
Sample records for genus psathyrostachys poaceae

  1. A phylogenetic analysis of the genus Psathyrostachys (Poaceae) based on one nuclear gene, three plastid genes, and morphology

    DEFF Research Database (Denmark)

    Petersen, Gitte; Seberg, Ole; Baden, Claus


    A phylogenetic analysis of the small, Central Asian genus Psathyrostachys Nevski is presented. The analysis is based on morphological characters and nucleotide sequence data from one nuclear gene, DMC1, and three plastid genes, rbcL, rpoA, and rpoC2. Separate analyses of the three data partitions...... (morphology, nuclear sequences, and plastid sequences) result in mostly congruent trees. The plastid and nuclear sequences produce completely congruent trees, and only the trees based on plastid sequences and morphological characters are incongruent. Combined analysis of all data results in a fairly well......-resolved strict consensus tree: Ps. rupestris is the sister to the remaining species, which are divided into two clades: one including Ps. fragilis and Ps. caduca, the other including Ps. juncea, Ps. huashanica, Ps. lanuginosa, Ps. stoloniformis, and Ps. kronenburgii. Pubescent culms and more than 20 mm long...

  2. Genome Evolution in the Genus Sorghum (Poaceae)




    • Background and Aims The roles of variation in DNA content in plant evolution and adaptation remain a major biological enigma. Chromosome number and 2C DNA content were determined for 21 of the 25 species of the genus Sorghum and analysed from a phylogenetic perspective.

  3. New records of the Genus Festuca L. (Poaceae for Colombia and Venezuela New records of the Genus Festuca L. (Poaceae for Colombia and Venezuela

    Directory of Open Access Journals (Sweden)

    Stancik Daniel


    Full Text Available The genus Festuca L. (Poaceae includes about 350-400 herbaceous species with wide cosmopolitan distribution (Watson & Dallwitz 1992. The center of distribution ofthe genus is in the meadows and steppes of North America and Eurasia. Sorne species are present in Australia, Tasmania, New Zealand, and W and SE Africa. High species diversity is found in the pampas of Argentina and the puna of the Andes, with approximately 40 species in Peru (Tovar 1993,30 in Bolivia (Renvoize 1998, and 30 in Argentina (Türpe 1969. So far, 26 native species are known from the páramos of the northern South America; about seven new species from this region will be described soon (author's unpublished data.The genus Festuca L. (Poaceae includes about 350-400 herbaceous species with wide cosmopolitan distribution (Watson & Dallwitz 1992. The center of distribution ofthe genus is in the meadows and steppes of North America and Eurasia. Sorne species are present in Australia, Tasmania, New Zealand, and W and SE Africa. High species diversity is found in the pampas of Argentina and the puna of the Andes, with approximately 40 species in Peru (Tovar 1993,30 in Bolivia (Renvoize 1998, and 30 in Argentina (Türpe 1969. So far, 26 native species are known from the páramos of the northern South America; about seven new species from this region will be described soon (author's unpublished data.

  4. Taxonomy and leaf anatomy of the genus Ehrharta (Poaceae in southern Africa: the Dura group

    Directory of Open Access Journals (Sweden)

    G. E. Gibbs Russel


    Full Text Available The Dura species group in the genus Ehrharta Thunb. is differentiated morphologically by the perennial habit and the very large, awned, subglabrous spikelets and anatomically by the occurrence of tanniniferous cells and wax platelets obscuring the stomatal pores. The Dura group consists of two species, E. dura Nees ex Trin. and E. microlaena Nees ex Trin., which occur only in Mountain Fynbos. The group shows no clear morphological or anatomical relationship with other species groups in the genus in southern Africa.

  5. Leaf anatomy of the South African Danthonieae (Poaceae. XV. The genus Elytrophorus

    Directory of Open Access Journals (Sweden)

    R. P. Ellis


    Full Text Available The leaf anatomy of  Elytrophorus globularis Hack, and  E. spicatus (Willd. A. Camus is described and illustrated from freshly fixed material from SWA/Namibia and Botswana. It is shown that these two species are anatomically indistinguishable. It is suggested that they are conspecific. and that  E. spicatus possibly represents juvenile plants with immature inflorescences. The anatomical evidence strongly refutes a chloridoid relationship for Elytrophorus but appears to support arundinoid affinities for the genus. Striking anatomical and ecological similarities exist between  Elytrophorus and  Sacciolepis huillensis (Rendle Stapf. No significant leaf anatomical differences separate  Elytrophorus from S.  huillensis and some of the other C3 panicoid taxa and. consequently,  Elytro­phorus may represent a link between the Arundinoideae and the Panicoideae.

  6. Leaf anatomy of the genus Ehrharta (Poaceae in southern Africa: the Setacea group

    Directory of Open Access Journals (Sweden)

    R. P. Ellis


    Full Text Available The leaf blade anatomy of the taxa of the Setacea group of species of the genus Ehrharta is described and illustrated. This group includes E. rupestris Nees ex Trin. subsp.  rupestris, subsp.  tricostata (Stapf Gibbs Russell and subsp.  dodii (Stapf Gibbs Russell, as well as E. setacea Nees subsp.  setacea, subsp.  scabra (Stapf Gibbs Russell, subsp.  uniflora (Burch, ex Stapf Gibbs Russell and subsp.  disticha Gibbs Russell. All these taxa share a very characteristic leaf anatomy with inrolled or infolded leaves without keels and have adaxial ribs with interlocking prickles. The chlorenchyma is dense and compact with inwardly projecting invaginations visible in all taxa except  E. setacea subsp.  setacea. In E .  setacea subsp. scabra typical arm cells are present. Abaxial costal and intercostal zones are not differentiated and stomata are absent. The long cells are hexagonal or inflated with sinuous walls. Silica bodies are single or paired and rounded in shape. Small hook-like prickles with short barbs are common. Microhairs with a short, truncated distal cell occur. This leaf anatomical structure differs considerably from that of the other species groups recognized in African  Ehrharta and the Setacea group appears to be more distinct from the other groups than they are from each other.

  7. Karyotype evolution in Phalaris (Poaceae): The role of reductional dysploidy, polyploidy and chromosome alteration in a wide-spread and diverse genus. (United States)

    Winterfeld, Grit; Becher, Hannes; Voshell, Stephanie; Hilu, Khidir; Röser, Martin


    Karyotype characteristics can provide valuable information on genome evolution and speciation, in particular in taxa with varying basic chromosome numbers and ploidy levels. Due to its worldwide distribution, remarkable variability in morphological traits and the fact that ploidy change plays a key role in its evolution, the canary grass genus Phalaris (Poaceae) is an excellent study system to investigate the role of chromosomal changes in species diversification and expansion. Phalaris comprises diploid species with two basic chromosome numbers of x = 6 and 7 as well as polyploids based on x = 7. To identify distinct karyotype structures and to trace chromosome evolution within the genus, we apply fluorescence in situ hybridisation (FISH) of 5S and 45S rDNA probes in four diploid and four tetraploid Phalaris species of both basic numbers. The data agree with a dysploid reduction from x = 7 to x = 6 as the result of reciprocal translocations between three chromosomes of an ancestor with a diploid chromosome complement of 2n = 14. We recognize three different genomes in the genus: (1) the exclusively Mediterranean genome A based on x = 6, (2) the cosmopolitan genome B based on x = 7 and (3) a genome C based on x = 7 and with a distribution in the Mediterranean and the Middle East. Both auto- and allopolyploidy of genomes B and C are suggested for the formation of tetraploids. The chromosomal divergence observed in Phalaris can be explained by the occurrence of dysploidy, the emergence of three different genomes, and the chromosome rearrangements accompanied by karyotype change and polyploidization. Mapping the recognized karyotypes on the existing phylogenetic tree suggests that genomes A and C are restricted to sections Phalaris and Bulbophalaris, respectively, while genome B occurs across all taxa with x = 7.

  8. Karyotype evolution in Phalaris (Poaceae: The role of reductional dysploidy, polyploidy and chromosome alteration in a wide-spread and diverse genus.

