to burn these alternative fuels without major changes to the reactor. The fuel handling system is adaptable to implement advanced fuel cycles with some minor changes. Each individual advanced fuel cycle imposes some new set of special requirements on the fuel handling system that is different from the requirements usually encountered in handling the traditional natural uranium fuel. These changes are minor from an overall plant point of view but will require some interesting design and operating changes to the fuel handling system. Some preliminary conceptual design has been done on the fuel handling system in support of these fuel cycles. Some fuel handling details were studies in depth for some of the advanced fuel cycles. This paper provides an overview of the concepts and design challenges. (author)

BWR fuel performance

International Nuclear Information System (INIS)

Baily, W.E.; Armijo, J.S.; Jacobson, J.; Proebstle, R.A.

1979-01-01

The General Electric experience base on BWR fuel includes over 29,000 fuel assemblies which contain 1,600,000 fuel rods. Over the last five years, design, process and operating changes have been introduced which have had major effects in improving fuel performance. Monitoring this fuel performance in BWRs has been accomplished through cooperative programs between GE and utilities. Activities such as plant fission product monitoring, fuel sipping and fuel and channel surveillance programs have jointly contributed to the value of this extensive experience base. The systematic evaluation of this data has established well-defined fuel performance trends which provide the assurance and confidence in fuel reliability that only actual operating experience can provide

Fuel Cycle Concept with Advanced METMET and Composite Fuel in LWRs

International Nuclear Information System (INIS)

Savchenko, A.; Skupov, M.; Vatulin, A.; Glushenkov, A.; Kulakov, G.; Lipkina, K.

2014-01-01

The basic factor that limits the serviceability of fuel elements developing in the framework of RERTR Program (transition from HEU to LEU fuel of research reactors) is interaction between U10Mo fuel and aluminium matrix . Interaction results in extra swelling of fuels, disappearance of a heat conducting matrix, a temperature rise in the fuel centre, penetration porosity, etc. Several methods exist to prevent fuel-matrix interaction. In terms of simplifying fuel element fabrication technology and reducing interaction, doping of fuel is the most optimal version

Nuclear-fuel-cycle costs. Consolidated Fuel-Reprocessing Program

International Nuclear Information System (INIS)

Burch, W.D.; Haire, M.J.; Rainey, R.H.

1981-01-01

The costs for the back-end of the nuclear fuel cycle, which were developed as part of the Nonproliferation Alternative Systems Assessment Program (NASAP), are presented. Total fuel-cycle costs are given for the pressurized-water reactor once-through and fuel-recycle systems, and for the liquid-metal fast-breeder-reactor system. These calculations show that fuel-cycle costs are a small part of the total power costs. For breeder reactors, fuel-cycle costs are about half that of the present once-through system. The total power cost of the breeder-reactor system is greater than that of light-water reactor at today's prices for uranium and enrichment

Nuclear fuel production

International Nuclear Information System (INIS)

Randol, A.G.

1985-01-01

The production of new fuel for a power plant reactor and its disposition following discharge from the power plant is usually referred to as the ''nuclear fuel cycle.'' The processing of fuel is cyclic in nature since sometime during a power plant's operation old or ''depleted'' fuel must be removed and new fuel inserted. For light water reactors this step typically occurs once every 12-18 months. Since the time required for mining of the raw ore to recovery of reusable fuel materials from discharged materials can span up to 8 years, the management of fuel to assure continuous power plant operation requires simultaneous handling of various aspects of several fuel cycles, for example, material is being mined for fuel to be inserted in a power plant 2 years into the future at the same time fuel is being reprocessed from a discharge 5 years prior. Important aspects of each step in the fuel production process are discussed

Proceedings of fuel strategies for conventional and unconventional fuels

International Nuclear Information System (INIS)

Mahr, D.; Nechvatal, T.T.

1991-01-01

Fuel selection is a major decision for a power engineer. It is the single largest item in the power plant operating budget and has a major effect on power plant economics. Fuel determines plant design requirements and the types of systems that are provided. As a result, it affects capital budgets and financing requirements. In the last few decades, we have seen different fuels of choice at any one time. Coal has always been a staple for power generation. During the 1950s and 1960s, oil became an attractive alternative. Nuclear fuel became a popular choice due to its very low energy cost. After Three-Mile-Island, however, capital budgets went through the roof, resulting in severe financial constraints. Natural gas, which was rationed in some regions a few years ago, is now a popular choice. Some sources predict that its cost will increase faster than other fuels. To mitigate the relative variations in energy cost for different fuels, a balanced energy plan is required. A balanced power generation plan with fuel options provides the flexibility to react to unpredictable changes. The papers in this book are a continuation of the Fuel Strategies theme. Three technical topics are covered: Converting to Orimulsion, A Replacement Fuel for Heavy Oil; Innovations in Handling Conventional and Unconventional Fuels for Power Plants; and Pacific Rim Experience With Coal

Containing method for spent fuel and spent fuel containing vessel

International Nuclear Information System (INIS)

Maekawa, Hiromichi; Hanada, Yoshine.

1996-01-01

Upon containing spent fuels, a metal vessel main body and a support spacer having fuel containing holes are provided. The support spacer is disposed in the inside of the metal vessel main body, and spent fuel assemblies are loaded in the fuel containing holes. Then, a lid is welded at the opening of the metal vessel main body to provide a sealing state. In this state, heat released from the spent fuel assemblies is transferred to the wall of the metal vessel main body via the support spacer. Since the support spacer has a greater heat conductivity than gases, heat of the spent fuel assemblies tends to be released to the outside, thereby capable of removing heat of the spent fuel assemblies effectively. In addition, since the surfaces of the spent fuel assemblies are in contact with the inner surface of the fuel containing holes of the support spacer, impact-resistance and earthquake-resistance are ensured, and radiation from the spent fuel assemblies is decayed by passing through the layer of the support spacer. (T.M.)

Fuel assembly

International Nuclear Information System (INIS)

Ueda, Makoto; Ogiya, Shunsuke.

1989-01-01

For improving the economy of a BWR type reactor by making the operation cycle longer, the fuel enrichment degree has to be increased further. However, this makes the subcriticality shallower in the upper portion of the reactor core, to bring about a possibility that the reactor shutdown becomes impossible. In the present invention, a portion of fuel rod is constituted as partial length fuel rods (P-fuel rods) in which the entire stack length in the effective portion is made shorter by reducing the concentration of fissionable materials in the axial portion. A plurality of moderator rods are disposed at least on one diagonal line of a fuel assembly and P-fuel rods are arranged at a position put between the moderator rods. This makes it possible to reactor shutdown and makes the axial power distribution satisfactory even if the fuel enrichment degree is increased. (T.M.)

Fuel Services

International Nuclear Information System (INIS)

Silberstein, A.

1982-09-01

FRAGEMA has developed most types of inspection equipments to work on irradiated fuel assemblies and on single fuel rods during reactor outages with an efficiency compatible with the utilities operating priorities. In order to illustrate this statement, two specific examples of inspection equipments are shortly described: the on-site removable fuel rod assembly examination stand, and the fuel assembly multiple examination device. FRAGEMA has developed techniques for the identifiction of the leaking fuel rods in the fuel assembly and the tooling necessary to perform the replacement of the faulted element. These examples of methods, techniques and equipments described and the experience accumulated through their use allow FRAGEMA to qualify for offering the supply of the corresponding software, hardware or both whenever an accurate understanding of the fuel behaviour is necessary and whenever direct intervention on the assembly and associated components is necessary due to safety, operating or economical reasons

Reactor fueling system

International Nuclear Information System (INIS)

Hattori, Noriaki; Hirano, Haruyoshi.

1983-01-01

Purpose: To optimally position a fuel catcher by mounting a television camera to a fuel catching portion and judging video images by the use of a computer or the like. Constitution: A television camera is mounted to the lower end of a fuel catching mechanism for handling nuclear fuels and a fuel assembly disposed within a reactor core or a fuel storage pool is observed directly from above to judge the position for the fuel assembly by means of video signals. Then, the relative deviation between the actual position of the fuel catcher and that set in a memory device is determined and the positional correction is carried out automatically so as to reduce the determined deviation to zero. This enables to catch the fuel assembly without failure and improves the efficiency for the fuel exchange operation. (Moriyama, K.)

Nuclear fuel elements

International Nuclear Information System (INIS)

Nakai, Keiichi

1983-01-01

Purpose: To decrease the tensile stresses resulted in a fuel can as well as prevent decladding of fuel pellets into the bore holes by decreasing the inner pressure within the nuclear fuel element. Constitution: A fuel can is filled with hollow fuel pellets, inserted with a spring for retaining the hollow fuel pellets with an appropriate force and, thereafter, closely sealed at the both ends with end plugs. A cylindrical body is disposed into the bore holes of the hollow fuel pellets. Since initial sealing gases and/or gaseous nuclear fission products can thus be excluded from the bore holes where the temperature is at the highest level, the inner pressure of the nuclear fuel element can be reduced to decrease the tensile strength resulted to the fuel can. Furthermore, decladding of fuel pellets into the bore holes can be prevented. (Moriyama, K.)

Recent IAEA activities on CANDU-PHWR fuels and fuel cycles

International Nuclear Information System (INIS)

Inozemtsev, V.; Ganguly, C.

2005-01-01

Pressurized Heavy Water Reactors (PHWR), widely known as CANDU, are in operation in Argentina, Canada, China, India, Pakistan, Republic of Korea and Romania and account for about 6% of the world's nuclear electricity production. The CANDU reactor and its fuel have several unique features, like horizontal calandria and coolant tubes, on-power fuel loading, thin-walled collapsible clad coated with graphite on the inner surface, very high density (>96%TD) natural uranium oxide fuel and amenability to slightly enriched uranium oxide, mixed uranium plutonium oxide (MOX), mixed thorium plutonium oxide, mixed thorium uranium (U-233) oxide and inert matrix fuels. Several Technical Working Groups (TWG) of IAEA periodically discuss and review CANDU reactors, its fuel and fuel cycle options. These include TWGs on water-cooled nuclear power reactor Fuel Performance and Technology (TWGFPT), on Nuclear Fuel Cycle Options and spent fuel management (TWGNFCO) and on Heavy Water Reactors (TWGHWR). In addition, IAEA-INPRO project also covers Advanced CANDU Reactors (ACR) and DUPIC fuel cycles. The present paper summarises the Agency's activities in CANDU fuel and fuel cycle, highlighting the progress during the last two years. In the past we saw HWR and LWR technologies and fuel cycles separate, but nowadays their interaction is obviously growing, and their mutual influence may have a synergetic character if we look at the world nuclear fuel cycle as at an integrated system where the both are important elements in line with fast neutron, gas cooled and other advanced reactors. As an international organization the IAEA considers this challenge and makes concrete steps to tackle it for the benefit of all Member States. (author)

LPG fuel

International Nuclear Information System (INIS)

Dagnas, F.X.; Jeuland, N.; Fouquet, J.P.; Lauraire, S.; Coroller, P.

2005-01-01

LPG fuel has become frequently used through a distribution network with 2 000 service stations over the French territory. LPG fuel ranks number 3 world-wide given that it can be used on individual vehicles, professional fleets, or public transport. What is the environmental benefit of LPG fuel? What is the technology used for these engines? What is the current regulation? Government commitment and dedication on support to promote LPG fuel? Car makers projects? Actions to favour the use of LPG fuel? This article gathers 5 presentations about this topic given at the gas conference

Spent fuel management and closed nuclear fuel cycle

International Nuclear Information System (INIS)

Kudryavtsev, E.G.

2012-01-01

Strategic objectives set by Rosatom Corporation in the field of spent fuel management are given. By 2030, Russia is to create technological infrastructure for innovative nuclear energy development, including complete closure of the nuclear fuel cycle. A target model of the spent NPP nuclear fuel management system until 2030 is analyzed. The schedule for key stages of putting in place the infrastructure for spent NPP fuel management is given. The financial aspect of the problem is also discussed [ru

Nuclear fuels and development of nuclear fuel elements

International Nuclear Information System (INIS)

Sundaram, C.V.; Mannan, S.L.

1989-01-01

Safe, reliable and economic operation of nuclear fission reactors, the source of nuclear power at present, requires judicious choice, careful preparation and specialised fabrication procedures for fuels and fuel element structural materials. These aspects of nuclear fuels (uranium, plutonium and their oxides and carbides), fuel element technology and structural materials (aluminium, zircaloy, stainless steel etc.) are discussed with particular reference to research and power reactors in India, e.g. the DHRUVA research reactor at BARC, Trombay, the pressurised heavy water reactors (PHWR) at Rajasthan and Kalpakkam, and the Fast Breeder Test Reactor (FBTR) at Kalpakkam. Other reactors like the gas-cooled reactors operating in UK are also mentioned. Because of the limited uranium resources, India has opted for a three-stage nuclear power programme aimed at the ultimate utilization of her abundant thorium resources. The first phase consists of natural uranium dioxide-fuelled, heavy water-moderated and cooled PHWR. The second phase was initiated with the attainment of criticality in the FBTR at Kalpakkam. Fast Breeder Reactors (FBR) utilize the plutonium and uranium by-products of phase 1. Moreover, FBR can convert thorium into fissile 233 U. They produce more fuel than is consumed - hence, the name breeders. The fuel parameters of some of the operating or proposed fast reactors in the world are compared. FBTR is unique in the choice of mixed carbides of plutonium and uranium as fuel. Factors affecting the fuel element performance and life in various reactors e.g. hydriding of zircaloys, fuel pellet-cladding interaction etc. in PHWR and void swelling; irradiation creep and helium embrittlement of fuel element structural materials in FBR are discussed along with measures to overcome some of these problems. (author). 15 refs., 9 tabs., 23 figs

Automobile Buyer Decisions about Fuel Economy and Fuel Efficiency

OpenAIRE

Kurani, Ken; Turrentine, Thomas

2004-01-01

Much prior research into consumer automotive and fuel purchase behaviors and fuel economy has been shaped by the normative assumptions of economics. Among these assumptions are that consumers should pay attention to costs of fuel and that they are aware of their options to save on fuel over long periods of time, i.e., the life of a vehicle or at least their period of ownership. For example, researchers have analyzed in some depth consumer choices for more fuel economical vehicles in the 1980s...

Development of PEM fuel cell technology at international fuel cells

Energy Technology Data Exchange (ETDEWEB)

Wheeler, D.J.

1996-04-01

The PEM technology has not developed to the level of phosphoric acid fuel cells. Several factors have held the technology development back such as high membrane cost, sensitivity of PEM fuel cells to low level of carbon monoxide impurities, the requirement to maintain full humidification of the cell, and the need to pressurize the fuel cell in order to achieve the performance targets. International Fuel Cells has identified a hydrogen fueled PEM fuel cell concept that leverages recent research advances to overcome major economic and technical obstacles.

Thermochemical aspects of fuel-cladding and fuel-coolant interactions in LMFBR oxide fuel pins

International Nuclear Information System (INIS)

Adamson, M.G.; Aitken, E.A.; Caputi, R.W.; Potter, P.E.; Mignanelli, M.A.

1979-01-01

This paper examines several thermochemical aspects of the fuel-cladding, fuel-coolant and fuel-fission product interactions that occur in LMFBR austenitic stainless steel-clad mixed (U,Pu)-oxide fuel pins during irradiation under normal operating conditions. Results are reported from a variety of high temperature EMF cell experiments in which continuous oxygen activity measurements on reacting and equilibrium mixtures of metal oxides and (excess) liquid alkali metal (Na, K, Cs) were performed. Oxygen potential and 0:M thresholds for Na-fuel reactions are re-evaluated in the light of new measurements and newly-assessed thermochemical data, and the influence on oxygen potential of possible U-Pu segregation between oxide and urano-plutonate (equilibrium) phases has been analyzed. (orig./RW) [de

Fuel charging machine

International Nuclear Information System (INIS)

Uchikawa, Sadao.

1978-01-01

Purpose: To enable continuous fuel discharging and charging steps in a bwr type reactor by effecting positioning only for once by providing a plurality of fuel assembly grippers and their drives co-axially on a rotatable surface. Constitution: A plurality of fuel assembly grippers and their drives are provided co-axially on a rotatable surface. For example, a gripper A, a drive B, a gripper C and a drive D are arranged co-axially in symmetric positions on a disk rotated on rails by wheels and rotational drives. A new fuel in a fuel pool is gripped by the gripper A and transported above the reactor core. Then, the disk is positioned so that the gripper C can grip the spent fuel in the core, and the fuel to be discharged is gripped and raised by the gripper C. Then the disk is rotated by 180 0 and the new fuel in the gripper A is charged into the position from which the old fuel has been discharged and, finally, the discharged fuel is sent to the fuel pool for storage. (Seki, T.)

Alternative Fuels

Science.gov (United States)

Alternative fuels include gaseous fuels such as hydrogen, natural gas, and propane; alcohols such as ethanol, methanol, and butanol; vegetable and waste-derived oils; and electricity. Overview of alternative fuels is here.

Elongated fuel road

International Nuclear Information System (INIS)

Williams, A.E.; Linkison, W.S.

1977-01-01

A fuel rod is proposed where a reorientation of the fuel in case of a considerable temperature increase, causing the melting of the densified fuel powder, will be avoided. For this purpose, in longitudinal direction of the fuel rod, a number of diameter reductions of the can are applied of certain distances. In the reduction zone the cross-sectional area of the fuel is reduced, as compared to the one of the remaining fuel material in the regions without diameter reduction, but not the density of the fuel. The recess is chosen to that in case of melting of the fuel in the center of the not contracted zone the fuel in the center of the narrowed area will remain solid and keep the molten material in position. (HR) [de

Blending Biodiesel in Fishing Boat Fuels for Improved Fuel Characteristics

International Nuclear Information System (INIS)

Lin, Cherng-Yuan

2014-01-01

Biodiesel is a renewable, clean, alternative energy source with advantages, such as excellent lubricity, superior biodegradability, and high combustion efficiency. Biodiesel is considered for mixing with fishing boat fuels to adjust their fuel characteristics so that toxic pollutants and greenhouse-effect gas emissions from such shipping might be reduced. The effects of blending fishing boat fuels A and B with various weight proportions of biodiesel are experimentally investigated in this study. The results show that biodiesel blending can significantly improve the inferior fuel properties of both fishing boat fuels and particularly fuel B. The flash points of both of these fuels increases significantly with the addition of biodiesel and thus enhances the safety of transporting and storing these blended fuels. The flash point of fishing boat fuel B even increases by 16% if 25 wt.% biodiesel is blended. The blending of biodiesel with no sulfur content is found to be one of the most effective ways to reduce the high sulfur content of fishing boat fuel, resulting in a reduction in the emission of sulfur oxides. The addition of only 25 wt.% biodiesel decreased the sulfur content of the fishing boat fuel by 37%. The high kinematic viscosity of fishing boat fuel B was also observed to be reduced by 63% with the blending of just 25 wt.% biodiesel. However, biodiesel blending caused a slight decrease in heating value around 1–4.5%.

Blending Biodiesel in Fishing Boat Fuels for Improved Fuel Characteristics

Energy Technology Data Exchange (ETDEWEB)

Lin, Cherng-Yuan, E-mail: lin7108@ntou.edu.tw [Department of Marine Engineering, National Taiwan Ocean University, Keelung, Taiwan (China)

2014-02-24

Biodiesel is a renewable, clean, alternative energy source with advantages, such as excellent lubricity, superior biodegradability, and high combustion efficiency. Biodiesel is considered for mixing with fishing boat fuels to adjust their fuel characteristics so that toxic pollutants and greenhouse-effect gas emissions from such shipping might be reduced. The effects of blending fishing boat fuels A and B with various weight proportions of biodiesel are experimentally investigated in this study. The results show that biodiesel blending can significantly improve the inferior fuel properties of both fishing boat fuels and particularly fuel B. The flash points of both of these fuels increases significantly with the addition of biodiesel and thus enhances the safety of transporting and storing these blended fuels. The flash point of fishing boat fuel B even increases by 16% if 25 wt.% biodiesel is blended. The blending of biodiesel with no sulfur content is found to be one of the most effective ways to reduce the high sulfur content of fishing boat fuel, resulting in a reduction in the emission of sulfur oxides. The addition of only 25 wt.% biodiesel decreased the sulfur content of the fishing boat fuel by 37%. The high kinematic viscosity of fishing boat fuel B was also observed to be reduced by 63% with the blending of just 25 wt.% biodiesel. However, biodiesel blending caused a slight decrease in heating value around 1–4.5%.

Fuel Cell and Hydrogen Technologies Program | Hydrogen and Fuel Cells |

Science.gov (United States)

NREL Fuel Cell and Hydrogen Technologies Program Fuel Cell and Hydrogen Technologies Program Through its Fuel Cell and Hydrogen Technologies Program, NREL researches, develops, analyzes, and validates fuel cell and hydrogen production, delivery, and storage technologies for transportation

Canadian CANDU fuel development program and recent fuel operating experience

International Nuclear Information System (INIS)

Lau, J.H.K.; Inch, W.W.R.; Cox, D.S.; Steed, R.G.; Kohn, E.; Macici, N.N.

1999-01-01

This paper reviews the performance of the CANDU fuel in the Canadian CANDU reactors in 1997 and 1998. The operating experience demonstrates that the CANDU fuel has performed very well. Over the 2-year period, the fuel-bundle defect rate for all bundles irradiated in the Canadian CANDU reactors has remained very low, at between 0.006% to 0.016%. On a fuel element basis, this represents an element defect rate of less than about 0.0005%. One of the reasons for the good fuel performance is the support provided by the Canadian fuel research and development programs. These programs address operational issues and provide evolutionary improvements to the fuel products. The programs consist of the Fuel Technology Program, funded by the CANDU Owners Group, and the Advanced Fuel and Fuel Cycles Technology Program, funded by Atomic Energy of Canada Ltd. These 2 programs, which have been in place for many years, complement each other by sharing expert resources and experimental facilities. This paper describes the programs in 1999/2000, to provide an overview of the scope of the programs and the issues that these programs address. (author)

Safe handling of renewable fuels and fuel mixtures

Energy Technology Data Exchange (ETDEWEB)

Wilen, C; Rautalin, A [VTT Energy, Espoo (Finland)

1997-12-01

VTT Energy has for several years carried out co-operation with many European research institutes on contractional basis on safety issues of fuels handling. A two-year co-operational project between VTT Energy and these research institutes was started in EU`s JOULE 3 programme in 1996, the total budget of which is 6.9 million FIM. Dust explosion testing method for `difficult` fuels, and for tests at elevated pressures and temperatures, will be developed in the task `Safe handling of renewable fuels and fuel mixtures`. Self- ignition and dust-explosion characteristics will be generated for wood and agro-biomass based biomasses and for the mixtures of them and coal. Inertization requirements will be studied, and the quenching method, combined with partial inertization, will be tested in 1.0 m{sup 3} test equipment. The ignition properties of the fuels under normal and elevated pressures will be characterised with thermobalances. The self-ignition tests with wood and forest residue dusts at 25 bar pressure have been carried out as scheduled. In addition to this, several fuels have undergone thermobalance tests, sieve analyses and microscopic studies for the characterisation of the fuels

Leak testing fuel stored in the ICPP fuel storage basin

International Nuclear Information System (INIS)

Lee, J.L.; Rhodes, D.W.

1977-06-01

Irradiated fuel to be processed at the Idaho Chemical Processing Plant is stored under water at the CPP-603 Fuel Storage Facility. Leakage of radionuclides through breaks in the cladding of some of the stored fuels contaminates the water with radionuclides resulting in radiation exposure to personnel during fuel handling operations and contamination of the shipping casks. A leak test vessel was fabricated to test individual fuel assemblies which were suspected to be leaking. The test equipment and procedures are described. Test results demonstrated that a leaking fuel element could be identified by this method; of the eleven fuel assemblies tested, six were estimated to be releasing greater than 0.5 Ci total radionuclides/day to the basin water

Nonlinear analyses of spent-fuel racks for consolidated fuel loading

International Nuclear Information System (INIS)

Kabir, A.F.; Godha, P.C.; Malik, L.E.; Bolourchi, S.

1987-01-01

Storage racks for spent-fuel assemblies in nuclear power plants are designed to withstand various combinations of loads generated by gravity, seismic, thermal, and accidental fuel drops. Due to the need for storing increased amounts of spent fuel in the existing fuel pools, many nuclear power utilities are evaluating existing fuel racks to safely carry the additional loads. The current study presents the seismic analyses of existing fuel racks of Northeast Utility Company's Millstone Unit Number 1 (BWR Mark I) nuclear plant to accommodate a 2:1 fuel consolidation. This objective requires rigorous nonlinear analyses to establish the full available capacities of the racks and thereby avoid expensive modifications or minimize any needed upgrades

Considerations for handling failed fuel at the Barnwell Nuclear Fuel Plant

International Nuclear Information System (INIS)

Anderson, R.T.; Cholister, R.J.

1982-05-01

The impact of failed fuel receipt on reprocessing operations is qualitatively described. It appears that extended storage of fuel, particularly with advanced storage techniques, will increase the quantity of failed fuel, the nature and possibly the configuration of the fuel. The receipt of failed fuel at the BNFP increases handling problems, waste volumes, and operator exposure. If it is necessary to impose special operating precautions to minimize this impact, a loss in plant throughput will result. Hence, ideally, the reprocessing plant operator would take every reasonable precaution so that no failed fuel is received. An alternative policy would be to require that failed fuel be placed in a sealed canister. In the latter case the canister must be compatible with the shipping cask and suitable for in-plant storage. A required inspection of bare fuel would be made at the reactor prior to shipping off-site. This would verify fuel integrity. These requirements are obviously idealistic. Due to the current uncertain status of reprocessing and the need to keep reactors operating, business or governmental policy may be enacted resulting in the receipt of a negotiated quantity of non-standard fuel (including failed fuel). In this situation, BNFP fuel receiving policy based soley on fuel cladding integrity would be difficult to enforce. There are certain areas where process incompatibility does exist and where a compromise would be virtually impossible, e.g., canned fuel for which material or dimensional conflicts exist. This fuel would have to be refused or the fuel would require recanning prior to shipment. In other cases, knowledge of the type and nature of the failure may be acceptable to the operator. A physical inspection of the fuel either before shipment or after the cask unloading operation would be warranted. In this manner, concerns with pool contamination can be identified and the assembly canned if deemed necessary

Fuel cycles with high fuel burn-up: analysis of reactivity coefficients

International Nuclear Information System (INIS)

Kryuchkov, E.F.; Shmelev, A.N.; Ternovykh, M.J.; Tikhomirov, G.V.; Jinhong, L.; Saito, M.

2003-01-01

Fuel cycles of light-water reactors (LWR) with high fuel burn-up (above 100 MWd/kg), as a rule, involve large amounts of fissionable materials. It leads to forming the neutron spectrum harder than that in traditional LWR. Change of neutron spectrum and significant amount of non-traditional isotopes (for example, 237 Np, 238 Pu, 231 Pa, 232 U) in such fuel compositions can alter substantially reactivity coefficients as compared with traditional uranium-based fuel. The present work addresses the fuel cycles with high fuel burn-up which are based on Th-Pa-U and U-Np-Pu fuel compositions. Numerical analyses are carried out to determine effective neutron multiplication factor and void reactivity coefficient (VRC) for different values of fuel burn-up and different lattice parameters. The algorithm is proposed for analysis of isotopes contribution to these coefficients. Various ways are considered to upgrade safety of nuclear fuel cycles with high fuel burn-up. So, the results obtained in this study have demonstrated that: -1) Non-traditional fuel compositions developed for achievement of high fuel burn-up in LWR can possess positive values of reactivity coefficients that is unacceptable from the reactor operation safety point of view; -2) The lattice pitch of traditional LWR is not optimal for non-traditional fuel compositions, the increased value of the lattice pitch leads to larger value of initial reactivity margin and provides negative VRC within sufficiently broad range of coolant density; -3) Fuel burn-up has an insignificant effect on VRC dependence on coolant density, so, the measures undertaken to suppress positive VRC of fresh fuel will be effective for partially burnt-up fuel compositions also and; -4) Increase of LWR core height and introduction of additional moderators into the fuel lattice can be used as the ways to reach negative VRC values for full range of possible coolant density variations

Nuclear-fuel-cycle education: Module 5. In-core fuel management

International Nuclear Information System (INIS)

Levine, S.H.

1980-07-01

The purpose of this project was to develop a series of educational modules for use in nuclear-fuel-cycle education. These modules are designed for use in a traditional classroom setting by lectures or in a self-paced, personalized system of instruction. This module on in-core fuel management contains information on computational methods and theory; in-core fuel management using the Virginia Polytechnic Institute and State University computer modules; pressurized water reactor in-core fuel management; boiling water reactor in-core fuel management; and in-core fuel management for gas-cooled and fast reactors

A fuel cycle cost study with HEU and LEU fuels

International Nuclear Information System (INIS)

Matos, J.E.; Freese, K.E.

1985-01-01

Fuel cycle costs are compared for a range of 235 U loadings with HEU and LEU fuels using the IAEA generic 10 MW reactor as an example. If LEU silicide fuels are successfully demonstrated and licensed, the results indicate that total fuel cycle costs can be about the same or lower than those with the HEU fuels that are currently used in most research reactors. (author)

A fuel cycle cost study with HEU and LEU fuels

Energy Technology Data Exchange (ETDEWEB)

Matos, J E; Freese, K E [Argonne National Laboratory, Argonne, IL (United States)

1985-07-01

Fuel cycle costs are compared for a range of {sup 235}U loadings with HEU and LEU fuels using the IAEA generic 10 MW reactor as an example. If LEU silicide fuels are successfully demonstrated and licensed, the results indicate that total fuel cycle costs can be about the same or lower than those with the HEU fuels that are currently used in most research reactors. (author)

Fuel Cell Electric Bus Evaluations | Hydrogen and Fuel Cells | NREL

Science.gov (United States)

Bus Evaluations Fuel Cell Electric Bus Evaluations NREL's technology validation team evaluates fuel cell electric buses (FCEBs) to provide comprehensive, unbiased evaluation results of fuel cell bus early transportation applications for fuel cell technology. Buses operate in congested areas where

Fuel Cell Manufacturing Research and Development | Hydrogen and Fuel Cells

Science.gov (United States)

| NREL Fuel Cell Manufacturing Research and Development Fuel Cell Manufacturing Research and Development NREL's fuel cell manufacturing R&D focuses on improving quality-inspection practices for high costs. A researcher monitoring web-line equipment in the Manufacturing Laboratory Many fuel cell

Fuel performance experience

International Nuclear Information System (INIS)

Sofer, G.A.

1986-01-01

The history of LWR fuel supply has been characterized by a wide range of design developments and fuel cycle cost improvements. Exxon Nuclear Company, Inc. has pursued an aggressive fuel research and development program aimed at improved fuel performance. Exxon Nuclear has introduced many design innovations which have improved fuel cycle economics and operating flexibility while fuel failures remain at very low levels. The removable upper tie plate feature of Exxon Nuclear assemblies has helped accelerate this development, enabling repeated inspections during successive plant outages. Also, this design feature has made it possible to repair damaged fuel assemblies during refueling outages, thereby minimizing the economic impact of fuel failure from all causes

Fuel transporting device

International Nuclear Information System (INIS)

Shiratori, Hirozo.

1979-01-01

Purpose: In a liquid-metal cooled reactor, to reduce the waiting time of fuel handling apparatuses and shorten the fuel exchange time. Constitution: A fuel transporting machine is arranged between a reactor vessel and an out-pile storage tank, thereby dividing the transportation line of the pot for contracting fuel and transporting the same. By assuming such a construction, the flow of fuel transportation which has heretofore been carried out through fuel transportation pipes is not limited to one direction but the take-out of fuels from the reactor and the take-in thereof from the storage tank can be carried out constantly, and much time is not required for fuel exchange. (Kamimura, M.)

Fuel assembly

International Nuclear Information System (INIS)

Bando, Masaru.

1993-01-01

As neutron irradiation progresses on a fuel assembly of an FBR type reactor, a strong force is exerted to cause ruptures if the arrangement of fuel elements is not displaced, whereas the fuel elements may be brought into direct contact with each other not by way of spacers to cause burning damages if the arrangement is displaced. In the present invention, the circumference of fuel elements arranged in a normal triangle lattice is surrounded by a wrapper tube having a hexagonal cross section, wire spacers are wound therearound, and deformable spacers are distributed to optional positions for fuel elements in the wrapper tube. Interaction between the fuel elements caused by irradiation is effectively absorbed, thereby enabling to delay the occurrence of the rupture and burning damages of the elements. (N.H.)

Fuel spacer

International Nuclear Information System (INIS)

Nishida, Koji; Yokomizo, Osamu; Kanazawa, Toru; Kashiwai, Shin-ichi; Orii, Akihito.

1992-01-01

The present invention concerns a fuel spacer for a fuel assembly of a BWR type reactor and a PTR type reactor. Springs each having a vane are disposed on the side surface of a circular cell which supports a fuel rods. A vortex streams having a vertical component are formed by the vanes in the flowing direction of a flowing channel between adjacent cylindrical cells. Liquid droplets carried by streams are deposited on liquid membrane streams flowing along the fuel rod at the downstream of the spacer by the vortex streams. In view of the above, the liquid droplets can be deposited to the fuel rod without increasing the amount of metal of the spacer. Accordingly, the thermal margin of the fuel assembly can be improved without losing neutron economy. (I.N.)