    Directory of Open Access Journals (Sweden)

    Grit Winterfeld

    Full Text Available Karyotype characteristics can provide valuable information on genome evolution and speciation, in particular in taxa with varying basic chromosome numbers and ploidy levels. Due to its worldwide distribution, remarkable variability in morphological traits and the fact that ploidy change plays a key role in its evolution, the canary grass genus Phalaris (Poaceae is an excellent study system to investigate the role of chromosomal changes in species diversification and expansion. Phalaris comprises diploid species with two basic chromosome numbers of x = 6 and 7 as well as polyploids based on x = 7. To identify distinct karyotype structures and to trace chromosome evolution within the genus, we apply fluorescence in situ hybridisation (FISH of 5S and 45S rDNA probes in four diploid and four tetraploid Phalaris species of both basic numbers. The data agree with a dysploid reduction from x = 7 to x = 6 as the result of reciprocal translocations between three chromosomes of an ancestor with a diploid chromosome complement of 2n = 14. We recognize three different genomes in the genus: (1 the exclusively Mediterranean genome A based on x = 6, (2 the cosmopolitan genome B based on x = 7 and (3 a genome C based on x = 7 and with a distribution in the Mediterranean and the Middle East. Both auto- and allopolyploidy of genomes B and C are suggested for the formation of tetraploids. The chromosomal divergence observed in Phalaris can be explained by the occurrence of dysploidy, the emergence of three different genomes, and the chromosome rearrangements accompanied by karyotype change and polyploidization. Mapping the recognized karyotypes on the existing phylogenetic tree suggests that genomes A and C are restricted to sections Phalaris and Bulbophalaris, respectively, while genome B occurs across all taxa with x = 7.

  9. Taxonomy and leaf anatomy of the genus Ehrharta (Poaceae) in southern Africa: the Dura group


    G. E. Gibbs Russel; R. P. Ellis


    The Dura species group in the genus Ehrharta Thunb. is differentiated morphologically by the perennial habit and the very large, awned, subglabrous spikelets and anatomically by the occurrence of tanniniferous cells and wax platelets obscuring the stomatal pores. The Dura group consists of two species, E. dura Nees ex Trin. and E. microlaena Nees ex Trin., which occur only in Mountain Fynbos. The group shows no clear morphological or anatomical relationship with other species groups in the ge...

  10. An empirical test of the treatment of indels during optimization alignment based on the phylogeny of the genus Secale (Poaceae)

    DEFF Research Database (Denmark)

    Petersen, Gitte; Seberg, Ole; Aagesen, Lone


    The ability of the program POY, implementing optimization alignment, to deal with major indels is explored and discussed in connection with a phylogenetic analysis of the genus Secale based on partial Adhl sequences. The Adhl sequences used span exon 2-4. Nearly all variation is found in intron 2...... recovers both genera as monophyletic when knowledge of the duplication is incorporated in the analysis. The phylogenetic relationships within Secale are not clearly resolved. Subspecific taxa of Secale strictum have identical sequences and they are confined to a monophyletic group. However, the two...

  11. Haploid Barley from the Intergeneric Cross Hordeum vulgare x Psathyrostachys fragilis

    DEFF Research Database (Denmark)

    Bothmer, Roland; Jacobsen, Niels; Bagger Jørgensen, Rikke


    The intergeneric hybrid Hordeum vulgare x Psathyrostachys fragilis was fairly easily obtained. During each growing season the intermediate, perennial hybrid yielded haploid tillers of H. vulgare. Late in one season few, hybrid tillers headed. The morphology, cytology and enzymatic patterns...

  12. Comparison of the karyotypes ofPsathyrostachys juncea andP. huashanica (Poaceae) studied by banding techniques

    DEFF Research Database (Denmark)

    Linde-Laursen, Ib; Bothmer, R. von


    . The patterns of both taxa are polymorphic, supporting that both taxa are outbreeders. The karyotypic characters suggest that P. juncea is more closely related to P. fragilis than either is to P. huashanica. N-banding stains weakly. Silver nitrate staining demonstrates that nucleolus organizers of both species...... have different nucleolus forming capacities. The presence of micronucleoli suggests that both species have an extra unidentified chromosome with nucleolus forming capacity....

  13. Anatomy and Cytogenetic Identification of a Wheat-Psathyrostachys huashanica Keng Line with Early Maturation.

    Directory of Open Access Journals (Sweden)

    Liangming Wang

    Full Text Available In previous studies, our research team successfully transferred the Ns genome from Psathyrostachys huashanica Keng into Triticum aestivum (common wheat cv. 7182 using embryo culture. In the present study, one of these lines, i.e., hybrid progeny 25-10-3, which matured about 10-14 days earlier than its wheat parent, was assessed using sequenced characterized amplified region (SCAR analysis, EST-SSR and EST-STS molecular markers, and genomic in situ hybridization (GISH. We found that this was a stable wheat-P. huashanica disomic addition line (2n = 44 = 22 II and the results demonstrated that it was a 6Ns disomic chromosome addition line, but it exhibited many different features compared with previously characterized lines, i.e., a longer awn, early maturation, and no twin spikelets. It was considered to be an early-maturing variety based on the early stage of inflorescence initiation in field experiments and binocular microscope observations over three consecutive years. This characteristic was distinct, especially from the single ridge stage and double ridge stage until the glume stage. In addition, it had a higher photosynthesis rate and economic values than common wheat cv. 7182, i.e., more spikelets per spike, more florets per spikelet, more kernels per spike, and a higher thousand-grain weight. These results suggest that this material may comprise a genetic pool of beneficial genes or chromosome segments, which are suitable for introgression to improve the quality of common wheat.

  14. Path and ridge regression analysis of seed yield and seed yield components of Russian wildrye (Psathyrostachys juncea Nevski) under field conditions

    DEFF Research Database (Denmark)

    Wang, Quanzhen; Zhang, Tiejun; Cui, Jian


    The correlations among seed yield components, and their direct and indirect effects on the seed yield (Z) of Russina wildrye (Psathyrostachys juncea Nevski) were investigated. The seed yield components: fertile tillers m-2 (Y1), spikelets per fertile tillers (Y2), florets per spikelet- (Y3), seed...

  15. A novel PCR-based marker for identifying Ns chromosomes in wheat-Psathyrostachys huashanica Keng derivative lines

    Directory of Open Access Journals (Sweden)

    J. Wang


    Full Text Available Psathyrostachys huashanica Keng is an endangered species that is endemic to China, which provides an important gene pool for wheat improvement. We developed a quick and reliable PCR-based diagnostic assay to accurately and efficiently detect P. huashanica DNA sequences from introgression lines, which was based on a species-specific marker derived from genomic DNA. The 900-bp PCR-amplified band used as a P. huashanica-specific RAPD marker was tested with 21 different plant species and was converted into a sequence-characterized amplified region (SCAR marker by cloning and sequencing the selected fragments (pHs11. This SCAR marker, which was designated as RHS23, could clearly distinguish the presence of P. huashanica DNA repetitive sequences in wheat-P. huashanica derivative lines. The specificity of the marker was validated using 21 different plant species and a complete set of wheat-P. huashanica disomic addition lines (1Ns–7Ns, 2n=44=22II. This specific sequence targeted the Ns genome of P. huashanica and it was present in all the seven P. huashanica chromosomes. Therefore, this SCAR marker is specific for P. huashanica chromosomes and may be used in the identification of alien repetitive sequences in large gene pools. This diagnostic PCR assay for screening the target genetic material may play a key role in marker-assisted selective breeding programs.

  16. Phylogeny and evolutionary history of Leymus (Triticeae; Poaceae based on a single-copy nuclear gene encoding plastid acetyl-CoA carboxylase

    Directory of Open Access Journals (Sweden)

    Ding Cun-Bang


    Full Text Available Abstract Background Single- and low- copy genes are less likely subject to concerted evolution, thus making themselves ideal tools for studying the origin and evolution of polyploid taxa. Leymus is a polyploid genus with a diverse array of morphology, ecology and distribution in Triticeae. The genomic constitution of Leymus was assigned as NsXm, where Ns was presumed to be originated from Psathyrostachys, while Xm represented a genome of unknown origin. In addition, little is known about the evolutionary history of Leymus. Here, we investigate the phylogenetic relationship, genome donor, and evolutionary history of Leymus based on a single-copy nuclear Acc1 gene. Results Two homoeologues of the Acc1 gene were isolated from nearly all the sampled Leymus species using allele-specific primer and were analyzed with those from 35 diploid taxa representing 18 basic genomes in Triticeae. Sequence diversity patterns and genealogical analysis suggested that (1 Leymus is closely related to Psathyrostachys, Agropyron, and Eremopyrum; (2 Psathyrostachys juncea is an ancestral Ns-genome donor of Leymus species; (3 the Xm genome in Leymus may be originated from an ancestral lineage of Agropyron and Eremopyrum triticeum; (4 the Acc1 sequences of Leymus species from the Qinghai-Tibetan plateau are evolutionarily distinct; (5 North America Leymus species might originate from colonization via the Bering land bridge; (6 Leymus originated about 11-12MYA in Eurasia, and adaptive radiation might have occurred in Leymus during the period of 3.7-4.3 MYA and 1.7-2.1 MYA. Conclusion Leymus species have allopolyploid origin. It is hypothesized that the adaptive radiation of Leymus species might have been triggered by the recent upliftings of the Qinghai-Tibetan plateau and subsequent climatic oscillations. Adaptive radiation may have promoted the rapid speciation, as well as the fixation of unique morphological characters in Leymus. Our results shed new light on our


    Directory of Open Access Journals (Sweden)

    Desy Yanuarita Wulandari


    Full Text Available Poaceae known as plants used as food ingredients in Indonesian. One area thas has high level diversity of plants Poaceae is Tahura R. Soerjo. Morphological characterization Poaceae in that region are still rare. The Goal for this research are to identify Poaceae tribes, and make photography Poaceae data that can be used as a supplement on Diversity of Plants course. This study included descriptive exploratory study with free cruising method. The species Poaceae has identified are Bambusa multiplex, Dendrocalamus asper, Digitaria radicosa, Echinochloa sp, Eragrostis unioloides, Lophatherum gracile, Oplismenus burmanni, Paspalidium flavidum, Pennisetum alopecuroides, Phragmites karka, Setaria parviflor. Suku Poaceae dikenal sebagai tumbuhan yang dimanfaatkan sebagai bahan pangan masyarakat Indonesia. Salah satu daerah yang memiliki tingkat keanekaragaman tumbuhan Poaceae adalah di Tahura R. Soerjo. Karakterisasi morfologi terkait suku Poaceae di daerah tersebut masih sedikit. Tujuan dalam penelitian ini adalah untuk identifikasi suku Poaceae, membuat data fotografi suku Poaceae sehingga dapat digunakan sebagai suplemen keanekaragaman tumbuhan. Penelitian ini termasuk penelitian deskriptif eksploratif dengan metode jelajah bebas. Sebelas spesies suku Poaceae yang telah teridentifikasi, yaitu Bambusa multiplex, Dendrocalamus asper, Digitaria radicosa, Echinochloa sp, Eragrostis unioloides, Lophatherum gracile, Oplismenus burmanni, Paspalidium flavidum, Pennisetum alopecuroides, Phragmites karka, Setaria parviflora.

  18. Development and characterization of a Psathyrostachys huashanica Keng 7Ns chromosome addition line with leaf rust resistance.

    Directory of Open Access Journals (Sweden)

    Wanli Du

    Full Text Available The aim of this study was to characterize a Triticum aestivum-Psathyrostachys huashanica Keng (2n = 2x = 14, NsNs disomic addition line 2-1-6-3. Individual line 2-1-6-3 plants were analyzed using cytological, genomic in situ hybridization (GISH, EST-SSR, and EST-STS techniques. The alien addition line 2-1-6-3 was shown to have two P. huashanica chromosomes, with a meiotic configuration of 2n = 44 = 22 II. We tested 55 EST-SSR and 336 EST-STS primer pairs that mapped onto seven different wheat chromosomes using DNA from parents and the P. huashanica addition line. One EST-SSR and nine EST-STS primer pairs indicated that the additional chromosome of P. huashanica belonged to homoeologous group 7, the diagnostic fragments of five EST-STS markers (BE404955, BE591127, BE637663, BF482781 and CD452422 were cloned, sequenced and compared. The results showed that the amplified polymorphic bands of P. huashanica and disomic addition line 2-1-6-3 shared 100% sequence identity, which was designated as the 7Ns disomic addition line. Disomic addition line 2-1-6-3 was evaluated to test the leaf rust resistance of adult stages in the field. We found that one pair of the 7Ns genome chromosomes carried new leaf rust resistance gene(s. Moreover, wheat line 2-1-6-3 had a superior numbers of florets and grains per spike, which were associated with the introgression of the paired P. huashanica chromosomes. These high levels of disease resistance and stable, excellent agronomic traits suggest that this line could be utilized as a novel donor in wheat breeding programs.

  19. Novedades nomenclaturales en Cenchrus s.l. (Poaceae: Panicoideae: Paniceae

    Directory of Open Access Journals (Sweden)

    Hugo F Gutiérrez


    Full Text Available Recientes estudios filogenéticos con datos morfológicos y moleculares aportaron evidencia sobre la monofilia de los géneros Cenchrus, Pennisetum y Odontelytrum y, por ello, se propuso su unificación y transferencia a Cenchrus, el cual tiene prioridad. Resultados preliminares de la revisión taxonómica del género Cenchrus s.l. para América (Gutiérrez, en preparación permitieron detectar problemas nomenclaturales. Para resolver dichos inconvenientes, en el presente trabajo se presentan nueve lectotipificaciones: Cenchrus bambusoides Caro & E.A. Sánchez, C. brevisetus E. Fourn., C. pennisetiformis Hochst. & Steud. var. intermedia Chiov., C. roseus E. Fourn., Gymnotrix mexicana E. Fourn., Hymenachne montana Griseb., Pennisetum amoenum Hochst. ex A. Rich., P. cenchroides Rich. var. hamphilahense Terracc., P. ciliare (L. Link var. anachoreticum Chiov., P. petraeum Steud., P. pringlei Leeke, P. tristachyum (Kunth Spreng. subsp. boliviense Chase, y se propone un nombre nuevo para Gymnotrix crinita Kunth.Nomenclatural novelties in Cenchrus s.l. (Poaceae: Panicoideae: Paniceae. Recent phylogenetic studies with morphological and molecular data provided evidence on the monophyly of the genera Cenchrus, Pennisetum and Odontelytrum. Therefore, these studies propose the unification and transfer of species of Pennisetum and Odontelytrum to the genus Cenchrus, which has priority. Nomenclatural problems were detected when conducting a preliminary taxonomic revision of the genus Cenchrus s.l. from America (Gutiérrez, in preparation. To resolve these inconveniences, nine lectotypifications: Cenchrus bambusoides Caro & E.A. Sánchez, C. brevisetus E. Fourn., C. pennisetiformis Hochst. & Steud. var. intermedia Chiov., C. roseus E. Fourn., Gymnotrix mexicana E. Fourn., Hymenachne montana Griseb., Pennisetum amoenum Hochst. ex A. Rich., P. cenchroides Rich. var. hamphilahense Terracc., P. ciliare (L. Link var. anachoreticum Chiov., P. petraeum Steud., P

  20. Complete plastid genome sequence of goosegrass (Eleusine indica) and comparison with other Poaceae. (United States)

    Zhang, Hui; Hall, Nathan; McElroy, J Scott; Lowe, Elijah K; Goertzen, Leslie R


    Eleusine indica, also known as goosegrass, is a serious weed in at least 42 countries. In this paper we report the complete plastid genome sequence of goosegrass obtained by de novo assembly of paired-end and mate-paired reads generated by Illumina sequencing of total genomic DNA. The goosegrass plastome is a circular molecule of 135,151bp in length, consisting of two single-copy regions separated by a pair of inverted repeats (IRs) of 20,919 bases. The large (LSC) and the small (SSC) single-copy regions span 80,667 bases and 12,646 bases, respectively. The plastome of goosegrass has 38.19% GC content and includes 108 unique genes, of which 76 are protein-coding, 28 are transfer RNA, and 4 are ribosomal RNA. The goosegrass plastome sequence was compared to eight other species of Poaceae. Although generally conserved with respect to Poaceae, this genomic resource will be useful for evolutionary studies within this weed species and the genus Eleusine. Copyright © 2016. Published by Elsevier B.V.

  1. Forma de crecimiento en Leptochloa Chloridiformis (Poaceae

    Directory of Open Access Journals (Sweden)

    Mariel G. Perreta


    Full Text Available Perreta, M. G., Tivano, J. C. & Vegetti, A. C. 2000. Forma de crecimiento en Leptochloachloridiformis (Poaceae. Darwiniana 38(3-4: 219-226.El objetivo de este trabajo fue analizar la forma de crecimiento de Leptochloa chloridiformis (Hack.Parodi. En esta especie perenne la ramificación ocurre principalmente a través de yemas axilarespresentes en la zona de innovación. Este sistema de ramificación genera una planta cespitosa, en la cual lasconexiones entre unidades estructurales son rizomas cortos. Dependiendo de su posición estas conexio-nes muestran diferentes tendencias en relación a la desarticulación estructural. En algunas plantas seobservó ramificación en la zona de entrenudos largos posiblemente debido a cambios ambientalesrelacionados con las distintas estaciones

  2. Comparison of the Giemsa C-banded karyotypes of the three subspecies of Psathyrostachys fragilis, subspp. villosus (2x), secaliformis (2x, 4x), and fragilis (2x) (Poaceae), with notes on chromosome pairing

    DEFF Research Database (Denmark)

    Linde-Laursen, I.; Baden, C.