Assessment of bio-fuel options for solid oxide fuel cell applications

Science.gov (United States)

Lin, Jiefeng

Rising concerns of inadequate petroleum supply, volatile crude oil price, and adverse environmental impacts from using fossil fuels have spurred the United States to promote bio-fuel domestic production and develop advanced energy systems such as fuel cells. The present dissertation analyzed the bio-fuel applications in a solid oxide fuel cell-based auxiliary power unit from environmental, economic, and technological perspectives. Life cycle assessment integrated with thermodynamics was applied to evaluate the environmental impacts (e.g., greenhouse gas emission, fossil energy consumption) of producing bio-fuels from waste biomass. Landfill gas from municipal solid wastes and biodiesel from waste cooking oil are both suggested as the promising bio-fuel options. A nonlinear optimization model was developed with a multi-objective optimization technique to analyze the economic aspect of biodiesel-ethanol-diesel ternary blends used in transportation sectors and capture the dynamic variables affecting bio-fuel productions and applications (e.g., market disturbances, bio-fuel tax credit, policy changes, fuel specification, and technological innovation). A single-tube catalytic reformer with rhodium/ceria-zirconia catalyst was used for autothermal reformation of various heavy hydrocarbon fuels (e.g., diesel, biodiesel, biodiesel-diesel, and biodiesel-ethanol-diesel) to produce a hydrogen-rich stream reformates suitable for use in solid oxide fuel cell systems. A customized mixing chamber was designed and integrated with the reformer to overcome the technical challenges of heavy hydrocarbon reformation. A thermodynamic analysis, based on total Gibbs free energy minimization, was implemented to optimize the operating environment for the reformations of various fuels. This was complimented by experimental investigations of fuel autothermal reformation. 25% biodiesel blended with 10% ethanol and 65% diesel was determined to be viable fuel for use on a truck travelling with

Turbine combustor with fuel nozzles having inner and outer fuel circuits

Science.gov (United States)

Uhm, Jong Ho; Johnson, Thomas Edward; Kim, Kwanwoo

2013-12-24

A combustor cap assembly for a turbine engine includes a combustor cap and a plurality of fuel nozzles mounted on the combustor cap. One or more of the fuel nozzles would include two separate fuel circuits which are individually controllable. The combustor cap assembly would be controlled so that individual fuel circuits of the fuel nozzles are operated or deliberately shut off to provide for physical separation between the flow of fuel delivered by adjacent fuel nozzles and/or so that adjacent fuel nozzles operate at different pressure differentials. Operating a combustor cap assembly in this fashion helps to reduce or eliminate the generation of undesirable and potentially harmful noise.

Reforming options for hydrogen production from fossil fuels for PEM fuel cells

Energy Technology Data Exchange (ETDEWEB)

Ersoz, Atilla; Olgun, Hayati [TUBITAK Marmara Research Center, Institute of Energy, Gebze, 41470 Kocaeli (Turkey); Ozdogan, Sibel [Marmara University Faculty of Engineering, Goztepe, 81040 Istanbul (Turkey)

2006-03-09

PEM fuel cell systems are considered as a sustainable option for the future transport sector in the future. There is great interest in converting current hydrocarbon based transportation fuels into hydrogen rich gases acceptable by PEM fuel cells on-board of vehicles. In this paper, we compare the results of our simulation studies for 100kW PEM fuel cell systems utilizing three different major reforming technologies, namely steam reforming (SREF), partial oxidation (POX) and autothermal reforming (ATR). Natural gas, gasoline and diesel are the selected hydrocarbon fuels. It is desired to investigate the effect of the selected fuel reforming options on the overall fuel cell system efficiency, which depends on the fuel processing, PEM fuel cell and auxiliary system efficiencies. The Aspen-HYSYS 3.1 code has been used for simulation purposes. Process parameters of fuel preparation steps have been determined considering the limitations set by the catalysts and hydrocarbons involved. Results indicate that fuel properties, fuel processing system and its operation parameters, and PEM fuel cell characteristics all affect the overall system efficiencies. Steam reforming appears as the most efficient fuel preparation option for all investigated fuels. Natural gas with steam reforming shows the highest fuel cell system efficiency. Good heat integration within the fuel cell system is absolutely necessary to achieve acceptable overall system efficiencies. (author)

Reforming options for hydrogen production from fossil fuels for PEM fuel cells

Science.gov (United States)

Ersoz, Atilla; Olgun, Hayati; Ozdogan, Sibel

PEM fuel cell systems are considered as a sustainable option for the future transport sector in the future. There is great interest in converting current hydrocarbon based transportation fuels into hydrogen rich gases acceptable by PEM fuel cells on-board of vehicles. In this paper, we compare the results of our simulation studies for 100 kW PEM fuel cell systems utilizing three different major reforming technologies, namely steam reforming (SREF), partial oxidation (POX) and autothermal reforming (ATR). Natural gas, gasoline and diesel are the selected hydrocarbon fuels. It is desired to investigate the effect of the selected fuel reforming options on the overall fuel cell system efficiency, which depends on the fuel processing, PEM fuel cell and auxiliary system efficiencies. The Aspen-HYSYS 3.1 code has been used for simulation purposes. Process parameters of fuel preparation steps have been determined considering the limitations set by the catalysts and hydrocarbons involved. Results indicate that fuel properties, fuel processing system and its operation parameters, and PEM fuel cell characteristics all affect the overall system efficiencies. Steam reforming appears as the most efficient fuel preparation option for all investigated fuels. Natural gas with steam reforming shows the highest fuel cell system efficiency. Good heat integration within the fuel cell system is absolutely necessary to achieve acceptable overall system efficiencies.

Metallic fuel development

International Nuclear Information System (INIS)

Walters, L.C.

1987-01-01

Metallic fuels are capable of achieving high burnup as a result of design modifications instituted in the late 1960's. The gap between the fuel slug and the cladding is fixed such that by the time the fuel swells to the cladding the fission gas bubbles interconnect and release the fission gas to an appropriately sized plenum volume. Interconnected porosity thus provides room for the fuel to deform from further swelling rather than stress the cladding. In addition, the interconnected porosity allows the fuel pin to be tolerant to transient events because as stresses are generated during a transient event the fuel flows rather than applying significant stress to the cladding. Until 1969 a number of metallic fuel alloys were under development in the US. At that time the metallic fuel development program in the US was discontinued in favor of ceramic fuels. However, development had proceeded to the point where it was clear that the zirconium addition to uranium-plutonium fuel would yield a ternary fuel with an adequately high solidus temperature and good compatibility with austenitic stainless steel cladding. Furthermore, several U-Pu-Zr fuel pins had achieved about 6 at.% bu by the late 1960's, without failure, and thus the prospect for high burnup was promising

Fuel economy and range estimates for fuel cell powered automobiles

Energy Technology Data Exchange (ETDEWEB)

Steinbugler, M.; Ogden, J. [Princeton Univ., NJ (United States)

1996-12-31

While a number of automotive fuel cell applications have been demonstrated, including a golf cart, buses, and a van, these systems and others that have been proposed have utilized differing configurations ranging from direct hydrogen fuel cell-only power plants to fuel cell/battery hybrids operating on reformed methanol. To date there is no clear consensus on which configuration, from among the possible combinations of fuel cell, peaking device, and fuel type, is the most likely to be successfully commercialized. System simplicity favors direct hydrogen fuel cell vehicles, but infrastructure is lacking. Infrastructure favors a system using a liquid fuel with a fuel processor, but system integration and performance issues remain. A number of studies have analyzed particular configurations on either a system or vehicle scale. The objective of this work is to estimate, within a consistent framework, fuel economies and ranges for a variety of configurations using flexible models with the goal of identifying the most promising configurations and the most important areas for further research and development.

RU fuel development program for an advanced fuel cycle in Korea

International Nuclear Information System (INIS)

Suk, Hochum; Sim, Kiseob; Kim, Bongghi; Inch, W.W.; Page, R.

1998-01-01

Korea is a unique country, having both PWR and CANDU reactors. Korea can therefore exploit the natural synergism between the two reactor types to minimize overall waste production, and maximize energy derived from the fuel, by ultimately burning the spent fuel from its PWR reactors in CANDU reactors. As one of the possible fuel cycles, Recovered Uranium (RU) fuel offers a very attractive alternative to the use of Natural Uranium (NU) and slightly enriched uranium (SEU) in CANDU reactors. Potential benefits can be derived from a number of stages in the fuel cycle: no enrichment required, therefore no enrichment tails, direct conversion to UO 2 , lower sensitivity to 234 U and 236U absorption in the CANDU reactor, and expected lower cost relative to NU and SEU. These benefits all fit well with the PWR-CANDU fuel cycle synergy. RU arising from the conventional reprocessing of European and Japanese oxide spent fuel by 2000 is projected to be approaching 25,000 te. The use of RU fuel in a CANDU 6 reactor should result in no serious radiological difficulties and no requirements for special precautions and should not require any new technologies for the fuel fabrication and handling. The use of the CANDU Flexible Fueling (CANFLEX) bundle as the carrier for RU will be fully compatible with the reactor design, current safety and operational requirements, and there will be improved fuel performance compared with the CANDU 37-element NU fuel bundle. Compared with the 37-element NU bundle, the RU fuel has significantly improved fuel cycle economics derived from increased burnups, a large reduction in both fuel requirements and spent fuel, arisings, and the potential lower cost for RU material. There is the potential for annual fuel cost savings in the range of one-third to two-thirds, with enhanced operating margins using RU in the CANFLEX bundle design. These benefits provide the rationale for justifying R and D efforts on the use of RU fuel for advanced fuel cycles in CANDU

Fuel cells 101

Energy Technology Data Exchange (ETDEWEB)

Taylor, B.

2003-06-01

A capsule history of fuel cells is given, beginning with the first discovery in 1839 by William Grove, a Welsh judge who, when experimenting with electrolysis discovered that by re-combining the two components of electrolysis (water and oxygen) an electric charge was produced. A century later, in 1958, Francis Thomas Bacon, a British scientist demonstrated the first working fuel cell stack, a technology which was licensed and used in the Apollo spacecraft. In Canada, early research on the development of fuel cells was carried out at the University of Toronto, the Defence Research Establishment and the National Research Council. Most of the early work concentrated on alkaline and phosphoric acid fuel cells. In 1983, Ballard Research began the development of the electrolyte membrane fuel cell, which marked the beginning of Canada becoming a world leader in fuel cell technology development. The paper provides a brief account of how fuel cells work, describes the distinguishing characteristics of the various types of fuel cells (alkaline, phosphoric acid, molten-carbonate, solid oxide, and proton exchange membrane types) and their principal benefits. The emphasis is on proton exchange membrane fuel cells because they are the only fuel cell technology that is appropriate for providing primary propulsion power onboard a vehicle. Since vehicles are by far the greatest consumers of fossil fuels, it follows that proton exchange membrane fuel cells will have the greatest potential impact on both environmental matters and on our reliance on oil as our primary fuel. Various on-going and planned fuel cell demonstration projects are also described. 1 fig.

Fuel pellet

International Nuclear Information System (INIS)

Hayashi, K.

1980-01-01

Fuel pellet for insertion into a cladding tube in order to form a fuel element or a fuel rod. The fuel pellet has got a belt-like projection around its essentially cylindrical lateral circumferential surface. The upper and lower edges in vertical direction of this belt-like projection are wave-shaped. The projection is made of the same material as the bulk pellet. Both are made in one piece. (orig.) [de

Oxy-fuel combustion of solid fuels

DEFF Research Database (Denmark)

Toftegaard, Maja Bøg; Brix, Jacob; Jensen, Peter Arendt

2010-01-01

Oxy-fuel combustion is suggested as one of the possible, promising technologies for capturing CO2 from power plants. The concept of oxy-fuel combustion is removal of nitrogen from the oxidizer to carry out the combustion process in oxygen and, in most concepts, recycled flue gas to lower the flame...... provide additional options for improvement of process economics are however likewise investigated. Of particular interest is the change of the combustion process induced by the exchange of carbon dioxide and water vapor for nitrogen as diluent. This paper reviews the published knowledge on the oxy......-fuel process and focuses particularly on the combustion fundamentals, i.e. flame temperatures and heat transfer, ignition and burnout, emissions, and fly ash characteristics. Knowledge is currently available regarding both an entire oxy-fuel power plant and the combustion fundamentals. However, several...

WWER-440 fuel cycles possibilities using improved fuel assemblies design

International Nuclear Information System (INIS)

Mikolas, P.; Svarny, J.

2008-01-01

Practically five years cycle has been achieved in the last years at NPP Dukovany. There are two principal means how it could be achieved. First, it is necessary to use fuel assemblies with higher fuel enrichment and second, to use fuel loading with very low leakage. Both these conditions are fulfilled at NPP Dukovany at this time. It is known, that the fuel cycle economy can be improved by increasing the fuel residence time in the core up to six years. There are at least two ways how this goal could be achieved. The simplest way is to increase enrichment in fuel. There exists a limit, which is 5.0 w % of 235 U. Taking into account some uncertainty, the calculation maximum is 4.95 w % of 235 U. The second way is to change fuel assembly design. There are several possibilities, which seem to be suitable from the neutron - physical point of view. The first one is higher mass content of uranium in a fuel assembly. The next possibility is to enlarge pin pitch. The last possibility is to 'omit' FA shroud. This is practically unrealistic; anyway, some other structural parts must be introduced. The basic neutron physical characteristics of these cycles for up-rated power are presented showing that the possibilities of fuel assemblies with this improved design in enlargement of fuel cycles are very promising. In the end, on the basis of neutron physical characteristics and necessary economical input parameters, a preliminary evaluation of economic contribution of proposals of advanced fuel assemblies on fuel cycle economy is presented (Authors)

40 CFR 80.602 - What records must be kept by entities in the NRLM diesel fuel, ECA marine fuel, and diesel fuel...

Science.gov (United States)

2010-07-01

... (CONTINUED) AIR PROGRAMS (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Motor Vehicle Diesel Fuel; Nonroad, Locomotive, and Marine Diesel Fuel; and ECA Marine Fuel Recordkeeping and Reporting Requirements... in the NRLM diesel fuel, ECA marine fuel, and diesel fuel additive production, importation, and...

Fuel loads and fuel type mapping

Science.gov (United States)

Chuvieco, Emilio; Riaño, David; Van Wagtendonk, Jan W.; Morsdof, Felix; Chuvieco, Emilio

2003-01-01

Correct description of fuel properties is critical to improve fire danger assessment and fire behaviour modeling, since they guide both fire ignition and fire propagation. This chapter deals with properties of fuel that can be considered static in short periods of time: biomass loads, plant geometry, compactness, etc. Mapping these properties require a detail knowledge of vegetation vertical and horizontal structure. Several systems to classify the great diversity of vegetation characteristics in few fuel types are described, as well as methods for mapping them with special emphasis on those based on remote sensing images.

Fuel Cell Technology Status Analysis | Hydrogen and Fuel Cells | NREL

Science.gov (United States)

Technology Status Analysis Fuel Cell Technology Status Analysis Get Involved Fuel cell developers interested in collaborating with NREL on fuel cell technology status analysis should send an email to NREL's Technology Validation Team at techval@nrel.gov. NREL's analysis of fuel cell technology provides objective

Fissile fuel doubling time characteristics for reactor lifetime fuel logistics

International Nuclear Information System (INIS)

Heindler, M.; Harms, A.A.

1978-01-01

The establishment of nuclear fuel requirements and their efficient utilization requires a detailed knowledge of some aspects of fuel dynamics and processing during the reactor lifetime. It is shown here that the use of the fuel stockpile inventory concept can serve effectively for this fuel management purpose. The temporal variation of the fissile fuel doubling time as well as nonequilibrium core conditions are among the characteristics which thus become more evident. These characteristics - rather than a single figure-of-merit - clearly provide an improved description of the expansion capacity and/or fuel requirements of a nuclear reactor energy system

Fuel assembly

International Nuclear Information System (INIS)

Nakajima, Akiyoshi; Bessho, Yasunori; Aoyama, Motoo; Koyama, Jun-ichi; Hirakawa, Hiromasa; Yamashita, Jun-ichi; Hayashi, Tatsuo

1998-01-01

In a fuel assembly of a BWR type reactor in which a water rod of a large diameter is disposed at the central portion, the cross sectional area perpendicular to the axial direction comprises a region a of a fuel rod group facing to a wide gap water region to which a control rod is inserted, a region b of a fuel rod group disposed on the side of the wide gap water region other than the region a, a region d of a fuel rod group facing to a narrow gap water region and a region c of a fuel rod group disposed on the side of the narrow gap water region other than the region d. When comparing an amount of fission products contained in the four regions relative to that in the entire regions and average enrichment degrees of fuel rods for the four regions, the relative amount and the average enrichment degree of the fuel rod group of the region a is minimized, and the relative amount and the average enrichment degree of the fuel rod group in the region b is maximized. Then, reactor shut down margin during cold operation can be improved while flattening the power in the cross section perpendicular to the axial direction. (N.H.)