    . Only the presence of 12 nucleoli in interphases identified 6 SAT-chromosome pairs. In subsp. villosus one or two extra micronucleoli indicated a chromosome pair with very low nucleolus-forming activity, bringing the number of SAT-chromosome pairs to 4. This number may be a characteristic...... of a common genome, N. NORs had different nucleolus-forming activities. Meiotic analysis demonstrated a high level of bivalent pairing in the three taxa. A chromosomal rearrangement was suggested in subsp. villosus. The low multivalent frequency in subsp. secaliformis indicates the presence of a pairing...

  3. Scanning electron microscopy of the leaf epidermis of Merostachys Spreng. (Poaceae: Bambusoideae Microscopia eletrônica de varredura da epiderme foliar de Merostachys Spreng. (Poaceae: Bambusoideae

    Directory of Open Access Journals (Sweden)

    Doria Maria Saiter Gomes


    Full Text Available This study presents data on leaf micromorphology of 13 species of Merostachys Spreng. (Poaceae: Bambusoideae, a neotropical genus with numerous endemic species. Greatest species richness is found in Central and Southern Brazil, with 41 of the 46 species described. Species were collected in the field at the localities: Itatiaia National Park and Tijuca National Park, Rio de Janeiro State; Fontes do Ipiranga State Park, São Paulo state; Santa Teresa, Espírito Santo State and Rio Doce State Park, Minas Gerais State. Dried plant material came from the herbarium at the São Paulo Botany Institute. The presence of prickles, silica bodies and macro hairs may be especially useful in delimiting species.São apresentados dados relativos à micromorfologia foliar de 13 espécies de Merostachys Spreng. (Poaceae:Bambusoideae, um gênero neotropical, com numerosas espécies endêmicas, que tem sua maior diversidade nas regiões central e sul do Brasil, onde ocorrem 41 das 46 espécies descritas. O material coletado foi obtido nas seguintes localidades: Parque Nacional do Itatiaia e Parque Nacional da Tijuca (RJ; Parque Estadual das Fontes do Ipiranga (SP; Propriedade dos Irmãos Martinelli, Vargem Alta, Santa Teresa (ES e Parque Estadual do Rio Doce (MG. As espécies herborizadas são provenientes do herbário do Instituto de Botânica de São Paulo (SP. Atenção especial é dada à presença de cerdas, corpúsculos silicosos e macropêlos, características que podem ser úteis na delimitação das espécies.

  4. Simple Web-based interactive key development software (WEBiKEY) and an example key for Kuruna (Poaceae: Bambusoideae). (United States)

    Attigala, Lakshmi; De Silva, Nuwan I; Clark, Lynn G


    Programs that are user-friendly and freely available for developing Web-based interactive keys are scarce and most of the well-structured applications are relatively expensive. WEBiKEY was developed to enable researchers to easily develop their own Web-based interactive keys with fewer resources. A Web-based multiaccess identification tool (WEBiKEY) was developed that uses freely available Microsoft ASP.NET technologies and an SQL Server database for Windows-based hosting environments. WEBiKEY was tested for its usability with a sample data set, the temperate woody bamboo genus Kuruna (Poaceae). WEBiKEY is freely available to the public and can be used to develop Web-based interactive keys for any group of species. The interactive key we developed for Kuruna using WEBiKEY enables users to visually inspect characteristics of Kuruna and identify an unknown specimen as one of seven possible species in the genus.

  5. Nature of ergastic substances in some Poaceae seeds | Idu | African ...

    African Journals Online (AJOL)

    Seeds of 48 species of Poaceae were examined for the presence of alkaloid, protein, fats and oil, inulin, starch and tannins. All taxa investigated indicated the presence of starch, fats and oils and protein and were devoid of tannins and inulin. Only 12 seed samples indicated the presence of alkaloids. The Positively ...

  6. Nature of ergastic substances in some Poaceae seeds

    African Journals Online (AJOL)

    ajl yemi


    Aug 29, 2011 ... 2Department of Botany, Ambrose Alli University, PMB. 14, Ekpoma, Edo State, Nigeria. Accepted 6 May, 2011. Seeds of 48 species of Poaceae were examined for the presence of alkaloid, protein, fats and oil, inulin, starch and tannins. All taxa investigated indicated the presence of starch, fats and oils and ...

  7. Genus vesiculoviruses (United States)

    The vesiculovirus genus of the family Rhabdoviridae contains a numbers of viruses that have been taxonomically classified using a combination of serological relatedness, host range, genome organization, pathobiology and phylogenetic analysis of sequence data. There are 11 viruses assigned to the gen...

  8. The Stable Concordance Genus


    Kearney, M. Kate


    The concordance genus of a knot is the least genus of any knot in its concordance class. Although difficult to compute, it is a useful invariant that highlights the distinction between the three-genus and four-genus. In this paper we define and discuss the stable concordance genus of a knot, which describes the behavior of the concordance genus under connected sum.

  9. Distribution of Vulpia species (Poaceae in Poland

    Directory of Open Access Journals (Sweden)

    Ludwik Frey


    Full Text Available The distribution of four species of the genus Vulpia [V. myuros (L. C.C. Gmel., V. bromoides (L. S.F. Gray, V. ciliata Dumort. and V. geniculata (L. Link] reported in Poland has been studied. Currently, V. myuros and especially V. bromoides are very rare species, and their greatest concentration can be found only in the Lower Silesia region. The number of their localities decreased after 1950 and it seems resonable to include both species in the "red list" of threatened plants in Poland: V. myuros in the EN category, V. bromoides in the CR category. V. ciliata and V. geniculata are very rare ephemerophytes and their localities not confirmed during ca 60 years are of historical interest only.

  10. Karyotype asymmetry in Cynodon Rich. (Poaceae) accessions. (United States)

    Chiavegatto, R B; Paula, C M P; Souza Sobrinho, F; Benites, F R G; Techio, V H


    Cynodon is a genus of plants with forage potential that has attracted the interest of breeders. These species have high morphological variability in a large number of varieties and cytotypes, hampering identification. This study aimed to determine the karyotype asymmetry index among accessions of Cynodon to discriminate between them. Karyotype symmetry was based on three estimates, which were compared. The basic number for the genus is x = 9. The results of the chromosome count and DNA quantification, respectively, were as follows: two diploid accessions (2n = 2x = 18 and 1.08 ± 0.094 to 1.17 ± 0.036 pg DNA and ± standard deviation), one triploid accession (2n = 3x = 27 and 1.63 ± 0.017 pg DNA), four tetraploid accessions (2n = 4x = 36 and 1.88 ± 0.069 to 2.10 ± 0.07 pg DNA), and one pentaploid accession (2n = 5x = 45 and 2.55 ± 0.098 pg DNA). C. incompletus var. hirsutus had the longest total length of the haploid lot (29.05 µm), with chromosomes that ranged from 1.7 to 6.2 µm in length. On the basis of the karyotype asymmetry indices, the accessions were divided into two groups: 1) C. dactylon var. dactylon, C. transvaalensis, C. dactylon var. polevansii, three accessions of Cynodon sp, and C. nlemfuensis; and 2) C. incompletus var. hirsutus. This is the first description of tetraploidy in C. transvaalensis. The karyotypic data facilitated a determination of the degree of proximity between the accessions.

  11. Poaceae pollen as the leading aeroallergen worldwide: A review. (United States)

    García-Mozo, H


    The Poaceae family comprises over 12 000 wind-pollinated species, which release large amounts of pollen into the atmosphere. Poaceae pollen is currently regarded as the leading airborne biological pollutant and the chief cause of pollen allergy worldwide. Sensitization rates vary by country, and those variations are reviewed here. Grass pollen allergens are grouped according to their protein structure and function. In Poaceae, although species belonging to different subfamilies are characterized by distinct allergen subsets, there is a considerable degree of cross-reactivity between many species. Cross-reactivity between grass pollen protein and fresh fruit pan-allergens is associated with the appearance of food allergies. The additional influence of urban pollution may prompt a more severe immunological response. The timing and the intensity of the pollen season are governed by species genetics, but plant phenology is also influenced by climate; as a result, climate changes may affect airborne pollen concentrations. This article reviews the findings of worldwide research which has highlighted the major impact of climate change on plant phenology and also on the prevalence and severity of allergic disease. © 2017 EAACI and John Wiley and Sons A/S. Published by John Wiley and Sons Ltd.

  12. Chemical composition and spasmolytic activity of Cymbopogon schoenanthus (L. Spreng. (Poaceae essential oil from Sudan

    Directory of Open Access Journals (Sweden)

    Pavlović Ivan


    Full Text Available The plants of genus Cymbopogon are well known for their use in traditional medicine and for their high content of essential oils that are widely used as flavoring agents, fragrances, cosmetics, and pharmaceuticals. Essential oils isolated from the dried stems and inflorescence of cultivated Cymbopogon schoenanthus (L. Spreng. (Poaceae collected from Khartoum state (Sudan in two periods were studied. The results of chemical analysis of C. schoenanthus revealed that this plant is rich in essential oil which is a valuable source of the commercially important monoterpene, piperitone (47.7-71.5%. Other abundant constituents of the oils were intermedeol (6.1-17.3%, δ-2-carene (4.5-10.0% and elemol (2.7-9.0%. The essential oil from the inflorescence was tested for spasmolytic activity using three different experimental models: against spontaneous contractions, contractions induced with acetylcholine and contractions induced with potassium chloride. The oil exhibited strong, significant and dose-dependent spasmolytic activity, indicating the possibility for further investigations of this essential oil for its medicinal purposes or application in food industry. [Project of the Serbian Ministry of Education, Science and Technological Development, Grant no.173021 and Grant no. III41018

  13. Phylogenomics and taxonomy of Lecomtelleae (Poaceae), an isolated panicoid lineage from Madagascar. (United States)

    Besnard, Guillaume; Christin, Pascal-Antoine; Malé, Pierre-Jean G; Coissac, Eric; Ralimanana, Hélène; Vorontsova, Maria S


    An accurate characterization of biodiversity requires analyses of DNA sequences in addition to classical morphological descriptions. New methods based on high-throughput sequencing may allow investigation of specimens with a large set of genetic markers to infer their evolutionary history. In the grass family, the phylogenetic position of the monotypic genus Lecomtella, a rare bamboo-like endemic from Madagascar, has never been appropriately evaluated. Until now its taxonomic treatment has remained controversial, indicating the need for re-evaluation based on a combination of molecular and morphological data. The phylogenetic position of Lecomtella in Poaceae was evaluated based on sequences from the nuclear and plastid genomes generated by next-generation sequencing (NGS). In addition, a detailed morphological description of L. madagascariensis was produced, and its distribution and habit were investigated in order to assess its conservation status. The complete plastid sequence, a ribosomal DNA unit and fragments of low-copy nuclear genes (phyB and ppc) were obtained. All phylogenetic analyses place Lecomtella as an isolated member of the core panicoids, which last shared a common ancestor with other species >20 million years ago. Although Lecomtella exhibits morphological characters typical of Panicoideae, an unusual combination of traits supports its treatment as a separate group. The study showed that NGS can be used to generate abundant phylogenetic information rapidly, opening new avenues for grass phylogenetics. These data clearly showed that Lecomtella forms an isolated lineage, which, in combination with its morphological peculiarities, justifies its treatment as a separate tribe: Lecomtelleae. New descriptions of the tribe, genus and species are presented with a typification, a distribution map and an IUCN conservation assessment.

  14. Early inflorescence development in the grasses (Poaceae

    Directory of Open Access Journals (Sweden)

    Elizabeth A. Kellogg


    Full Text Available The shoot apical meristem of grasses produces the primary branches of the inflorescence, controlling inflorescence architecture and hence seed production. Whereas leaves are produced in a distichous pattern, with the primordia separated from each other by an angle of 180o, inflorescence branches are produced in a spiral in most species. The morphology and developmental genetics of the shift in phyllotaxis have been studied extensively in maize and rice. However, in wheat, Brachypodium, and oats, all in the grass subfamily Pooideae, the change in phyllotaxis does not occur; primary inflorescence branches are produced distichously. It is unknown whether the distichous inflorescence originated at the base of Pooideae, or whether it appeared several times independently. In this study, we show that Brachyelytrum, the genus sister to all other Pooideae has spiral phyllotaxis in the inflorescence, but that in the remaining 3000+ species of Pooideae, the phyllotaxis is two-ranked. These two-ranked inflorescences are not perfectly symmetrical, and have a clear front and back; this developmental axis has never been described in the literature and it is unclear what establishes its polarity. Strictly distichous inflorescences appear somewhat later in the evolution of the subfamily. Two-ranked inflorescences also appear in a few grass outgroups and sporadically elsewhere in the family, but unlike in Pooideae do not generally correlate with a major radiation of species. After production of branches, the inflorescence meristem may be converted to a spikelet meristem or may simply abort; this developmental decision appears to be independent of the branching pattern.

  15. O gênero Chloris (Poaceae) em Pernambuco, Brasil


    Maciel, Jefferson Rodrigues; Silva, Wegliane Campelo da; Costa-e-Silva, Maria Bernadete


    Com o objetivo de colaborar com o conhecimento da riqueza de Poaceae em Pernambuco, foi estudado o gênero Chloris Sw. As coletas foram realizadas no estado, bem como dados foram coligidos de levantamento em herbários da região. Foram registradas sete espécies de Chloris em Pernambuco: C. barbata Sw., C. elata Desv., C. exilis Renv., C. gayana Kunth, C. orthonoton Döll, C. pycnothrix Trin. e C. virgata Sw. O gênero apresenta distribuição ampla em todas as zonas fitogeográficas do estado. Chlor...

  16. Phylogeny of Eleusine (Poaceae: Chloridoideae) based on nuclear ITS and plastid trnT-trnF sequences. (United States)

    Neves, Susana S; Swire-Clark, Ginger; Hilu, Khidir W; Baird, Wm Vance


    Phylogenetic relationships in the genus Eleusine (Poaceae: Chloridoideae) were investigated using nuclear ITS and plastid trnT-trnF sequences. Separate and combined data sets were analyzed using parsimony, distance, and likelihood based methods, including Bayesian. Data congruence was examined using character and topological measures. Significant data heterogeneity was detected, but there was little conflict in the topological substructure measures for triplets and quartets, and resolution and clade support increased in the combined analysis. Data incongruence may be a result of noise and insufficient information in the slower evolving trnT-trnF. Monophyly of Eleusine is strongly supported in all analyses, but basal relationships in the genus remain uncertain. There is good support for a CAIK clade (E. coracana subsp. coracana and africana, E. indica, and E. kigeziensis), with E. tristachya as its sister group. Two putative ITS homeologues (A and B loci) were identified in the allotetraploid E. coracana; the 'B' locus sequence type was not found in the remaining species. Eleusine coracana and its putative 'A' genome donor, the diploid E. indica, are confirmed close allies, but sequence data contradicts the hypothesis that E. floccifolia is its second genome donor. The 'B' genome donor remains unidentified and may be extinct.

  17. Cercosporoid fungi (Mycosphaerellaceae) 2. Species on monocots (Acoraceae to Xyridaceae, excluding Poaceae). (United States)

    Braun, Uwe; Crous, Pedro W; Nakashima, Chiharu


    Cercosporoid fungi (formerly Cercospora s. lat.) represent one of the largest groups of hyphomycetes belonging to the Mycosphaerellaceae (Ascomycota). They include asexual morphs, asexual holomorphs, or species with mycosphaerella-like sexual morphs. Most of them are leaf-spotting plant pathogens with special phytopathological relevance. In the first part of a new monographic work, cercosporoid hyphomycetes occurring on other fungi (fungicolous species), on ferns (pteridophytes) and gymnosperms were treated. This second part deals with cercosporoid fungi on monocots (Liliopsida; Equisetopsida, Magnoliidae, Lilianae), which covers species occurring on host plants belonging to families arranged in alphabetical order from Acoraceae to Xyridaceae, excluding Poaceae (cereals and grasses) which requires a separate treatment. The species are described and illustrated in alphabetical order under the particular cercosporoid genera, supplemented by keys to the species concerned. A detailed introduction, a survey of currently recognised cercosporoid genera, a key to the genera concerned, and a discussion of taxonomically relevant characters were published in the first part of this series. Neopseudocercospora, an additional recently introduced cercosporoid genus, is briefly discussed. The following taxonomic novelties are introduced: Cercospora alpiniigena sp. nov., C. neomaricae sp. nov., Corynespora palmicola comb. nov., Exosporium miyakei comb. nov., E. petersii comb. nov., Neopseudocercospora zambiensis comb. nov., Passalora caladiicola comb. nov., P. streptopi comb. nov., P. togashiana comb. nov., P. tranzschelii var. chinensis var. nov., Pseudocercospora beaucarneae comb. nov., P. constrictoflexuosa comb. et stat. nov., P. curcumicola sp. nov., P. dispori comb. nov., P. smilacicola sp. nov., P. urariigena nom. nov., Zasmidium agavicola comb. nov., Z. cercestidis-afzelii comb. nov., Z. citri-griseum comb. nov., Z. cyrtopodii comb. nov., Z. gahnae comb. nov., Z. indicum

  18. Chemotaxonomy as a tool for interpreting the cryptic diversity of Poaceae pollen

    NARCIS (Netherlands)

    Julier, A.C.M.; Jardine, P.E.; Coe, A.L.; Gosling, W.D.; Lomax, B.H.; Fraser, W.T.