Fuel assemblies

International Nuclear Information System (INIS)

Nagano, Mamoru; Yoshioka, Ritsuo

1983-01-01

Purpose: To effectively utilize nuclear fuels by increasing the reactivity of a fuel assembly and reduce the concentration at the central region thereof upon completion of the burning. Constitution: A fuel assembly is bisected into a central region and a peripheral region by disposing an inner channel box within a channel box. The flow rate of coolants passing through the central region is made greater than that in the peripheral region. The concentration of uranium 235 of the fuel rods in the central region is made higher. In such a structure, since the moderating effect in the central region is improved, the reactivity of the fuel assembly is increased and the uranium concentration in the central region upon completion of the burning can be reduced, fuel economy and effective utilization of uranium can be attained. (Kamimura, M.)

Fuel assembly

International Nuclear Information System (INIS)

Nakatsuka, Masafumi; Matsuzuka, Ryuji.

1976-01-01

Object: To provide a fuel assembly which can decrease pressure loss of coolant to uniform temperature. Structure: A sectional area of a flow passage in the vicinity of an inner peripheral surface of a wrapper tube is limited over the entire length to prevent the temperature of a fuel element in the outermost peripheral portion from being excessively decreased to thereby flatten temperature distribution. To this end, a plurality of pincture-frame-like sheet metals constituting a spacer for supporting a fuel assembly, which has a plurality of fuel elements planted lengthwise and in given spaced relation within the wrapper tube, is disposed in longitudinal grooves and in stacked fashion to form a substantially honeycomb-like space in cross section. The fuel elements are inserted and supported in the space to form a fuel assembly. (Kamimura, M.)

Accelerated fuel depreciation as an economic incentive for low-leakage fuel management

International Nuclear Information System (INIS)

Downar, T.J.

1986-01-01

An analysis is presented which evaluates the tax depreciation advantage which results from the increased rate of fuel depletion achieved in the current low-leakage fuel-management LWR core reload designs. An analytical fuel-cycle cost model is used to examine the important cost parameters which are then validated using the fuel-cycle cost code CINCAS and data from the Maine Yankee PWR. Results show that low-leakage fuel management, through the tax depreciation advantage from accelerated fuel depletion, provides an improvement of several percent in fuel-cycle costs compared to traditional out-in fuel management and a constant fuel depletion rate. (author)

Proceedings of the Water Reactor Fuel Performance Meeting - WRFPM / Top Fuel 2009

Energy Technology Data Exchange (ETDEWEB)

NONE

2009-06-15

SFEN, ENS, SNR, ANS, AESJ, CNS KNS, IAEA and NEA are jointly organizing the 2009 International Water Reactor Fuel Performance / TopFuel 2009 Meeting following the 2008 KNS Water Reactor Performance Meeting held during October 19-23, 2008 in Seoul, Korea. This meeting is held annually on a tri-annual rotational basis in Europe, USA and Asia. In 2009, this meeting will be held in Paris, September 6-10, 2009 in coordination with the Global 2009 Conference at the same date and place. That would lead to a common opening session, some common technical presentations, a common exhibition and common social events. The technical scope of the meeting includes all aspects of nuclear fuel from fuel rod to core design as well as manufacturing, performance in commercial and test reactors or on-going and future developments and trends. Emphasis will be placed on fuel reliability in the general context of nuclear 'Renaissance' and recycling perspective. The meeting includes selectively front and/or back end issues that impact fuel designs and performance. In this frame, the conference track devoted to 'Concepts for transportation and interim storage of spent fuels and conditioned waste' will be shared with 'GLOBAL' conference. Technical Tracks: - 1. Fuel Performance, Reliability and Operational Experience: Fuel operating experience and performance; experience with high burn-up fuels; water side corrosion; stress corrosion cracking; MOX fuel performance; post irradiation data on lead fuel assemblies; radiation effects; water chemistry and corrosion counter-measures. - 2. Transient Fuel Behaviour and Safety Related Issues: Transient fuel behavior and criteria (RIA, LOCA, ATWS, Ramp tests..). Fuel safety-related issues such as PCI (pellet cladding interaction), transient fission gas releases and cladding bursting/ballooning during transient events - Advances in fuel performance modeling and core reload methodology, small and large-scale fuel testing

Proceedings of the Water Reactor Fuel Performance Meeting - WRFPM / Top Fuel 2009

International Nuclear Information System (INIS)

2009-06-01

SFEN, ENS, SNR, ANS, AESJ, CNS KNS, IAEA and NEA are jointly organizing the 2009 International Water Reactor Fuel Performance / TopFuel 2009 Meeting following the 2008 KNS Water Reactor Performance Meeting held during October 19-23, 2008 in Seoul, Korea. This meeting is held annually on a tri-annual rotational basis in Europe, USA and Asia. In 2009, this meeting will be held in Paris, September 6-10, 2009 in coordination with the Global 2009 Conference at the same date and place. That would lead to a common opening session, some common technical presentations, a common exhibition and common social events. The technical scope of the meeting includes all aspects of nuclear fuel from fuel rod to core design as well as manufacturing, performance in commercial and test reactors or on-going and future developments and trends. Emphasis will be placed on fuel reliability in the general context of nuclear 'Renaissance' and recycling perspective. The meeting includes selectively front and/or back end issues that impact fuel designs and performance. In this frame, the conference track devoted to 'Concepts for transportation and interim storage of spent fuels and conditioned waste' will be shared with 'GLOBAL' conference. Technical Tracks: - 1. Fuel Performance, Reliability and Operational Experience: Fuel operating experience and performance; experience with high burn-up fuels; water side corrosion; stress corrosion cracking; MOX fuel performance; post irradiation data on lead fuel assemblies; radiation effects; water chemistry and corrosion counter-measures. - 2. Transient Fuel Behaviour and Safety Related Issues: Transient fuel behavior and criteria (RIA, LOCA, ATWS, Ramp tests..). Fuel safety-related issues such as PCI (pellet cladding interaction), transient fission gas releases and cladding bursting/ballooning during transient events - Advances in fuel performance modeling and core reload methodology, small and large-scale fuel testing facilities. - 3. Advances in Water

UK experience on fuel and cladding interaction in oxide fuels

Energy Technology Data Exchange (ETDEWEB)

Batey, W [Dounreay Experimental Reactor Establishment, Thurso, Caithness (United Kingdom); Findlay, J R [AERE, Harwell, Didcot, Oxon (United Kingdom)

1977-04-01

The occurrence of fuel cladding interactions in fast reactor fuels has been observed in UK irradiations over a period of years. Chemical incompatibility between fuel and clad represents a potential source of failure and has, on this account, been studied using a variety of techniques. The principal fuel of interest to the UK for fast reactor application is mixed uranium plutonium oxide clad in stainless steel and it is in this field that the majority of work has been concentrated. Some consideration has been given to carbide fuels, because of their application as an advanced fuel. This experience is described in the accompanying paper. Several complementary initiatives have been followed to investigate the interactions in oxide fuel. The principal source of experimental information is from the experimental fuel irradiation programme in the Dounreay Fast Reactor (DFR). Supporting information has been obtained from irradiation programmes in Materials Testing Reactors (MTR). Conditions approaching those in a fast reactor are obtained and the effects of specific variables have been examined in specifically designed experiments. Out-of-reactor experiments have been used to determine the limits of fuel and cladding compatibility and also to give indications of corrosion The observations from all experiments have been examined in the light of thermo-dynamic predictions of fuel behaviour to assess the relative significance of various observations and operating conditions. An experimental programme to control and limit the interactions in oxide fuel is being followed.

UK experience on fuel and cladding interaction in oxide fuels

International Nuclear Information System (INIS)

Batey, W.; Findlay, J.R.

1977-01-01

The occurrence of fuel cladding interactions in fast reactor fuels has been observed in UK irradiations over a period of years. Chemical incompatibility between fuel and clad represents a potential source of failure and has, on this account, been studied using a variety of techniques. The principal fuel of interest to the UK for fast reactor application is mixed uranium plutonium oxide clad in stainless steel and it is in this field that the majority of work has been concentrated. Some consideration has been given to carbide fuels, because of their application as an advanced fuel. This experience is described in the accompanying paper. Several complementary initiatives have been followed to investigate the interactions in oxide fuel. The principal source of experimental information is from the experimental fuel irradiation programme in the Dounreay Fast Reactor (DFR). Supporting information has been obtained from irradiation programmes in Materials Testing Reactors (MTR). Conditions approaching those in a fast reactor are obtained and the effects of specific variables have been examined in specifically designed experiments. Out-of-reactor experiments have been used to determine the limits of fuel and cladding compatibility and also to give indications of corrosion The observations from all experiments have been examined in the light of thermo-dynamic predictions of fuel behaviour to assess the relative significance of various observations and operating conditions. An experimental programme to control and limit the interactions in oxide fuel is being followed

Fuel cycles with high fuel burn-up: analysis of reactivity coefficients

Energy Technology Data Exchange (ETDEWEB)

Kryuchkov, E.F.; Shmelev, A.N.; Ternovykh, M.J.; Tikhomirov, G.V.; Jinhong, L. [Moscow Engineering Physics Institute (State University) (Russian Federation); Saito, M. [Tokyo Institute of Technology (Japan)

2003-07-01

Fuel cycles of light-water reactors (LWR) with high fuel burn-up (above 100 MWd/kg), as a rule, involve large amounts of fissionable materials. It leads to forming the neutron spectrum harder than that in traditional LWR. Change of neutron spectrum and significant amount of non-traditional isotopes (for example, {sup 237}Np, {sup 238}Pu, {sup 231}Pa, {sup 232}U) in such fuel compositions can alter substantially reactivity coefficients as compared with traditional uranium-based fuel. The present work addresses the fuel cycles with high fuel burn-up which are based on Th-Pa-U and U-Np-Pu fuel compositions. Numerical analyses are carried out to determine effective neutron multiplication factor and void reactivity coefficient (VRC) for different values of fuel burn-up and different lattice parameters. The algorithm is proposed for analysis of isotopes contribution to these coefficients. Various ways are considered to upgrade safety of nuclear fuel cycles with high fuel burn-up. So, the results obtained in this study have demonstrated that: -1) Non-traditional fuel compositions developed for achievement of high fuel burn-up in LWR can possess positive values of reactivity coefficients that is unacceptable from the reactor operation safety point of view; -2) The lattice pitch of traditional LWR is not optimal for non-traditional fuel compositions, the increased value of the lattice pitch leads to larger value of initial reactivity margin and provides negative VRC within sufficiently broad range of coolant density; -3) Fuel burn-up has an insignificant effect on VRC dependence on coolant density, so, the measures undertaken to suppress positive VRC of fresh fuel will be effective for partially burnt-up fuel compositions also and; -4) Increase of LWR core height and introduction of additional moderators into the fuel lattice can be used as the ways to reach negative VRC values for full range of possible coolant density variations.

Sipping fuel and saving lives: increasing fuel economy withoutsacrificing safety

Energy Technology Data Exchange (ETDEWEB)

Gordon, Deborah; Greene, David L.; Ross, Marc H.; Wenzel, Tom P.

2007-06-11

The public, automakers, and policymakers have long worried about trade-offs between increased fuel economy in motor vehicles and reduced safety. The conclusion of a broad group of experts on safety and fuel economy in the auto sector is that no trade-off is required. There are a wide variety of technologies and approaches available to advance vehicle fuel economy that have no effect on vehicle safety. Conversely, there are many technologies and approaches available to advance vehicle safety that are not detrimental to vehicle fuel economy. Congress is considering new policies to increase the fuel economy of new automobiles in order to reduce oil dependence and reduce greenhouse gas emissions. The findings reported here offer reassurance on an important dimension of that work: It is possible to significantly increase the fuel economy of motor vehicles without compromising their safety. Automobiles on the road today demonstrate that higher fuel economy and greater safety can co-exist. Some of the safest vehicles have higher fuel economy, while some of the least safe vehicles driven today--heavy, large trucks and SUVs--have the lowest fuel economy. At an October 3, 2006 workshop, leading researchers from national laboratories, academia, auto manufacturers, insurance research industry, consumer and environmental groups, material supply industries, and the federal government agreed that vehicles could be designed to simultaneously improve safety and fuel economy. The real question is not whether we can realize this goal, but the best path to get there. The experts' studies reveal important new conclusions about fuel economy and safety, including: (1) Vehicle fuel economy can be increased without affecting safety, and vice versa; (2) Reducing the weight and height of the heaviest SUVs and pickup trucks will simultaneously increase both their fuel economy and overall safety; and (3) Advanced materials can decouple size from mass, creating important new possibilities

The Fuel Performance Analysis of LWR Fuel containing High Thermal Conductivity Reinforcements

International Nuclear Information System (INIS)

Kim, Seung Su; Ryu, Ho Jin

2015-01-01

The thermal conductivity of fuel affects many performance parameters including the fuel centerline temperature, fission gas release and internal pressure. In addition, enhanced safety margin of fuel might be expected when the thermal conductivity of fuel is improved by the addition of high thermal conductivity reinforcements. Therefore, the effects of thermal conductivity enhancement on the fuel performance of reinforced UO2 fuel with high thermal conductivity compounds should be analyzed. In this study, we analyzed the fuel performance of modified UO2 fuel with high thermal conductivity reinforcements by using the FRAPCON-3.5 code. The fissile density and mechanical properties of the modified fuel are considered the same with the standard UO2 fuel. The fuel performance of modified UO2 with high thermal conductivity reinforcements were analyzed by using the FRAPCON-3.5 code. The thermal conductivity enhancement factors of the modified fuels were obtained from the Maxwell model considering the volume fraction of reinforcements

CANDU fuel performance

International Nuclear Information System (INIS)

Ivanoff, N.V.; Bazeley, E.G.; Hastings, I.J.

1982-01-01

CANDU fuel has operated successfully in Ontario Hydro's power reactors since 1962. In the 19 years of experience, about 99.9% of all fuel bundles have performed as designed. Most defects occurred before 1979 and subsequent changes in fuel design, fuel management, reactor control, and manufacturing quality control have reduced the current defect rate to near zero. Loss of power production due to defective fuel has been negligible. The outstanding performance continues while maintaining a low unit energy cost for fuel

Repairing fuel for reinsertion

International Nuclear Information System (INIS)

Krukshenk, A.

1986-01-01

Eqiupment for nuclear reactor fuel assembly repairing produced by Westinghouse and Brawn Bovery companies is described. Repair of failed fuel assemblies replacement of defect fuel elements gives a noticeable economical effect. Thus if the cost of a new fuel assembly is 450-500 thousand dollars, the replacement of one fuel element in it costs approximately 40-60 thousand dollars. In simple cases repairing includes either removal of failed fuel elements from a fuel assembly and its reinsertion with the rest of fuel elements into the reactor core (reactor refueling), or replacement of unfailed fuel elements from one fuel assembly to a new one (fuel assembly overhaul and reconditioning)

Fuel mechanical design as a boundary condition for fuel management optimization

International Nuclear Information System (INIS)

Wunderlich, F.; Aisch, F.W.; Heins, L.

1988-01-01

The incentive to reduce fuel cycle costs as well as the amount of active waste requires, among others, measures to optimize fuel management. Improved fuel management in this sense calls, e.g., for reduction of parasitic neutron absorption, for reduction of neutron leakage, and particularly for burnup extension. Such measures result in increased demands for fuel mechanical design. In the first part of this paper their impact on fuel mechanical behaviour is described. In the second part, some examples of practical importance for the interaction between fuel management optimization and fuel mechanical design are discussed. (orig.) [de

Climate consequences of low-carbon fuels: The United States Renewable Fuel Standard

International Nuclear Information System (INIS)

Hill, Jason; Tajibaeva, Liaila; Polasky, Stephen

2016-01-01

A common strategy for reducing greenhouse gas (GHG) emissions from energy use is to increase the supply of low-carbon alternatives. However, increasing supply tends to lower energy prices, which encourages additional fuel consumption. This “fuel market rebound effect” can undermine climate change mitigation strategies, even to the point where efforts to reduce GHG emissions by increasing the supply of low-carbon fuels may actually result in increased GHG emissions. Here, we explore how policies that encourage the production of low-carbon fuels may result in increased GHG emissions because the resulting increase in energy use overwhelms the benefits of reduced carbon intensity. We describe how climate change mitigation strategies should follow a simple rule: a low-carbon fuel with a carbon intensity of X% that of a fossil fuel must displace at least X% of that fossil fuel to reduce overall GHG emissions. We apply this rule to the United States Renewable Fuel Standard (RFS2). We show that absent consideration of the fuel market rebound effect, RFS2 appears to reduce GHG emissions, but once the fuel market rebound effect is factored in, RFS2 actually increases GHG emissions when all fuel GHG intensity targets are met. - Highlights: • Low-carbon fuels partially displace petroleum via fuel market rebound effect. • Synthesis of recent analyses shows incomplete petroleum displacement by biofuels. • Fuel market rebound effect can reduce or reverse climate benefit of low-carbon fuels. • Fossil fuel displacement must exceed relative carbon footprint of a low-carbon fuel. • The Renewable Fuel Standard increases greenhouse gas emissions when mandate is met.