    The uniform morphology of different species of Poaceae (grass) pollen means that identification to below family level using light microscopy is extremely challenging. Poor taxonomic resolution reduces recoverable information from the grass pollen record, for example, species diversity and

  19. Révision du genre Digitaria Haller (Poaceae) au Sénégal ...

    African Journals Online (AJOL)

    Le genre Digitaria Haller (Poaceae) constitue l'un des genres les plus diversifiés des Poaceae du Sénégal avec 19 espèces. Bien qu'il y ait une monographie mondiale du genre, la détermination des espèces reste difficile et repose essentiellement sur les caractères de l'appareil reproducteur. Ce travail, qui est une ...


    Directory of Open Access Journals (Sweden)

    Diego Giraldo-Cañas


    Full Text Available Se presenta un inventario de las especies de Poaceae de Colombia junto con un análisis de la diversidad específica de esta familia según las regiones naturales colombianas, los gradientes de altitud y de precipitaciones, y la distribución sistemática. Se realizaron 96 expediciones de campo a las diez grandes regiones naturales de Colombia (Amazonia, Andes, Caribe, Chocó Biogeográfico, Guayana, islas caribeñas, Orinoquia, Sierra Nevada de Santa Marta, valle del río Cauca y valle del río Magdalena con un muestreo total de alrededor de 5800 ejemplares. Además, se consultaron colecciones de los herbarios CAUP, COAH, COL, CUVC, CHOCO, HFAB, HUA, HUQ, JAUM, MEDEL, MEXU, MO, NY, PSO, RSA, SI, UDBC, UIS, US, VALLE y VEN, y se realizó una investigación bibliográfica exhaustiva. Las Poaceae están representadas en Colombia por 840 especies y 173 géneros. Se reconocieron 74 especies y un género (Agrostopoa endémicos. Por otra parte, se documentaron 83 especies introducidas-naturalizadas y 50 introducidas-cultivadas. Los géneros más ricos en especies son Paspalum (89 especies, Panicum (42, Festuca (36, Eragrostis (29, Calamagrostis (25, Chusquea (25, Digitaria (24, Axonopus (21, Setaria (20, Cenchrus (18, Poa (17, Muhlenbergia (16, Andropogon (15, Aristida (15, Agrostis (14, Lasiacis (12, Urochloa (12, Pariana (11, Sporobolus (11, Arthrostylidium (10, Cortaderia (10, Nassella (10, Neurolepis (10 y Schizachyrium (10. Durante el desarrollo de esta investigación, se descubrieron 10 nuevos registros para la flora colombiana. La regiones Andina, Orinocense, Caribe y Guayanesa son las más ricas en especies, con 583, 233, 186 y 179 especies, respectivamente. La Región Andina presenta el mayor número de especies endémicas (57 especies. Los gradientes altitudinales más diversos corresponden a los de las tierras bajas (por debajo de 1200 m s.m.. Al igual que en otras áreas tropicales, en Colombia las subfamilias de Poaceae muestran una

  1. The genus Bipolaris

    NARCIS (Netherlands)

    Manamgoda, D.S.; Rossman, A.Y.; Castlebury, L.A.; Crous, P.W.; Madrid, H.; Chukeatirote, E.; Hyde, K.D.


    The genus Bipolaris includes important plant pathogens with worldwide distribution. Species recognition in the genus has been uncertain due to the lack of molecular data from ex-type cultures as well as overlapping morphological characteristics. In this study, we revise the genus Bipolaris based on

  2. Genome-wide distribution comparative and composition analysis of the SSRs in Poaceae. (United States)

    Wang, Yi; Yang, Chao; Jin, Qiaojun; Zhou, Dongjie; Wang, Shuangshuang; Yu, Yuanjie; Yang, Long


    The Poaceae family is of great importance to human beings since it comprises the cereal grasses which are the main sources for human food and animal feed. With the rapid growth of genomic data from Poaceae members, comparative genomics becomes a convinent method to study genetics of diffierent species. The SSRs (Simple Sequence Repeats) are widely used markers in the studies of Poaceae for their high abundance and stability. In this study, using the genomic sequences of 9 Poaceae species, we detected 11,993,943 SSR loci and developed 6,799,910 SSR primer pairs. The results show that SSRs are distributed on all the genomic elements in grass. Hexamer is the most frequent motif and AT/TA is the most frequent motif in dimer. The abundance of the SSRs has a positive linear relationship with the recombination rate. SSR sequences in the coding regions involve a higher GC content in the Poaceae than that in the other species. SSRs of 70-80 bp in length showed the highest AT/GC base ratio among all of these loci. The result shows the highest polymorphism rate belongs to the SSRs ranged from 30 bp to 40 bp. Using all the SSR primers of Japonica, nineteen universal primers were selected and located on the genome of the grass family. The information of SSR loci, the SSR primers and the tools of mining and analyzing SSR are provided in the PSSRD (Poaceae SSR Database, Our study and the PSSRD database provide a foundation for the comparative study in the Poaceae and it will accelerate the study on markers application, gene mapping and molecular breeding.

  3. Building supertrees: an empirical assessment using the grass family (Poaceae). (United States)

    Salamin, Nicolas; Hodkinson, Trevor R; Savolainen, Vincent


    Large and comprehensive phylogenetic trees are desirable for studying macroevolutionary processes and for classification purposes. Such trees can be obtained in two different ways. Either the widest possible range of taxa can be sampled and used in a phylogenetic analysis to produce a "big tree," or preexisting topologies can be used to create a supertree. Although large multigene analyses are often favored, combinable data are not always available, and supertrees offer a suitable solution. The most commonly used method of supertree reconstruction, matrix representation with parsimony (MRP), is presented here. We used a combined data set for the Poaceae to (1) assess the differences between an approach that uses combined data and one that uses different MRP modifications based on the character partitions and (2) investigate the advantages and disadvantages of these modifications. Baum and Ragan and Purvis modifications gave similar results. Incorporating bootstrap support associated with pre-existing topologies improved Baum and Ragan modification and its similarity with a combined analysis. Finally, we used the supertree reconstruction approach on 55 published phylogenies to build one of most comprehensive phylogenetic trees published for the grass family including 403 taxa and discuss its strengths and weaknesses in relation to other published hypotheses.

  4. Anther and pollen development in some species of Poaceae (Poales

    Directory of Open Access Journals (Sweden)

    AT. Nakamura

    Full Text Available Anther and pollen development were studied in Olyra humilis Nees, Sucrea monophylla Soderstr, (Bambusoideae, Axonopus aureus P. Beauv., Paspalum polyphyllum Nees ex Trin. (Panicoideae, Eragrostis solida Nees, and Chloris elata Desv. (Chloridoideae. The objective of this study was to characterise, embryologically, these species of subfamilies which are considered basal, intermediate and derivate, respectively. The species are similar to each other and to other Poaceae. They present the following characters: tetrasporangiate anthers; monocotyledonous-type anther wall development, endothecium showing annular thickenings, secretory tapetum; successive microsporogenesis; isobilateral tetrads; spheroidal, tricellular, monoporate pollen grains with annulus and operculum. Nevertheless, the exine patterns of the species studied are distinct. Olyra humilis and Sucrea monophylla (Bambusoideae show a granulose pattern, whereas in the other species, it is insular. In addition, Axonopus aureus and Paspalum polyphyllum (Panicoideae have a compactly insular spinule pattern, while Chloris elata and Eragrostis solida (Chloridoideae show a sparsely insular spinule pattern. The exine ornamentation may be considered an important feature at the infrafamiliar level.

  5. Late Cretaceous origin of the rice tribe provides evidence for early diversification in Poaceae. (United States)

    Prasad, V; Strömberg, C A E; Leaché, A D; Samant, B; Patnaik, R; Tang, L; Mohabey, D M; Ge, S; Sahni, A


    Rice and its relatives are a focal point in agricultural and evolutionary science, but a paucity of fossils has obscured their deep-time history. Previously described cuticles with silica bodies (phytoliths) from the Late Cretaceous period (67-65 Ma) of India indicate that, by the latest Cretaceous, the grass family (Poaceae) consisted of members of the modern subclades PACMAD (Panicoideae-Aristidoideae-Chloridoideae-Micrairoideae-Arundinoideae-Danthonioideae) and BEP (Bambusoideae-Ehrhartoideae-Pooideae), including a taxon with proposed affinities to Ehrhartoideae. Here we describe additional fossils and show that, based on phylogenetic analyses that combine molecular genetic data and epidermal and phytolith features across Poaceae, these can be assigned to the rice tribe, Oryzeae, of grass subfamily Ehrhartoideae. The new Oryzeae fossils suggest substantial diversification within Ehrhartoideae by the Late Cretaceous, pushing back the time of origin of Poaceae as a whole. These results, therefore, necessitate a re-evaluation of current models for grass evolution and palaeobiogeography.

  6. The genus Bipolaris. (United States)

    Manamgoda, D S; Rossman, A Y; Castlebury, L A; Crous, P W; Madrid, H; Chukeatirote, E; Hyde, K D


    The genus Bipolaris includes important plant pathogens with worldwide distribution. Species recognition in the genus has been uncertain due to the lack of molecular data from ex-type cultures as well as overlapping morphological characteristics. In this study, we revise the genus Bipolaris based on DNA sequence data derived from living cultures of fresh isolates, available ex-type cultures from worldwide collections and observation of type and additional specimens. Combined analyses of ITS, GPDH and TEF gene sequences were used to reconstruct the molecular phylogeny of the genus Bipolaris for species with living cultures. The GPDH gene is determined to be the best single marker for species of Bipolaris. Generic boundaries between Bipolaris and Curvularia are revised and presented in an updated combined ITS and GPDH phylogenetic tree. We accept 47 species in the genus Bipolaris and clarify the taxonomy, host associations, geographic distributions and species' synonymies. Modern descriptions and illustrations are provided for 38 species in the genus with notes provided for the other taxa when recent descriptions are available. Bipolaris cynodontis, B. oryzae, B. victoriae, B. yamadae and B. zeicola are epi- or neotypified and a lectotype is designated for B. stenospila. Excluded and doubtful species are listed with notes on taxonomy and phylogeny. Seven new combinations are introduced in the genus Curvularia to accomodate the species of Bipolaris transferred based on the phylogenetic analysis. A taxonomic key is provided for the morphological identification of species within the genus.

  7. [Taxonomy and evolution of the genus Pratylenchoides (Nematoda: Pratylenchidae)]. (United States)

    Ryss, A Iu


    The amended diagnosis of the genus Pratylenchoides and list of its valid species with synonyms are given. All the efficient diagnostic characters are listed. Modern taxonomic standard for the description of Pratylenchoides species is proposed; it may be used also in taxonomic databases. Tabular and text keys for all species of the genus are given. Five following groups are considered within the genus Pratylenchoides. The group arenicola differs from other groups in the primitive adanal bursa type; the groups magnicauda, crenicauda, ritteri, and megalobatus differ from each other in the position of cardium along the body axis in relation to the pharyngeal gland nuclei, pharynx types are named according to the stages of its evolution from the primitive tylenchoid pharynx (cardium situated posteriorly) to the advanced hoplolaimoid one (cardium situated anteriorly). Diagnoses and species compositions of the groups are given. Basing on the matrix of species characters, the dendrogram has been generated for all species of Pratylenchoides and for all characters (UPGMA, distance, mean character difference, random, characters ordered). Taking in view that the PAUP software gives equal weights to all characters, including the most important ones which define the prognostic species groups, the separate dendrograms for each prognostic species group were generated using the same above mentioned tree parameters. On the base of the records of Pratylenchoides species the matrices of plant host ranges, geographic distribution, and preferred soil-climatic conditions were developed. The dendrograms of the faunal similarities were generated using these matrices, with conclusions on a possible origin and evolution of the genus. The genus evolved from the flood lands with swampy soils and prevalence of dicotyledons (herbaceous Lamiaceae and woody Salicaceae families) to the forest mainland communities with balanced humidity and predominance of herbaceous Poaceae and Fabaceae with woody

  8. Potential biological control agents for management of cogongrass (Cyperales: Poaceae) in the southeastern USA (United States)

    Cogongrass, Imperata cylindrica (L.) Palisot de Beauvois (Cyperales: Poaceae), is a noxious invasive weed in the southeastern USA. Surveys for potential biological control agents of cogongrass were conducted in Asia and East Africa from 2013 to 2016. Several insect herbivores were found that may hav...

  9. Aira (Poaceae: a new generic record for Nicobar Islands, India

    Directory of Open Access Journals (Sweden)

    Kumar Vinod Chhotupuri Gosavi


    Full Text Available During plant exploration of Andaman and Nicobar in 2014, we were collected some interesting grass specimens from Kamorta Islands of Nicobar. After critical study and taxonomic analysis the unidentified grass species has identified as an Aira caryophyllea L.  Perusals of relevant literature were revealed that, the genus Aira L. has so far not reported from Andaman and Nicobar islands. Hence, it is reported in present communication for new record to the Andaman and Nicobar Islands. 

  10. A review of the genus Saccharicoccus Ferris, 1950 (Hemiptera: Coccomorpha: Pseudococcidae) in China, with description of a new species. (United States)

    Zhang, Jiang-Tao; Wu, Bo-Wen; Wu, San-An


    The mealybug genus Saccharicoccus Ferris includes three species: S. isfarensis (Borchsenius, 1949), S. sacchari (Cockerell, 1895) and a new species, S. chinensis Zhang, Wu Wu sp. n. The new species, collected on Miscanthus sp. (Poaceae) and other poaceous weeds in China, is described and illustrated, and molecular analyses based on the mitochondrial gene cytochrome c oxidase subunit I (COI) are provided. Additional data on the distribution and host-plants of each species are given, and a key to the adult females of Saccharicoccus species is provided.

  11. Desenvolvimento pós-seminal de espécies de Poaceae (Poales Post-seminal development of Poaceae species (Poales

    Directory of Open Access Journals (Sweden)

    Adriana Tiemi Nakamura


    Full Text Available O presente estudo objetivou verificar a existência de um padrão do desenvolvimento pós-seminal em Poaceae. Para tanto, foram estudadas as seguintes espécies: Olyra humilis Nees (Bambusoideae; Axonopus aureus P. Beauv. e Paspalum polyphyllum Nees ex Trin. (Panicoideae; Chloris elata Nees e Eragrostis solida Desv. (Chloridoideae. Procurou-se também comparar as estruturas da plântula de Poaceae com as demais monocotiledôneas. As espécies estudadas são plantas perenes, rizomatosas, cespitosas e apresentam cariopses de tamanhos diferentes. Apresentam sementes albuminosas; embrião lateral, diferenciado, com raiz endógena (adventícia; cotilédone dividido em hiperfilo (escutelo, bainha reduzida e hipofilo (coleóptilo; coleorriza (raiz primária reduzida e mesocótilo (eixo localizado entre o escutelo e coleóptilo. A presença de epiblasto (folha embrionária foi observada em Olyra humilis, Chloris elata e Eragrostis solida. O desenvolvimento pós-seminal é semelhante nas espécies estudadas e forma um padrão em Poaceae. Primeiramente, observa-se a emissão da coleorriza, que cresce no sentido geotrópico positivo, seguida do coleóptilo e plúmula que crescem em sentido contrário, a partir do desenvolvimento do mesocótilo. As primeiras folhas são semelhantes às folhas definitivas (metafilos das espécies, exceto em Olyra humilis, que são modificadas em catafilos e podem ser interpretadas como caráter basal em Bambusoideae. Raiz primária reduzida (coleorriza e hipofilo modificado em coleóptilo são considerados caracteres derivados em Poaceae, quando comparados com as demais monocotiledôneas.This work has aimed to verify the existence of a pattern of the post-seminal development in Poaceae. Thus, Olyra humilis Nees (Bambusoideae; Axonopus aureus P. Beauv. e Paspalum polyphyllum Nees ex Trin. (Panicoideae; Chloris elata Nees e Eragrostis solida Desv. (Chloridoideae have been studied. Besides, it was compared the structures of

  12. The genus Baijiania (Cucurbitaceae)

    NARCIS (Netherlands)

    Wilde, de W.J.J.O.; Duyfjes, B.E.E.


    The genus Baijiania, originally thought to be indigenous in China and Borneo, appears to be restricted to Borneo. The only species is Baijiania borneensis, with two varieties, the type variety and var. paludicola Duyfjes, var. nov.

  13. Evolutionary dynamics of the Pgk1 gene in the polyploid genus Kengyilia (Triticeae: Poaceae and its diploid relatives.