The Role of Soil Organic Matter, Nutrients, and Microbial Community Structure on the Performance of Microbial Fuel Cells

Science.gov (United States)

Rooney-Varga, J. N.; Dunaj, S. J.; Vallino, J. J.; Hines, M. E.; Gay, M.; Kobyljanec, C.

2011-12-01

Microbial fuel cells (MFCs) offer the potential for generating electricity, mitigating greenhouse gas emissions, and bioremediating pollutants through utilization of a plentiful, natural, and renewable resource: soil organic carbon. In the current study, we analyzed microbial community structure, MFC performance, and soil characteristics in different microhabitats (bulk soil, anode, and cathode) within MFCs constructed from agricultural or forest soils in order to determine how soil type and microbial dynamics influence MFC performance. MFCs were constructed with soils from agricultural and hardwood forest sites at Harvard Forest (Petersham, MA). The bulk soil characteristics were analyzed, including polyphenols, short chain fatty acids, total organic C and N, abiotic macronutrients, N and P mineralization rates, CO2 respiration rates, and MFC power output. Microbial community structure of the anodes, cathodes, and bulk soils was determined with molecular fingerprinting methods, which included terminal restriction length polymorphism (T-RFLP) analysis and 16S rRNA gene sequencing analysis. Our results indicated that MFCs constructed from agricultural soil had power output about 17 times that of forest soil-based MFCs and respiration rates about 10 times higher than forest soil MFCs. Agricultural soil MFCs had lower C:N ratios, polyphenol content, and acetate concentrations than forest soil MFCs, suggesting that active agricultural MFC microbial communities were supported by higher quality organic carbon. Microbial community profile data indicate that the microbial communities at the anode of the high power MFCs were less diverse than in low power MFCs and were dominated by Deltaproteobacteria, Geobacter, and, to a lesser extent, Clostridia, while low-power MFC anode communities were dominated by Clostridia. These data suggest that the presence of organic carbon substrate (acetate) was not the major limiting factor in selecting for highly electrogenic microbial

Fuel pattern recognition device

International Nuclear Information System (INIS)

Sato, Tomomi.

1995-01-01

The device of the present invention monitors normal fuel exchange upon fuel exchanging operation carried out in a reactor of a nuclear power plant. Namely, a fuel exchanger is movably disposed to the upper portion of the reactor and exchanges fuels. An exclusive computer receives operation signals of the fuel exchanger during operation as inputs, and outputs reactor core fuel pattern information signals to a fuel arrangement diagnosis device. An underwater television camera outputs image signals of a fuel pattern in the reactor core to an image processing device. If there is any change in the image signals for the fuel pattern as a result of the fuel exchange operation of the fuel exchanger, the image processing device outputs the change as image signals to the fuel pattern diagnosis device. The fuel pattern diagnosis device compares the pattern information signals from the exclusive computer with the image signals from the image processing device, to diagnose the result of the fuel exchange operation performed by the fuel exchanger and inform the diagnosis by means of an image display. (I.S.)

Proceedings of the 2006 International Meeting on LWR fuel performance 'Nuclear Fuel: Addressing the future' - TopFuel 2006 Transactions

International Nuclear Information System (INIS)

2006-01-01

From 22-26 October, 340 researchers, nuclear engineers and scientists from across Europe and beyond congregated in the ancient university city of Salamanca, Spain, to discuss the challenges facing the developers and manufacturers of new high-performance nuclear fuels-fuels that will help meet current and future energy demand and reduce man's over dependence upon CO 2 -emitting fossil fuels. TopFuel is an annual topical meeting organised by ENS, the American Nuclear Society and the Atomic Energy Society of Japan. This year it was co-sponsored by the IAEA, the OECD/NEA and the Spanish Nuclear Society (SNE). TopFuel's primary objective was to bring together leading specialists in the field from around the world to analyse advances in nuclear fuel management technology and to use the findings of the latest cutting-edge research to help manufacture the high performance nuclear fuels of today and tomorrow. The TopFuel 2006 agenda revolved around ten technical sessions dedicated to priority issues such as security of supply, new fuel and reactor core designs, fuel cycle strategies and spent fuel management. Among the many topics under discussion were new developments in fuel performance modelling, advanced fuel assembly design and the improved conditioning and processing of spent fuel. During the week, a poster exhibition also gave delegates the opportunity to display and discuss the results of their latest work and to network with fellow professionals. One important statement to emerge from TopFuel 2006 was that the world has enough reserves of uranium to support the large-scale and long-term production of nuclear energy. The OECD/NEA and the IAEA recently published a report entitled Uranium 2005: Resources, Production and Demand (the Red Book). The report, which makes a comprehensive assessment of uranium supplies and projected demand up until the year 2025, concludes by saying 'the uranium resource base is adequate to meet projected future requirements'. With the

Optimization of Fuel Cell System Operating Conditions for Fuel Cell Vehicles

OpenAIRE

Zhao, Hengbing; Burke, Andy

2008-01-01

Proton Exchange Membrane fuel cell (PEMFC) technology for use in fuel cell vehicles and other applications has been intensively developed in recent decades. Besides the fuel cell stack, air and fuel control and thermal and water management are major challenges in the development of the fuel cell for vehicle applications. The air supply system can have a major impact on overall system efficiency. In this paper a fuel cell system model for optimizing system operating conditions was developed wh...

Fuel choices for fuel-cell vehicles : well-to-wheel energy and emission impacts

International Nuclear Information System (INIS)

Wang, M.

2002-01-01

Because of their high energy efficiencies and low emissions, fuel-cell vehicles (FCVs) are undergoing extensive research and development. While hydrogen will likely be the ultimate fuel to power fuel-cell vehicles, because of current infrastructure constraints, hydrogen-carrying fuels are being investigated as transitional fuel-cell fuels. A complete well-to-wheels (WTW) evaluation of fuel-cell vehicle energy and emission effects that examines (1) energy feedstock recovery and transportation; (2) fuel production, transportation, and distribution; and (3) vehicle operation must be conducted to assist decision makers in selecting the fuel-cell fuels that achieve the greatest energy and emission benefits. A fuel-cycle model developed at Argonne National Laboratory--called the Greenhouse gases, Regulated Emissions, and Energy use in Transportation (GREET) model--was used to evaluate well-to-wheels energy and emission impacts of various fuel-cell fuels. The results show that different fuel-cell fuels can have significantly different energy and greenhouse gas emission effects. Therefore, if fuel-cell vehicles are to achieve the envisioned energy and emission reduction benefits, pathways for producing the fuels that power them must be carefully examined.

An optimized BWR fuel lattice for improved fuel utilization

International Nuclear Information System (INIS)

Bernander, O.; Helmersson, S.; Schoen, C.G.

1984-01-01

Optimization of the BWR fuel lattice has evolved into the water cross concept, termed ''SVEA'', whereby the improved moderation within bundles augments reactivity and thus improves fuel cycle economy. The novel design introduces into the assembly a cruciform and double-walled partition containing nonboiling water, thus forming four subchannels, each of which holds a 4x4 fuel rod bundle. In Scandinavian BWRs - for which commercial SVEA reloads are now scheduled - the reactivity gain is well exploited without adverse impact in other respects. In effect, the water cross design improves both mechanical and thermal-hydraulic performance. Increased average burnup is also promoted through achieving flatter local power distributions. The fuel utilization savings are in the order of 10%, depending on the basis of comparison, e.g. choice of discharge burnup and lattice type. This paper reviews the design considerations and the fuel utilization benefits of the water cross fuel for non-Scandinavian BWRs which have somewhat different core design parameters relative to ASEA-ATOM reactors. For one design proposal, comparisons are made with current standard 8x8 fuel rod bundles as well as with 9x9 type fuel in reactors with symmetric or asymmetric inter-assembly water gaps. The effect on reactivity coefficients and shutdown margin are estimated and an assessment is made of thermal-hydraulic properties. Consideration is also given to a novel and advantageous way of including mixed-oxide fuel in BWR reloads. (author)

Heating subsurface formations by oxidizing fuel on a fuel carrier

Science.gov (United States)

Costello, Michael; Vinegar, Harold J.

2012-10-02

A method of heating a portion of a subsurface formation includes drawing fuel on a fuel carrier through an opening formed in the formation. Oxidant is supplied to the fuel at one or more locations in the opening. The fuel is combusted with the oxidant to provide heat to the formation.

Well-to-wheels analysis of fuel-cell vehicle/fuel systems

International Nuclear Information System (INIS)

Wang, M.

2002-01-01

Major automobile companies worldwide are undertaking vigorous research and development efforts aimed at developing fuel-cell vehicles (FCVs). Proton membrane exchange (PEM)-based FCVs require hydrogen (H(sub 2)) as the fuel-cell (FC) fuel. Because production and distribution infrastructure for H(sub 2) off board FCVs as a transportation fuel does not exist yet, researchers are developing FCVs that can use hydrocarbon fuels, such as methanol (MeOH) and gasoline, for onboard production of H(sub 2) via fuel processors. Direct H(sub 2) FCVs have no vehicular emissions, while FCVs powered by hydrocarbon fuels have near-zero emissions of criteria pollutants and some carbon dioxide (CO(sub 2)) emissions. However, production of H(sub 2) can generate a large amount of emissions and suffer significant energy losses. A complete evaluation of the energy and emission impacts of FCVs requires an analysis of energy use and emissions during all stages, from energy feedstock wells to vehicle wheels-a so-called ''well-to-wheels'' (WTW) analysis. This paper focuses on FCVs powered by several transportation fuels. Gasoline vehicles (GVs) equipped with internal combustion engines (ICEs) are the baseline technology to which FCVs are compared. Table 1 lists the 13 fuel pathways included in this study. Petroleum-to-gasoline (with 30-ppm sulfur[S] content) is the baseline fuel pathway for GVs

Fuel loading and homogeneity analysis of HFIR design fuel plates loaded with uranium silicide fuel

International Nuclear Information System (INIS)

Blumenfeld, P.E.

1995-08-01

Twelve nuclear reactor fuel plates were analyzed for fuel loading and fuel loading homogeneity by measuring the attenuation of a collimated X-ray beam as it passed through the plates. The plates were identical to those used by the High Flux Isotope Reactor (HFIR) but were loaded with uranium silicide rather than with HFIR's uranium oxide fuel. Systematic deviations from nominal fuel loading were observed as higher loading near the center of the plates and underloading near the radial edges. These deviations were within those allowed by HFIR specifications. The report begins with a brief background on the thermal-hydraulic uncertainty analysis for the Advanced Neutron Source (ANS) Reactor that motivated a statistical description of fuel loading and homogeneity. The body of the report addresses the homogeneity measurement techniques employed, the numerical correction required to account for a difference in fuel types, and the statistical analysis of the resulting data. This statistical analysis pertains to local variation in fuel loading, as well as to ''hot segment'' analysis of narrow axial regions along the plate and ''hot streak'' analysis, the cumulative effect of hot segment loading variation. The data for all twelve plates were compiled and divided into 20 regions for analysis, with each region represented by a mean and a standard deviation to report percent deviation from nominal fuel loading. The central regions of the plates showed mean values of about +3% deviation, while the edge regions showed mean values of about -7% deviation. The data within these regions roughly approximated random samplings from normal distributions, although the chi-square (χ 2 ) test for goodness of fit to normal distributions was not satisfied

Cost reductions of fuel cells for transport applications: fuel processing options

Energy Technology Data Exchange (ETDEWEB)

Teagan, W P; Bentley, J; Barnett, B [Arthur D. Little, Inc., Cambridge, MA (United States)

1998-03-15

The highly favorable efficiency/environmental characteristics of fuel cell technologies have now been verified by virtue of recent and ongoing field experience. The key issue regarding the timing and extent of fuel cell commercialization is the ability to reduce costs to acceptable levels in both stationary and transport applications. It is increasingly recognized that the fuel processing subsystem can have a major impact on overall system costs, particularly as ongoing R and D efforts result in reduction of the basic cost structure of stacks which currently dominate system costs. The fuel processing subsystem for polymer electrolyte membrane fuel cell (PEMFC) technology, which is the focus of transport applications, includes the reformer, shift reactors, and means for CO reduction. In addition to low cost, transport applications require a fuel processor that is compact and can start rapidly. This paper describes the impact of factors such as fuel choice operating temperature, material selection, catalyst requirements, and controls on the cost of fuel processing systems. There are fuel processor technology paths which manufacturing cost analyses indicate are consistent with fuel processor subsystem costs of under $150/kW in stationary applications and $30/kW in transport applications. As such, the costs of mature fuel processing subsystem technologies should be consistent with their use in commercially viable fuel cell systems in both application categories. (orig.)

Design Package for Fuel Retrieval System Fuel Handling Tool Modification

International Nuclear Information System (INIS)

TEDESCHI, D.J.

2000-01-01

This is a design package that contains the details for a modification to a tool used for moving fuel elements during loading of MCO Fuel Baskets for the Fuel Retrieval System. The tool is called the fuel handling tool (or stinger). This document contains requirements, development design information, tests, and test reports

Behaviour of defective CANDU fuel: fuel oxidation kinetic and thermodynamic modelling

International Nuclear Information System (INIS)

Higgs, J.

2005-01-01

The thermal performance of operating CANDU fuel under defect conditions is affected by the ingress of heavy water into the fuel element. A mechanistic model has been developed to predict the extent of fuel oxidation in defective fuel and its affect on fuel thermal performance. A thermodynamic treatment of such oxidized fuel has been performed as a basis for the boundary conditions in the kinetic model. Both the kinetic and thermodynamic models have been benchmarked against recent experimental work. (author)

Nuclear fuel storage

International Nuclear Information System (INIS)

Bevilacqua, F.

1979-01-01

A method and apparatus for the storage of fuel in a stainless steel egg crate structure within a storage pool are described. Fuel is initially stored in a checkerboard pattern or in each opening if the fuel is of low enrichment. Additional fuel (or fuel of higher enrichment) is later stored by adding stainless steel angled plates within each opening, thereby forming flux traps between the openings. Still higher enrichment fuel is later stored by adding poison plates either with or without the stainless steel angles. 8 claims

Fuel handling machine and auxiliary systems for a fuel handling cell

International Nuclear Information System (INIS)

Suikki, M.

2013-10-01

This working report is an update for as well as a supplement to an earlier fuel handling machine design (Kukkola and Roennqvist 2006). A focus in the earlier design proposal was primarily on the selection of a mechanical structure and operating principle for the fuel handling machine. This report introduces not only a fuel handling machine design but also auxiliary fuel handling cell equipment and its operation. An objective of the design work was to verify the operating principles of and space allocations for fuel handling cell equipment. The fuel handling machine is a remote controlled apparatus capable of handling intensely radiating fuel assemblies in the fuel handling cell of an encapsulation plant. The fuel handling cell is air tight space radiation-shielded with massive concrete walls. The fuel handling machine is based on a bridge crane capable of traveling in the handling cell along wall tracks. The bridge crane has its carriage provided with a carousel type turntable having mounted thereon both fixed and telescopic masts. The fixed mast has a gripper movable on linear guides for the transfer of fuel assemblies. The telescopic mast has a manipulator arm capable of maneuvering equipment present in the fuel handling cell, as well as conducting necessary maintenance and cleaning operations or rectifying possible fault conditions. The auxiliary fuel handling cell systems consist of several subsystems. The subsystems include a service manipulator, a tool carrier for manipulators, a material hatch, assisting winches, a vacuum cleaner, as well as a hose reel. With the exception of the vacuum cleaner, the devices included in the fuel handling cell's auxiliary system are only used when the actual encapsulation process is not ongoing. The malfunctions of mechanisms or actuators responsible for the motion actions of a fuel handling machine preclude in a worst case scenario the bringing of the fuel handling cell and related systems to a condition appropriate for

Fuel handling machine and auxiliary systems for a fuel handling cell

Energy Technology Data Exchange (ETDEWEB)

Suikki, M. [Optimik Oy, Turku (Finland)

2013-10-15

This working report is an update for as well as a supplement to an earlier fuel handling machine design (Kukkola and Roennqvist 2006). A focus in the earlier design proposal was primarily on the selection of a mechanical structure and operating principle for the fuel handling machine. This report introduces not only a fuel handling machine design but also auxiliary fuel handling cell equipment and its operation. An objective of the design work was to verify the operating principles of and space allocations for fuel handling cell equipment. The fuel handling machine is a remote controlled apparatus capable of handling intensely radiating fuel assemblies in the fuel handling cell of an encapsulation plant. The fuel handling cell is air tight space radiation-shielded with massive concrete walls. The fuel handling machine is based on a bridge crane capable of traveling in the handling cell along wall tracks. The bridge crane has its carriage provided with a carousel type turntable having mounted thereon both fixed and telescopic masts. The fixed mast has a gripper movable on linear guides for the transfer of fuel assemblies. The telescopic mast has a manipulator arm capable of maneuvering equipment present in the fuel handling cell, as well as conducting necessary maintenance and cleaning operations or rectifying possible fault conditions. The auxiliary fuel handling cell systems consist of several subsystems. The subsystems include a service manipulator, a tool carrier for manipulators, a material hatch, assisting winches, a vacuum cleaner, as well as a hose reel. With the exception of the vacuum cleaner, the devices included in the fuel handling cell's auxiliary system are only used when the actual encapsulation process is not ongoing. The malfunctions of mechanisms or actuators responsible for the motion actions of a fuel handling machine preclude in a worst case scenario the bringing of the fuel handling cell and related systems to a condition appropriate for

Impact of fuel fabrication and fuel management technologies on uranium management

International Nuclear Information System (INIS)

Arnsberger, P.L.; Stucker, D.L.

1994-01-01

Uranium utilization in commercial pressurized water reactors is a complex function of original NSSS design, utility energy requirements, fuel assembly design, fuel fabrication materials and fuel fabrication materials and fuel management optimization. Fuel design and fabrication technologies have reacted to the resulting market forcing functions with a combination of design and material changes. The technologies employed have included ever-increasing fuel discharge burnup, non-parasitic structural materials, burnable absorbers, and fissile material core zoning schemes (both in the axial and radial direction). The result of these technological advances has improved uranium utilization by roughly sixty percent from the infancy days of nuclear power to present fuel management. Fuel management optimization technologies have also been developed in recent years which provide fuel utilization improvements due to core loading pattern optimization. This paper describes the development and impact of technology advances upon uranium utilization in modern pressurized water reactors. 10 refs., 3 tabs., 10 figs

Methanol fuel processor and PEM fuel cell modeling for mobile application

Energy Technology Data Exchange (ETDEWEB)

Chrenko, Daniela [ISAT, University of Burgundy, Rue Mlle Bourgoise, 58000 Nevers (France); Gao, Fei; Blunier, Benjamin; Bouquain, David; Miraoui, Abdellatif [Transport and Systems Laboratory (SeT) - EA 3317/UTBM, Fuel cell Laboratory (FCLAB), University of Technology of Belfort-Montbeliard, Rue Thierry Mieg 90010, Belfort Cedex (France)

2010-07-15

The use of hydrocarbon fed fuel cell systems including a fuel processor can be an entry market for this emerging technology avoiding the problem of hydrogen infrastructure. This article presents a 1 kW low temperature PEM fuel cell system with fuel processor, the system is fueled by a mixture of methanol and water that is converted into hydrogen rich gas using a steam reformer. A complete system model including a fluidic fuel processor model containing evaporation, steam reformer, hydrogen filter, combustion, as well as a multi-domain fuel cell model is introduced. Experiments are performed with an IDATECH FCS1200 trademark fuel cell system. The results of modeling and experimentation show good results, namely with regard to fuel cell current and voltage as well as hydrogen production and pressure. The system is auto sufficient and shows an efficiency of 25.12%. The presented work is a step towards a complete system model, needed to develop a well adapted system control assuring optimized system efficiency. (author)

Fuel manufacturing and utilization

International Nuclear Information System (INIS)

2005-01-01

The efficient utilisation of nuclear fuel requires manufacturing facilities capable of making advanced fuel types, with appropriate quality control. Once made, the use of such fuels requires a proper understanding of their behaviour in the reactor environment, so that safe operation for the design life can be achieved. The International Atomic Energy Agency supports Member States to improve in-pile fuel performance and management of materials; and to develop advanced fuel technologies for ensuring reliability and economic efficiency of the nuclear fuel cycle. It provides assistance to Member States to support fuel-manufacturing capability, including quality assurance techniques, optimization of manufacturing parameters and radiation protection. The IAEA supports the development fuel modelling expertise in Member States, covering both normal operation and postulated and severe accident conditions. It provides information and support for the operation of Nuclear Power Plant to ensure that the environment and water chemistry is appropriate for fuel operation. The IAEA supports fuel failure investigations, including equipment for failed fuel detection and for post-irradiation examination and inspection, as well as fuel repair, it provides information and support research into the basic properties of fuel materials, including UO 2 , MOX and zirconium alloys. It further offers guidance on the relationship with back-end requirement (interim storage, transport, reprocessing, disposal), fuel utilization and management, MOX fuels, alternative fuels and advanced fuel technology

Measurement of fuel importance distribution in non-uniformly distributed fuel systems

International Nuclear Information System (INIS)

Yamane, Yoshihiro; Hirano, Yasushi; Yasui, Hazime; Izima, Kazunori; Shiroya, Seiji; Kobayashi, Keiji.

1995-01-01

A reactivity effect due to a spatial variation of nuclear fuel concentration is an important problem for nuclear criticality safety in a reprocessing plant. As a theory estimating this reactivity effect, the Goertzel and fuel importance theories are well known. It has been shown that the Goertzel's theory is valid in the range of our experiments based on measurements of reactivity effect and thermal neutron flux in non-uniformly distributed fuel systems. On the other hand, there have been no reports concerning systematic experimental studies on the flatness of fuel importance which is a more general index than the Goertzel's theory. It is derived from the perturbation theory that the fuel importance is proportional to the reactivity change resulting from a change of small amount of fuel mass. Using a uniform and three kinds of nonuniform fuel systems consisting of 93.2% enriched uranium plates and polyethylene plates, the fuel importance distributions were measured. As a result, it was found experimentally that the fuel importance distribution became flat, as its reactivity effect became large. Therefore it was concluded that the flatness of fuel importance distribution is the useful index for estimating reactivity effect of non-uniformly distributed fuel system. (author)

Taxation on vehicle fuels: its impacts on switching to cleaner fuels

International Nuclear Information System (INIS)

Hung, W.-T.

2006-01-01

Vehicular consumption of fossil fuel contributes over 90% of air pollution in Hong Kong. A key strategy to improve Hong Kong's air quality is to discourage dirty fuels (e.g., leaded petrol and high-sulphur diesel) and to promote the use of clean fuels (e.g., low-sulphur diesel and liquefied petroleum gas (LPG)). This paper presents the empirical evidence on the effectiveness of the Government's clean fuel programs that offer tax subsidy to lower the consumption cost of such fuels. For the cases of unleaded petrol and ultra-low-sulphur diesel, lower fuel duties were offered so that the prices of these fuels were below those of leaded petrol and conventional diesel. Conventional petrol and diesel were phased out. In order to decide on the level of fuel duty concessions required to introduce LPG for taxis and bio-diesel for other vehicles, various Government-run trial programs were introduced to obtain cost estimates of using these alternative cleaner fuels. LPG using vehicles were subsequently exempted from the fuel duty in order to attract taxi and light bus operators to switch to LPG. It is apparent that the higher the subsidy, the faster is the rate at which switching to cleaner fuels takes place

Fuels characterization studies. [jet fuels

Science.gov (United States)

Seng, G. T.; Antoine, A. C.; Flores, F. J.

1980-01-01

Current analytical techniques used in the characterization of broadened properties fuels are briefly described. Included are liquid chromatography, gas chromatography, and nuclear magnetic resonance spectroscopy. High performance liquid chromatographic ground-type methods development is being approached from several directions, including aromatic fraction standards development and the elimination of standards through removal or partial removal of the alkene and aromatic fractions or through the use of whole fuel refractive index values. More sensitive methods for alkene determinations using an ultraviolet-visible detector are also being pursued. Some of the more successful gas chromatographic physical property determinations for petroleum derived fuels are the distillation curve (simulated distillation), heat of combustion, hydrogen content, API gravity, viscosity, flash point, and (to a lesser extent) freezing point.

The Nuclear Fuel Cycle

International Nuclear Information System (INIS)

2011-08-01

This brochure describes the nuclear fuel cycle, which is an industrial process involving various activities to produce electricity from uranium in nuclear power reactors. The cycle starts with the mining of uranium and ends with the disposal of nuclear waste. The raw material for today's nuclear fuel is uranium. It must be processed through a series of steps to produce an efficient fuel for generating electricity. Used fuel also needs to be taken care of for reuse and disposal. The nuclear fuel cycle includes the 'front end', i.e. preparation of the fuel, the 'service period' in which fuel is used during reactor operation to generate electricity, and the 'back end', i.e. the safe management of spent nuclear fuel including reprocessing and reuse and disposal. If spent fuel is not reprocessed, the fuel cycle is referred to as an 'open' or 'once-through' fuel cycle; if spent fuel is reprocessed, and partly reused, it is referred to as a 'closed' nuclear fuel cycle.

Fuel assembly

International Nuclear Information System (INIS)

Yokota, Tokunobu.

1990-01-01

A fuel assembly used in a FBR type nuclear reactor comprises a plurality of fuel rods and a moderator guide member (water rod). A moderator exit opening/closing mechanism is formed at the upper portion of the moderator guide member for opening and closing a moderator exit. In the initial fuel charging operation cycle to the reactor, the moderator exit is closed by the moderator exit opening/closing mechanism. Then, voids are accumulated at the inner upper portion of the moderator guide member to harden spectrum and a great amount of plutonium is generated and accumulated in the fuel assembly. Further, in the fuel re-charging operation cycle, the moderator guide member is used having the moderator exit opened. In this case, voids are discharged from the moderator guide member to decrease the ratio, and the plutonium accumulated in the initial charging operation cycle is burnt. In this way, the fuel economy can be improved. (I.N.)

Carbon fuel particles used in direct carbon conversion fuel cells

Science.gov (United States)

Cooper, John F.; Cherepy, Nerine

2012-10-09

A system for preparing particulate carbon fuel and using the particulate carbon fuel in a fuel cell. Carbon particles are finely divided. The finely dividing carbon particles are introduced into the fuel cell. A gas containing oxygen is introduced into the fuel cell. The finely divided carbon particles are exposed to carbonate salts, or to molten NaOH or KOH or LiOH or mixtures of NaOH or KOH or LiOH, or to mixed hydroxides, or to alkali and alkaline earth nitrates.

Carbon Fuel Particles Used in Direct Carbon Conversion Fuel Cells

Science.gov (United States)

Cooper, John F.; Cherepy, Nerine

2008-10-21

A system for preparing particulate carbon fuel and using the particulate carbon fuel in a fuel cell. Carbon particles are finely divided. The finely dividing carbon particles are introduced into the fuel cell. A gas containing oxygen is introduced into the fuel cell. The finely divided carbon particles are exposed to carbonate salts, or to molten NaOH or KOH or LiOH or mixtures of NaOH or KOH or LiOH, or to mixed hydroxides, or to alkali and alkaline earth nitrates.

Fuel characteristics pertinent to the design of aircraft fuel systems, Supplement I : additional information on MIL-F-7914(AER) grade JP-5 fuel and several fuel oils

Science.gov (United States)

Barnett, Henry C; Hibbard, Robert R

1953-01-01

Since the release of the first NACA publication on fuel characteristics pertinent to the design of aircraft fuel systems (NACA-RM-E53A21), additional information has become available on MIL-F7914(AER) grade JP-5 fuel and several of the current grades of fuel oils. In order to make this information available to fuel-system designers as quickly as possible, the present report has been prepared as a supplement to NACA-RM-E53A21. Although JP-5 fuel is of greater interest in current fuel-system problems than the fuel oils, the available data are not as extensive. It is believed, however, that the limited data on JP-5 are sufficient to indicate the variations in stocks that the designer must consider under a given fuel specification. The methods used in the preparation and extrapolation of data presented in the tables and figures of this supplement are the same as those used in NACA-RM-E53A21.

Detection of failed fuel rods in shrouded BWR fuel assemblies

International Nuclear Information System (INIS)

Baero, G.; Boehm, W.; Goor, B.; Donnelly, T.

1988-01-01

A manipulator and an ultrasonic testing (UT) technique were developed to identify defective fuel rods in shrouded BWR fuel assemblies. The manipulator drives a UT probe axially through the bottom tie plate into the water channels between the fuel rods. The rotating UT probe locates defective fuel rods by ingressed water which attenuates the UT-signal. (author)

Interim report spent nuclear fuel retrieval system fuel handling development testing

Energy Technology Data Exchange (ETDEWEB)

Ketner, G.L.; Meeuwsen, P.V.; Potter, J.D.; Smalley, J.T.; Baker, C.P.; Jaquish, W.R.

1997-06-01

Fuel handling development testing was performed in support of the Fuel Retrieval System (FRS) Sub-Project at the Hanford Site. The project will retrieve spent nuclear fuel, clean and remove fuel from canisters, repackage fuel into baskets, and load fuel into a multi-canister overpack (MCO) for vacuum drying and interim dry storage. The FRS is required to retrieve basin fuel canisters, clean fuel elements sufficiently of uranium corrosion products (or sludge), empty fuel from canisters, sort debris and scrap from whole elements, and repackage fuel in baskets in preparation for MCO loading. The purpose of fuel handling development testing was to examine the systems ability to accomplish mission activities, optimization of equipment layouts for initial process definition, identification of special needs/tools, verification of required design changes to support performance specification development, and validation of estimated activity times/throughput. The test program was set up to accomplish this purpose through cold development testing using simulated and prototype equipment; cold demonstration testing using vendor expertise and systems; and graphical computer modeling to confirm feasibility and throughput. To test the fuel handling process, a test mockup that represented the process table was fabricated and installed. The test mockup included a Schilling HV series manipulator that was prototypic of the Schilling Hydra manipulator. The process table mockup included the tipping station, sorting area, disassembly and inspection zones, fuel staging areas, and basket loading stations. The test results clearly indicate that the Schilling Hydra arm cannot effectively perform the fuel handling tasks required unless it is attached to some device that can impart vertical translation, azimuth rotation, and X-Y translation. Other test results indicate the importance of camera locations and capabilities, and of the jaw and end effector tool design. 5 refs., 35 figs., 3 tabs.

Spent fuel storage practices and perspectives for WWER fuel in Eastern Europe

International Nuclear Information System (INIS)

Takats, F.

1999-01-01

In this lecture the general issues and options in spent fuel management and storage are reviewed. Quantities of spent fuel world-wide and spent fuel amounts in storage as well as spent fuel capacities are presented. Selected examples of typical spent fuel storage facilities are discussed. The storage technologies applied for WWER fuel is presented. Description of other relevant storage technologies is included

Nuclear power fuel cycle

International Nuclear Information System (INIS)

Havelka, S.; Jakesova, L.

1982-01-01

Economic problems are discussed of the fuel cycle (cost of the individual parts of the fuel cycle and the share of the fuel cycle in the price of 1 kWh), the technological problems of the fuel cycle (uranium ore mining and processing, uranium isotope enrichment, the manufacture of fuel elements, the building of long-term storage sites for spent fuel, spent fuel reprocessing, liquid and gaseous waste processing), and the ecologic aspects of the fuel cycle. (H.S.)

Compatibility analysis of DUPIC fuel (part5) - DUPIC fuel cycle economics analysis

Energy Technology Data Exchange (ETDEWEB)

Ko, Won Il; Choi, Hang Bok; Yang, Myung Seung

2000-08-01

This study examines the economics of the DUPIC fuel cycle using unit costs of fuel cycle components estimated based on conceptual designs. The fuel cycle cost (FCC) was calculated by a deterministic method in which reference values of fuel cycle components are used. The FCC was then analyzed by a Monte Carlo simulation to get the uncertainty of the FCC associated with the unit costs of the fuel cycle components. From the deterministic analysis on the one-batch equilibrium fuel cycle model, the DUPIC FCC was estimated to be 6.55-6.72 mills/kWh for proposed DUPIC fuel options, which is a little smaller than that of the once-through FCC by 0.04-0.28 mills/kWh. Considering the uncertainty (0.45-0.51 mills/kWh) of the FCC estimated by the Monte Carlo simulation method, the cost difference between the DUPIC and once-through fuel cycle is negligible. On the other hand, the material balance calculation has shown that the DUPIC fuel cycle can save natural uranium resources by -20% and reduce the spent fuel arising by -65%, compared with the once-through fuel cycle. In conclusion, the DUPIC fuel cycle possesses a strong advantage over the once-through fuel cycle from the viewpoint of the environmental effect.

Compatibility analysis of DUPIC fuel (part5) - DUPIC fuel cycle economics analysis

International Nuclear Information System (INIS)

Ko, Won Il; Choi, Hang Bok; Yang, Myung Seung

2000-08-01

This study examines the economics of the DUPIC fuel cycle using unit costs of fuel cycle components estimated based on conceptual designs. The fuel cycle cost (FCC) was calculated by a deterministic method in which reference values of fuel cycle components are used. The FCC was then analyzed by a Monte Carlo simulation to get the uncertainty of the FCC associated with the unit costs of the fuel cycle components. From the deterministic analysis on the one-batch equilibrium fuel cycle model, the DUPIC FCC was estimated to be 6.55-6.72 mills/kWh for proposed DUPIC fuel options, which is a little smaller than that of the once-through FCC by 0.04-0.28 mills/kWh. Considering the uncertainty (0.45-0.51 mills/kWh) of the FCC estimated by the Monte Carlo simulation method, the cost difference between the DUPIC and once-through fuel cycle is negligible. On the other hand, the material balance calculation has shown that the DUPIC fuel cycle can save natural uranium resources by -20% and reduce the spent fuel arising by -65%, compared with the once-through fuel cycle. In conclusion, the DUPIC fuel cycle possesses a strong advantage over the once-through fuel cycle from the viewpoint of the environmental effect

The Canadian CANDU fuel development program and recent fuel operating experience

International Nuclear Information System (INIS)

Lau, J.H.K.; Inch, W.W.R.; Cox, D.S.; Steed, R.G.; Kohn, E.; Macici, N.N.

1999-01-01

This paper reviews the performance of the CANDU fuel in the Canadian CANDU reactors in 1997 and 1998. The operating experience demonstrates that the CANDU fuel has performed very well. Over the two-year period, the fuel-bundle defect rate for all bundles irradiated in the Canadian CANDU reactors has remained very low, at between 0.006% to 0.016%. On a fuel element basis, this represents an element defect rate of less than about 0.0005%. One of the reasons for the good fuel performance is the support provided by the Canadian fuel research and development programs. These programs address operational issues and provide evolutionary improvements to the fuel products. The programs consist of the Fuel Technology Program, funded by the CANDU Owners Group, and the Advanced Fuel and Fuel Cycles Technology Program, funded by Atomic Energy of Canada Ltd. These two programs, which have been in place for many years, complement each other by sharing expert resources and experimental facilities. This paper describes the programs in 1999/2000, to provide an overview of the scope of the programs and the issues that these programs address. (author)

Fuel options for the fuel cell vehicle: hydrogen, methanol or gasoline?

International Nuclear Information System (INIS)

Thomas, C.E.; James, B.D.; Lomax, F.D. Jr.; Kuhn, I.F. Jr.

2000-01-01

Fuel cell vehicles can be powered directly by hydrogen or, with an onboard chemical processor, other liquid fuels such as gasoline or methanol. Most analysts agree that hydrogen is the preferred fuel in terms of reducing vehicle complexity, but one common perception is that the cost of a hydrogen infrastructure would be excessive. According to this conventional wisdom, the automobile industry must therefore develop complex onboard fuel processors to convert methanol, ethanol or gasoline to hydrogen. We show here, however, that the total fuel infrastructure cost to society including onboard fuel processors may be less for hydrogen than for either gasoline or methanol, the primary initial candidates currently under consideration for fuel cell vehicles. We also present the local air pollution and greenhouse gas advantages of hydrogen fuel cell vehicles compared to those powered by gasoline or methanol. (Author)

Fuel Production from Seawater and Fuel Cells Using Seawater.

Science.gov (United States)

Fukuzumi, Shunichi; Lee, Yong-Min; Nam, Wonwoo

2017-11-23

Seawater is the most abundant resource on our planet and fuel production from seawater has the notable advantage that it would not compete with growing demands for pure water. This Review focuses on the production of fuels from seawater and their direct use in fuel cells. Electrolysis of seawater under appropriate conditions affords hydrogen and dioxygen with 100 % faradaic efficiency without oxidation of chloride. Photoelectrocatalytic production of hydrogen from seawater provides a promising way to produce hydrogen with low cost and high efficiency. Microbial solar cells (MSCs) that use biofilms produced in seawater can generate electricity from sunlight without additional fuel because the products of photosynthesis can be utilized as electrode reactants, whereas the electrode products can be utilized as photosynthetic reactants. Another important source for hydrogen is hydrogen sulfide, which is abundantly found in Black Sea deep water. Hydrogen produced by electrolysis of Black Sea deep water can also be used in hydrogen fuel cells. Production of a fuel and its direct use in a fuel cell has been made possible for the first time by a combination of photocatalytic production of hydrogen peroxide from seawater and dioxygen in the air and its direct use in one-compartment hydrogen peroxide fuel cells to obtain electric power. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

Nuclear fuel

International Nuclear Information System (INIS)

Quinauk, J.P.

1990-01-01

Since 1985, Fragema has been marketing and selling the Advanced Fuel Assemby AFA whose main features are its zircaloy grids and removable top and bottom nozzles. It is this product, which exists for several different fuel assembly arrays and heights, that will be employed in the reactors at Daya Bay. Fragema employs gadolinium as the consumable poison to enable highperformance fuel management. More recently, the company has supplied fuel assemblies of the mixed-oxide(MOX) and enriched reprocessed uranium type. The reliability level of the fuel sold by Fragema is one of the highest in the world, thanks in particular to the excellence of the quality assurance and quality control programs that have been implemented at all stages of its design and manufacture

Methanol Fuel Cell

Science.gov (United States)

Voecks, G. E.

1985-01-01

In proposed fuel-cell system, methanol converted to hydrogen in two places. External fuel processor converts only part of methanol. Remaining methanol converted in fuel cell itself, in reaction at anode. As result, size of fuel processor reduced, system efficiency increased, and cost lowered.

Integrated fuel processor development

International Nuclear Information System (INIS)

Ahmed, S.; Pereira, C.; Lee, S. H. D.; Krumpelt, M.

2001-01-01

The Department of Energy's Office of Advanced Automotive Technologies has been supporting the development of fuel-flexible fuel processors at Argonne National Laboratory. These fuel processors will enable fuel cell vehicles to operate on fuels available through the existing infrastructure. The constraints of on-board space and weight require that these fuel processors be designed to be compact and lightweight, while meeting the performance targets for efficiency and gas quality needed for the fuel cell. This paper discusses the performance of a prototype fuel processor that has been designed and fabricated to operate with liquid fuels, such as gasoline, ethanol, methanol, etc. Rated for a capacity of 10 kWe (one-fifth of that needed for a car), the prototype fuel processor integrates the unit operations (vaporization, heat exchange, etc.) and processes (reforming, water-gas shift, preferential oxidation reactions, etc.) necessary to produce the hydrogen-rich gas (reformate) that will fuel the polymer electrolyte fuel cell stacks. The fuel processor work is being complemented by analytical and fundamental research. With the ultimate objective of meeting on-board fuel processor goals, these studies include: modeling fuel cell systems to identify design and operating features; evaluating alternative fuel processing options; and developing appropriate catalysts and materials. Issues and outstanding challenges that need to be overcome in order to develop practical, on-board devices are discussed

Fuel economy and life-cycle cost analysis of a fuel cell hybrid vehicle

Science.gov (United States)

Jeong, Kwi Seong; Oh, Byeong Soo

The most promising vehicle engine that can overcome the problem of present internal combustion is the hydrogen fuel cell. Fuel cells are devices that change chemical energy directly into electrical energy without combustion. Pure fuel cell vehicles and fuel cell hybrid vehicles (i.e. a combination of fuel cell and battery) as energy sources are studied. Considerations of efficiency, fuel economy, and the characteristics of power output in hybridization of fuel cell vehicle are necessary. In the case of Federal Urban Driving Schedule (FUDS) cycle simulation, hybridization is more efficient than a pure fuel cell vehicle. The reason is that it is possible to capture regenerative braking energy and to operate the fuel cell system within a more efficient range by using battery. Life-cycle cost is largely affected by the fuel cell size, fuel cell cost, and hydrogen cost. When the cost of fuel cell is high, hybridization is profitable, but when the cost of fuel cell is less than 400 US$/kW, a pure fuel cell vehicle is more profitable.

Nuclear fuel storage facility

International Nuclear Information System (INIS)

Matsumoto, Takashi; Isaka, Shinji.

1987-01-01

Purpose: To increase the spent fuel storage capacity and reduce the installation cost in a nuclear fuel storage facility. Constitution: Fuels handled in the nuclear fuel storage device of the present invention include the following four types: (1) fresh fuels, (2) 100 % reactor core charged fuels, (3) spent fuels just after taking out and (4) fuels after a certain period (for example one half-year) from taking out of the reactor. Reactivity is high for the fuels (1), and some of fuels (2), while low in the fuels (3) (4), Source intensity is strong for the fuels (3) and some of the fuels (2), while it is low for the fuels (1) and (4). Taking notice of the fact that the reactivity, radioactive source intensity and generated after heat are different in the respective fuels, the size of the pool and the storage capacity are increased by the divided storage control. While on the other hand, since the division is made in one identical pool, the control method becomes important, and the working range is restricted by means of a template, interlock, etc., the operation mode of the handling machine is divided into four, etc. for preventing errors. (Kamimura, M.)

Consequences of Fuel Failure on Criticality Safety of Used Nuclear Fuel

International Nuclear Information System (INIS)

Marshall, William J.; Wagner, John C.

2012-09-01

This report documents work performed for the Department of Energy's Office of Nuclear Energy (DOENE) Fuel Cycle Technologies Used Fuel Disposition Campaign to assess the impact of fuel reconfiguration due to fuel failure on the criticality safety of used nuclear fuel (UNF) in storage and transportation casks. This work was motivated by concerns related to the potential for fuel degradation during extended storage (ES) periods and transportation following ES, but has relevance to other potential causes of fuel reconfiguration. Commercial UNF in the United States is expected to remain in storage for longer periods than originally intended. Extended storage time and irradiation of nuclear fuel to high-burnup values (>45 GWd/t) may increase the potential for fuel failure during normal and accident conditions involving storage and transportation. Fuel failure, depending on the severity, can result in changes to the geometric configuration of the fuel, which has safety and regulatory implications for virtually all aspects of a UNF storage and transport system's performance. The potential impact of fuel reconfiguration on the safety of UNF in storage and transportation is dependent on the likelihood and extent of the fuel reconfiguration, which is not well understood and is currently an active area of research. The objective of this work is to assess and quantify the impact of postulated failed fuel configurations on the criticality safety of UNF in storage and transportation casks. Although this work is motivated by the potential for fuel degradation during ES periods and transportation following ES, it has relevance to fuel reconfiguration due to the effects of high burnup. Regardless of the ultimate disposition path, UNF will need to be transported at some point in the future. To investigate and quantify the impact of fuel reconfiguration on criticality safety limits, which are given in terms of the effective neutron multiplication factor, a set of failed fuel

The nuclear fuel cycle: (2) fuel element manufacture

International Nuclear Information System (INIS)

Doran, J.

1976-01-01

Large-scale production of nuclear fuel in the United Kingdom is carried out at Springfields Works of British Nuclear Fuels Ltd., a company formed from the United Kingdom Atomic Energy Authority in 1971. The paper describes in some detail the Springfields Works processes for the conversion of uranium ore concentrate to uranium tetrafluoride, then conversion of the tetrafluoride to either uranium metal for cladding in Magnox to form fuel for the British Mk I gas-cooled reactors, or to uranium hexafluoride for enrichment of the fissile 235 U isotope content at the Capenhurst Works of BNFL. Details are given of the reconversion at Springfields Works of this enriched uranium hexafluoride to uranium dioxide, which is pelleted and then clad in either stainless steel or zircaloy containers to form the fuel assemblies for the British Mk II AGR or advanced gas-cooled reactors or for the water reactor fuels. (author)

Fuel Assembly Damping Summary

Energy Technology Data Exchange (ETDEWEB)

Lee, Kanghee; Kang, Heungseok; Oh, Dongseok; Yoon, Kyungho; Kim, Hyungkyu; Kim, Jaeyong [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

2013-10-15

This paper summary the fuel assembly damping data in air/in still water/under flow, released from foreign fuel vendors, compared our data with the published data. Some technical issues in fuel assembly damping measurement testing are also briefly discussed. Understanding of each fuel assembly damping mechanisms according to the surrounding medium and flow velocity can support the fuel design improvement in fuel assembly dynamics and structural integrity aspect. Because the upgraded requirements of the newly-developed advanced reactor system will demands to minimize fuel design margin in integrity evaluation, reduction in conservatism of fuel assembly damping can contribute to alleviate the fuel design margin for sure. Damping is an energy dissipation mechanism in a vibrating mechanical structure and prevents a resonant structure from having infinite vibration amplitudes. The sources of fuel assembly damping are various from support friction to flow contribution, and it can be increased by the viscosity or drag of surrounding fluid medium or the average velocity of water flowing. Fuel licensing requires fuel design evaluation in transient or accidental condition. Dynamic response analysis of fuel assembly is to show fuel integrity and requires information on assembly-wise damping in dry condition and under wet or water flowing condition. However, damping measurement test for the full-scale fuel assembly prototype is not easy to carry out because of the scale (fuel prototype, test facility), unsteadiness of test data (scattering, random sampling and processing), instrumentation under water flowing (water-proof response measurement), and noise. LWR fuel technology division in KAERI is preparing the infra structure for damping measurement test of full-scale fuel assembly, to support fuel industries and related research activities. Here is a preliminary summary of fuel assembly damping, published in the literature. Some technical issues in fuel assembly damping

Nuclear fuel

Energy Technology Data Exchange (ETDEWEB)

Nakano, H [Power Reactor and Nuclear Fuel Development Corp., Tokyo (Japan)

1976-10-01

It is expected that nuclear power generation will reach 49 million kW in 1985 and 129 million kW in 1995, and the nuclear fuel having to be supplied and processed will increase in proportion to these values. The technical problems concerning nuclear fuel are presented on the basis of the balance between the benefit for human beings and the burden on the human beings. Recently, especially the downstream of nuclear fuel attracts public attention. Enriched uranium as the raw material for light water reactor fuel is almost monopolized by the U.S., and the technical information has not been published for fear of the diversion to nuclear weapons. In this paper, the present situations of uranium enrichment, fuel fabrication, transportation, reprocessing and waste disposal and the future problems are described according to the path of nuclear fuel cycle. The demand and supply of enriched uranium in Japan will be balanced up to about 1988, but afterwards, the supply must rely upon the early establishment of the domestic technology by centrifugal separation method. No problem remains in the fabrication of light water reactor fuel, but for the fabrication of mixed oxide fuel, the mechanization of the production facility and labor saving are necessary. The solution of the capital risk for the construction of the second reprocessing plant is the main problem. Japan must develop waste disposal techniques with all-out efforts.

Canadian power reactor fuel

International Nuclear Information System (INIS)

Page, R.D.

1976-03-01

The following subjects are covered: the basic CANDU fuel design, the history of the bundle design, the significant differences between CANDU and LWR fuel, bundle manufacture, fissile and structural materials and coolants used in the CANDU fuel program, fuel and material behaviour, and performance under irradiation, fuel physics and management, booster rods and reactivity mechanisms, fuel procurement, organization and industry, and fuel costs. (author)

14 CFR 29.979 - Pressure refueling and fueling provisions below fuel level.

Science.gov (United States)

2010-01-01

..., DEPARTMENT OF TRANSPORTATION AIRCRAFT AIRWORTHINESS STANDARDS: TRANSPORT CATEGORY ROTORCRAFT Powerplant Fuel System § 29.979 Pressure refueling and fueling provisions below fuel level. (a) Each fueling connection... from that tank in case of malfunction of the fuel entry valve. (b) For systems intended for pressure...

IFBA credit in the Shearon Harris fuel racks with Vantage 5 fuel

International Nuclear Information System (INIS)

Boyd, W.A.; Schmidt, R.F.; Erwin, R.D.

1989-01-01

At the Shearon Harris nuclear plant, fuel management strategies are being considered which will result in feed fuel enrichments approaching 5.0 w/o U-235. These types of enrichments require a new criticality analysis to raise the existing fuel rack enrichment limit. It is receiving Westinghouse Vantage 5 fuel with integral fuel burnable absorber (IFBA) rods providing the depletable neutron absorber. An analysis was performed on the fuel racks which demonstrates that fuel enriched up to 5.0 w/o U-235 can be stored by taking credit for the IFBA rods present in the high enriched fuel assemblies. This is done by calculating the maximum Vantage 5 fuel assembly reactivity that can be placed in the fuel racks and meet the criticality K-eff limit. A methodology is also developed which conservatively calculates the minimum number of IFBA rods needed per assembly to meet the fuel rack storage limits. This eliminates the need for core designers to determine assembly K-inf terms for every different enrichment/IFBA combination

Future automotive fuels

International Nuclear Information System (INIS)

Lepik, M.

1993-01-01

There are several important factors which are fundamental to the choice of alternative automobile fuels: the chain of energetic efficiency of fuels; costs; environmental friendliness; suitability for usual engines or adapting easiness; existing reserves of crude oil, natural gas or the fossil energy sources; and, alternatively, agricultural potentiality. This paper covers all these factors. The fuels dealt with in this paper are alcohol, vegetable oil, gaseous fuel, hydrogen and ammonia fuels. Renewable fuels are the most valuable forms of renewable energy. In addition to that rank, they can contribute to three other problem areas: agricultural surpluses, environmental degradation, and conservation of natural resources. Due to the competitive utilization of biomass for food energy production, bio-fuels should mainly be produced in those countries where an energy shortage is combined with a food surplus. The fuels arousing the most interest are alcohol and vegetable oil, the latter for diesel engines, even in northern countries. (au)

CANDU RU fuel manufacturing basic technology development and advanced fuel verification tests

International Nuclear Information System (INIS)

Chung, Chang Hwan; Chang, S.K.; Hong, S.D.

1999-04-01

A PHWR advanced fuel named the CANFLEX fuel has been developed through a KAERI/AECL joint Program. The KAERI made fuel bundle was tested at the KAERI Hot Test Loop for the performance verification of the bundle design. The major test activities were the fuel bundle cross-flow test, the endurance fretting/vibration test, the freon CHF test, and the fuel bundle heat-up test. KAERI also has developing a more advanced PHWR fuel, the CANFLEX-RU fuel, using recovered uranium to extend fuel burn-up in the CANDU reactors. For the purpose of proving safety of the RU handling techniques and appraising feasibility of the CANFLEX-RU fuel fabrication in near future, a physical, chemical and radiological characterization of the RU powder and pellets was performed. (author). 54 refs., 46 tabs., 62 figs

CANDU RU fuel manufacturing basic technology development and advanced fuel verification tests

Energy Technology Data Exchange (ETDEWEB)

Chung, Chang Hwan; Chang, S.K.; Hong, S.D. [and others

1999-04-01

A PHWR advanced fuel named the CANFLEX fuel has been developed through a KAERI/AECL joint Program. The KAERI made fuel bundle was tested at the KAERI Hot Test Loop for the performance verification of the bundle design. The major test activities were the fuel bundle cross-flow test, the endurance fretting/vibration test, the freon CHF test, and the fuel bundle heat-up test. KAERI also has developing a more advanced PHWR fuel, the CANFLEX-RU fuel, using recovered uranium to extend fuel burn-up in the CANDU reactors. For the purpose of proving safety of the RU handling techniques and appraising feasibility of the CANFLEX-RU fuel fabrication in near future, a physical, chemical and radiological characterization of the RU powder and pellets was performed. (author). 54 refs., 46 tabs., 62 figs.

Performance of candu-6 fuel bundles manufactured in romania nuclear fuel plant

International Nuclear Information System (INIS)

Bailescu, A.; Barbu, A.; Din, F.; Dinuta, G.; Dumitru, I.; Musetoiu, A.; Serban, G.; Tomescu, A.

2013-01-01

The purpose of this article is to present the performance of nuclear fuel produced by Nuclear Fuel Plant (N.F.P.) - Pitesti during 1995 - 2012 and irradiated in units U1 and U2 from Nuclear Power Plant (N.P.P.) Cernavoda and also present the Nuclear Fuel Plant (N.F.P.) - Pitesti concern for providing technology to prevent the failure causes of fuel bundles in the reactor. This article presents Nuclear Fuel Plant (N.F.P.) - Pitesti experience on tracking performance of nuclear fuel in reactor and strategy investigation of fuel bundles notified as suspicious and / or defectives both as fuel element and fuel bundle, it analyzes the possible defects that can occur at fuel bundle or fuel element and can lead to their failure in the reactor. Implementation of modern technologies has enabled optimization of manufacturing processes and hence better quality stability of achieving components (end caps, chamfered sheath), better verification of end cap - sheath welding. These technologies were qualified by Nuclear Fuel Plant (N.F.P.) - Pitesti on automatic and Computer Numerical Control (C.N.C.) programming machines. A post-irradiation conclusive analysis which will take place later this year (2013) in Institute for Nuclear Research Pitesti (the action was initiated earlier this year by bringing a fuel bundle which has been reported defective by pool visual inspection) will provide additional information concerning potential damage causes of fuel bundles due to manufacturing processes. (authors)

Structure of fuel performance audit code for SFR metal fuel

Energy Technology Data Exchange (ETDEWEB)

Yang, Yong Sik; Kim, Hyo Chan [KAERI, Daejeon (Korea, Republic of); Jeong, Hye Dong; Shin, An Dong; Suh, Nam Duk [Korea Institute of Nuclear Safety, Daejeon (Korea, Republic of)

2012-10-15

A Sodium Cooled Fast Reactor (SFR) is a promising option to solve the spent fuel problems, but, there are still much technical issues to commercialize a SFR. One of issues is a development of advanced fuel which can solve the safety and the economic issues at the same time. Since a nuclear fuel is the first barrier to protect radioactive isotope release, the fuel's integrity must be secured. In Korea Institute of Nuclear Safety (KINS), the new project has been started to develop the regulatory technology for SFR system including a fuel area. To evaluate the fuel integrity and safety during an irradiation, the fuel performance code must be used for audit calculation. To develop the new code system, the code structure design and its requirements need to be studied. Various performance models and code systems are reviewed and their characteristics are analyzed in this paper. Based on this study, the fundamental performance models are deduced and basic code requirements and structure are established.

Fuel nozzle assembly

Science.gov (United States)

Johnson, Thomas Edward [Greer, SC; Ziminsky, Willy Steve [Simpsonville, SC; Lacey, Benjamin Paul [Greer, SC; York, William David [Greer, SC; Stevenson, Christian Xavier [Inman, SC

2011-08-30

A fuel nozzle assembly is provided. The assembly includes an outer nozzle body having a first end and a second end and at least one inner nozzle tube having a first end and a second end. One of the nozzle body or nozzle tube includes a fuel plenum and a fuel passage extending therefrom, while the other of the nozzle body or nozzle tube includes a fuel injection hole slidably aligned with the fuel passage to form a fuel flow path therebetween at an interface between the body and the tube. The nozzle body and the nozzle tube are fixed against relative movement at the first ends of the nozzle body and nozzle tube, enabling the fuel flow path to close at the interface due to thermal growth after a flame enters the nozzle tube.

Fuel element services

International Nuclear Information System (INIS)

Marta, H.; Alvarez, P.; Jimenez, J.

2006-01-01

Refuelling outages comprise a number of maintenance tasks scheduled long in advance to assure a reliable operation throughout the next cycle and, in the long run, a safer and more efficient plant. Most of these tasks are routine service of mechanical and electrical system and likewise fuel an be considered a critical component as to handling, inspection, cleaning and repair. ENUSA-ENWESA AIE has been working in this area since 1995 growing from fuel repair to a more integrated service that includes new and spent fuel handling, inserts, failed fuel rod detection systems, ultrasonic fuel cleaning, fuel repair and a comprehensive array of inspection and tests related to the reliability of the mechanical components in the fuel assembly, all this, performed in compliance with quality, safety, health physics and any other nuclear standard. (Author)

Fossil Fuels.

Science.gov (United States)

Crank, Ron

This instructional unit is one of 10 developed by students on various energy-related areas that deals specifically with fossil fuels. Some topics covered are historic facts, development of fuels, history of oil production, current and future trends of the oil industry, refining fossil fuels, and environmental problems. Material in each unit may…

Subchannel analysis of sodium-cooled reactor fuel assemblies with annular fuel pins

International Nuclear Information System (INIS)

Memmott, Matthew; Buongiorno, Jacopo; Hejzlar, Pavel

2009-01-01

Using a RELAP5-3D subchannel analysis model, the thermal-hydraulic behavior of sodium-cooled fuel assemblies with internally and externally cooled annular fuel rods was investigated, in an effort to enhance the economic performance of sodium-fast reactors by increasing the core power density, decreasing the core pressure drop, and extending the fuel discharge burnup. Both metal and oxide fuels at high and low conversion ratios (CR=0.25 and CR=1.00) were investigated. The externally and internally cooled annular fuel design is most beneficial when applied to the low CR core, as clad temperatures are reduced by up to 62.3degC for the oxide fuel, and up to 18.5degC for the metal fuel. This could result in a power uprates of up to ∼44% for the oxide fuel, and up to ∼43% for the metal fuel. The use of duct ribs was explored to flatten the temperature distribution at the core outlet. Subchannel analyses revealed that no fuel melting would occur in the case of complete blockage of the hot interior-annular channel for both metal and oxide fuels. Also, clad damage would not occur for the metal fuel if the power uprate is 38% or less, but would indeed occur for the oxide fuel. (author)

Solid Oxide Fuel Cells Operating on Alternative and Renewable Fuels

Energy Technology Data Exchange (ETDEWEB)

Wang, Xiaoxing; Quan, Wenying; Xiao, Jing; Peduzzi, Emanuela; Fujii, Mamoru; Sun, Funxia; Shalaby, Cigdem; Li, Yan; Xie, Chao; Ma, Xiaoliang; Johnson, David; Lee, Jeong; Fedkin, Mark; LaBarbera, Mark; Das, Debanjan; Thompson, David; Lvov, Serguei; Song, Chunshan

2014-09-30

This DOE project at the Pennsylvania State University (Penn State) initially involved Siemens Energy, Inc. to (1) develop new fuel processing approaches for using selected alternative and renewable fuels – anaerobic digester gas (ADG) and commercial diesel fuel (with 15 ppm sulfur) – in solid oxide fuel cell (SOFC) power generation systems; and (2) conduct integrated fuel processor – SOFC system tests to evaluate the performance of the fuel processors and overall systems. Siemens Energy Inc. was to provide SOFC system to Penn State for testing. The Siemens work was carried out at Siemens Energy Inc. in Pittsburgh, PA. The unexpected restructuring in Siemens organization, however, led to the elimination of the Siemens Stationary Fuel Cell Division within the company. Unfortunately, this led to the Siemens subcontract with Penn State ending on September 23rd, 2010. SOFC system was never delivered to Penn State. With the assistance of NETL project manager, the Penn State team has since developed a collaborative research with Delphi as the new subcontractor and this work involved the testing of a stack of planar solid oxide fuel cells from Delphi.

Response of a direct methanol fuel cell to fuel change

Energy Technology Data Exchange (ETDEWEB)

Leo, T.J. [Dpto de Sistemas Oceanicos y Navales- ETSI Navales, Univ. Politecnica de Madrid, Avda Arco de la Victoria s/n, 28040 Madrid (Spain); Raso, M.A.; de la Blanca, E. Sanchez [Dpto de Quimica Fisica I- Fac. CC. Quimicas, Univ. Complutense de Madrid, Avda Complutense s/n, 28040 Madrid (Spain); Navarro, E.; Villanueva, M. [Dpto de Motopropulsion y Termofluidodinamica, ETSI Aeronauticos, Univ. Politecnica de Madrid, Pza Cardenal Cisneros 3, 28040 Madrid (Spain); Moreno, B. [Instituto de Ceramica y Vidrio, Consejo Superior de Investigaciones Cientificas, C/Kelsen 5, Campus de la UAM, 28049 Cantoblanco, Madrid (Spain)

2010-10-15

Methanol and ethanol have recently received much attention as liquid fuels particularly as alternative 'energy-vectors' for the future. In this sense, to find a direct alcohol fuel cell that able to interchange the fuel without losing performances in an appreciable way would represent an evident advantage in the field of portable applications. In this work, the response of a in-house direct methanol fuel cell (DMFC) to the change of fuel from methanol to ethanol and its behaviour at different ambient temperature values have been investigated. A corrosion study on materials suitable to fabricate the bipolar plates has been carried out and either 316- or 2205-duplex stainless steels have proved to be adequate for using in direct alcohol fuel cells. Polarization curves have been measured at different ambient temperature values, controlled by an experimental setup devised for this purpose. Data have been fitted to a model taking into account the temperature effect. For both fuels, methanol and ethanol, a linear dependence of adjustable parameters with temperature is obtained. Fuel cell performance comparison in terms of open circuit voltage, kinetic and resistance is established. (author)

Effect of broadened-specification fuels on aircraft engines and fuel systems

Science.gov (United States)

Rudey, R. A.

1979-01-01

A wide variety of studies on the potential effects of broadened-specification fuels on future aircraft engines and fuel systems are summarized. The compositions and characteristics of aircraft fuels that may be derived from current and future crude-oil sources are described, and the most critical properties that may affect aircraft engines and fuel systems are identified and discussed. The problems that are most likely to be encountered because of changes in selected fuel properties are described; and the related effects on engine performance, component durability and maintenance, and aircraft fuel-system performance are discussed. The ability of current technology to accept possible future fuel-specification changes is discussed, and selected technological advances that can reduce the severity of the potential problems are illustrated.

Highly durable, coking and sulfur tolerant, fuel-flexible protonic ceramic fuel cells.

Science.gov (United States)

Duan, Chuancheng; Kee, Robert J; Zhu, Huayang; Karakaya, Canan; Chen, Yachao; Ricote, Sandrine; Jarry, Angelique; Crumlin, Ethan J; Hook, David; Braun, Robert; Sullivan, Neal P; O'Hayre, Ryan

2018-05-01

Protonic ceramic fuel cells, like their higher-temperature solid-oxide fuel cell counterparts, can directly use both hydrogen and hydrocarbon fuels to produce electricity at potentially more than 50 per cent efficiency 1,2 . Most previous direct-hydrocarbon fuel cell research has focused on solid-oxide fuel cells based on oxygen-ion-conducting electrolytes, but carbon deposition (coking) and sulfur poisoning typically occur when such fuel cells are directly operated on hydrocarbon- and/or sulfur-containing fuels, resulting in severe performance degradation over time 3-6 . Despite studies suggesting good performance and anti-coking resistance in hydrocarbon-fuelled protonic ceramic fuel cells 2,7,8 , there have been no systematic studies of long-term durability. Here we present results from long-term testing of protonic ceramic fuel cells using a total of 11 different fuels (hydrogen, methane, domestic natural gas (with and without hydrogen sulfide), propane, n-butane, i-butane, iso-octane, methanol, ethanol and ammonia) at temperatures between 500 and 600 degrees Celsius. Several cells have been tested for over 6,000 hours, and we demonstrate excellent performance and exceptional durability (less than 1.5 per cent degradation per 1,000 hours in most cases) across all fuels without any modifications in the cell composition or architecture. Large fluctuations in temperature are tolerated, and coking is not observed even after thousands of hours of continuous operation. Finally, sulfur, a notorious poison for both low-temperature and high-temperature fuel cells, does not seem to affect the performance of protonic ceramic fuel cells when supplied at levels consistent with commercial fuels. The fuel flexibility and long-term durability demonstrated by the protonic ceramic fuel cell devices highlight the promise of this technology and its potential for commercial application.

Fuel element loading system

International Nuclear Information System (INIS)

Arya, S.P; s.

1978-01-01

A nuclear fuel element loading system is described which conveys a plurality of fuel rods to longitudinal passages in fuel elements. Conveyor means successively position the fuel rods above the longitudinal passages in axial alignment therewith and adapter means guide the fuel rods from the conveyor means into the longitudinal passages. The fuel elements are vibrated to cause the fuel rods to fall into the longitudinal passages through the adapter means

Hydrogen as a fuel for fuel cell vehicles: A technical and economic comparison

Energy Technology Data Exchange (ETDEWEB)

Ogden, J.; Steinbugler, M.; Kreutz, T. [Princeton Univ., NJ (United States). Center for Energy and Environmental Studies

1997-12-31

All fuel cells currently being developed for near term use in vehicles require hydrogen as a fuel. Hydrogen can be stored directly or produced onboard the vehicle by reforming methanol, ethanol or hydrocarbon fuels derived from crude oil (e.g., Diesel, gasoline or middle distillates). The vehicle design is simpler with direct hydrogen storage, but requires developing a more complex refueling infrastructure. In this paper, the authors compare three leading options for fuel storage onboard fuel cell vehicles: compressed gas hydrogen storage; onboard steam reforming of methanol; onboard partial oxidation (POX) of hydrocarbon fuels derived from crude oil. Equilibrium, kinetic and heat integrated system (ASPEN) models have been developed to estimate the performance of onboard steam reforming and POX fuel processors. These results have been incorporated into a fuel cell vehicle model, allowing us to compare the vehicle performance, fuel economy, weight, and cost for various fuel storage choices and driving cycles. A range of technical and economic parameters were considered. The infrastructure requirements are also compared for gaseous hydrogen, methanol and hydrocarbon fuels from crude oil, including the added costs of fuel production, storage, distribution and refueling stations. Considering both vehicle and infrastructure issues, the authors compare hydrogen to other fuel cell vehicle fuels. Technical and economic goals for fuel cell vehicle and hydrogen technologies are discussed. Potential roles for hydrogen in the commercialization of fuel cell vehicles are sketched.

Fabrication of PWR fuel assembly and CANDU fuel bundle

International Nuclear Information System (INIS)

Lee, G.S.; Suh, K.S.; Chang, H.I.; Chung, S.H.

1980-01-01

For the project of localization of nuclear fuel fabrication, the R and D to establish the fabrication technology of CANDU fuel bundle as well as PWR fuel assembly was carried out. The suitable boss height and the prober Beryllium coating thickness to get good brazing condition of appendage were studied in the fabrication process of CANDU fuel rod. Basic Studies on CANLUB coating method also were performed. Problems in each fabrication process step and process flow between steps were reviewed and modified. The welding conditions for top and bottom nozzles, guide tube, seal and thimble screw pin were established in the fabrication processes of PWR fuel assembly. Additionally, some researches for a part of PWR grid brazing problems are also carried out

Fuel tank integrity research : fuel tank analyses and test plans

Science.gov (United States)