    Directory of Open Access Journals (Sweden)

    Xing Fan

    Full Text Available The level and pattern of nucleotide variation in duplicate gene provide important information on the evolutionary history of polyploids and divergent process between homoeologous loci within lineages. Kengyilia is a group of allohexaploid species with the StYP genomic constitutions in the wheat tribe. To investigate the evolutionary dynamics of the Pgk1 gene in Kengyilia and its diploid relatives, three copies of Pgk1 homoeologues were isolated from all sampled hexaploid Kengyilia species and analyzed with the Pgk1 sequences from 47 diploid taxa representing 18 basic genomes in Triticeae. Sequence diversity patterns and genealogical analysis suggested that (1 Kengyilia species from the Central Asia and the Qinghai-Tibetan plateau have independent origins with geographically differentiated P genome donors and diverged levels of nucleotide diversity at Pgk1 locus; (2 a relatively long-time sweep event has allowed the Pgk1 gene within Agropyron to adapt to cold climate triggered by the recent uplifts of the Qinghai-Tibetan Plateau; (3 sweep event and population expansion might result in the difference in the d(N/d(S value of the Pgk1 gene in allopatric Agropyron populations, and this difference may be genetically transmitted to Kengyilia lineages via independent polyploidization events; (4 an 83 bp MITE element insertion has shaped the Pgk1 loci in the P genome lineage with different geographical regions; (5 the St and P genomes in Kengyilia were donated by Pseudoroegneria and Agropyron, respectively, and the Y genome is closely related to the Xp genome of Peridictyon sanctum. The interplay of evolutionary forces involving diverged natural selection, population expansion, and transposable events in geographically differentiated P genome donors could attribute to geographical differentiation of Kengyilia species via independent origins.

  14. Variability of Pyrrolizidine Alkaloid Occurrence in Species of the Grass Subfamily Pooideae (Poaceae) (United States)

    Wesseling, Anne-Maria; Demetrowitsch, Tobias J.; Schwarz, Karin; Ober, Dietrich


    Pyrrolizidine alkaloids (PAs) are a class of secondary metabolites found in various unrelated angiosperm lineages including cool-season grasses (Poaceae, subfamily Pooideae). Thesinine conjugates, saturated forms of PA that are regarded as non-toxic, have been described to occur in the two grass species Lolium perenne and Festuca arundinacea (Poaceae, subfamily Pooideae). In a wider screen, we tested various species of the Pooideae lineage, grown under controlled conditions, for their ability to produce thesinine conjugates or related structures. Using an LC-MS based targeted metabolomics approach we were able to show that PA biosynthesis in grasses is limited to a group of very closely related Pooideae species that produce a limited diversity of PA structures. High variability in PA levels was observed even between individuals of the same species. These individual accumulation patterns are discussed with respect to a possible function and evolution of this type of alkaloid. PMID:29250094

  15. Variability of Pyrrolizidine Alkaloid Occurrence in Species of the Grass Subfamily Pooideae (Poaceae

    Directory of Open Access Journals (Sweden)

    Anne-Maria Wesseling


    Full Text Available Pyrrolizidine alkaloids (PAs are a class of secondary metabolites found in various unrelated angiosperm lineages including cool-season grasses (Poaceae, subfamily Pooideae. Thesinine conjugates, saturated forms of PA that are regarded as non-toxic, have been described to occur in the two grass species Lolium perenne and Festuca arundinacea (Poaceae, subfamily Pooideae. In a wider screen, we tested various species of the Pooideae lineage, grown under controlled conditions, for their ability to produce thesinine conjugates or related structures. Using an LC-MS based targeted metabolomics approach we were able to show that PA biosynthesis in grasses is limited to a group of very closely related Pooideae species that produce a limited diversity of PA structures. High variability in PA levels was observed even between individuals of the same species. These individual accumulation patterns are discussed with respect to a possible function and evolution of this type of alkaloid.

  16. A 250 plastome phylogeny of the grass family (Poaceae): topological support under different data partitions (United States)

    Burke, Sean V.; Wysocki, William P.; Clark, Lynn G.


    The systematics of grasses has advanced through applications of plastome phylogenomics, although studies have been largely limited to subfamilies or other subgroups of Poaceae. Here we present a plastome phylogenomic analysis of 250 complete plastomes (179 genera) sampled from 44 of the 52 tribes of Poaceae. Plastome sequences were determined from high throughput sequencing libraries and the assemblies represent over 28.7 Mbases of sequence data. Phylogenetic signal was characterized in 14 partitions, including (1) complete plastomes; (2) protein coding regions; (3) noncoding regions; and (4) three loci commonly used in single and multi-gene studies of grasses. Each of the four main partitions was further refined, alternatively including or excluding positively selected codons and also the gaps introduced by the alignment. All 76 protein coding plastome loci were found to be predominantly under purifying selection, but specific codons were found to be under positive selection in 65 loci. The loci that have been widely used in multi-gene phylogenetic studies had among the highest proportions of positively selected codons, suggesting caution in the interpretation of these earlier results. Plastome phylogenomic analyses confirmed the backbone topology for Poaceae with maximum bootstrap support (BP). Among the 14 analyses, 82 clades out of 309 resolved were maximally supported in all trees. Analyses of newly sequenced plastomes were in agreement with current classifications. Five of seven partitions in which alignment gaps were removed retrieved Panicoideae as sister to the remaining PACMAD subfamilies. Alternative topologies were recovered in trees from partitions that included alignment gaps. This suggests that ambiguities in aligning these uncertain regions might introduce a false signal. Resolution of these and other critical branch points in the phylogeny of Poaceae will help to better understand the selective forces that drove the radiation of the BOP and PACMAD

  17. Two New Records from Lebanon: Chamaesyce nutans (Lag.) Small (Euphorbiaceae) and Eleusine indica (L.) Gaertner (Poaceae)


    HABER, Ricardus M.; SEMAAN, Myrna T.


    Chamaesyce nutans (Lag.) Small (Euphorbiaceae) and Eleusine indica (L.) Gaertner (Poaceae) are described as new records for the flora of Lebanon. Specimens of C. nutans collected from roadsides and rocks in a middle mountain forest confirm the occurrence of the species on the western slopes of the Mount Lebanon Range. Additionally, specimens of E. indica were collected from wasteland and roadsides in the coastal town of Kaslik. The species were observed to thrive abundantly in similar habitat...

  18. Novedades nomenclaturales en la tribu Stipeae (Poaceae, Pooideae) para la Flora Argentina


    Ana María Cialdella


    Durante la revisión de los géneros de Stipeae (Poaceae) para la flora argentina y de acuerdo a los últimos estudios filogenéticos en la tribu, se confirmó la necesidad de transferir algunos taxones recientemente descriptos de Stipa a Nassella, Jarava o Pappostipa. En este trabajo se presentan 12 nuevas combinaciones: Jarava ichu var. pungens, Nassella brachyglumis, N. macrotricha, Pappostipa arenicola, P. choconensis, P. colloncurensis, P. frigida var. longifolia, P. jucunda, P. kieslingii, P...

  19. Assessing universality of DNA barcoding in geographically isolated selected desert medicinal species of Fabaceae and Poaceae (United States)

    Hussain, Fatma; Ahmed, Nisar; Ghorbani, Abdolbaset


    In pursuit of developing fast and accurate species-level molecular identification methods, we tested six DNA barcodes, namely ITS2, matK, rbcLa, ITS2+matK, ITS2+rbcLa, matK+rbcLa and ITS2+matK+rbcLa, for their capacity to identify frequently consumed but geographically isolated medicinal species of Fabaceae and Poaceae indigenous to the desert of Cholistan. Data were analysed by BLASTn sequence similarity, pairwise sequence divergence in TAXONDNA, and phylogenetic (neighbour-joining and maximum-likelihood trees) methods. Comparison of six barcode regions showed that ITS2 has the highest number of variable sites (209/360) for tested Fabaceae and (106/365) Poaceae species, the highest species-level identification (40%) in BLASTn procedure, distinct DNA barcoding gap, 100% correct species identification in BM and BCM functions of TAXONDNA, and clear cladding pattern with high nodal support in phylogenetic trees in both families. ITS2+matK+rbcLa followed ITS2 in its species-level identification capacity. The study was concluded with advocating the DNA barcoding as an effective tool for species identification and ITS2 as the best barcode region in identifying medicinal species of Fabaceae and Poaceae. Current research has practical implementation potential in the fields of pharmaco-vigilance, trade of medicinal plants and biodiversity conservation. PMID:29576968

  20. The ascomycete genus Sordaria


    Guarro, J.; Arx, von, J.A.


    Sordaria is restricted to coprophilous, soil-, or seed-borne Pyrenomycetes with aseptate, elongate ascospores with a gelatinous, amorphous sheath. The genus is redescribed and a key to fourteen accepted species is given. A checklist of all taxa described as Sordaria is added.

  1. Genus I. Leptospira (United States)

    Leptospira comprise a diverse group of bacteria. Some species cause serious infections in animals and humans. These bacteria are aerobes that consume long-chain fatty acids and alcohols as carbon and energy sources. This genus is distinguished from Leptonema or Turneriella by lack of similarity u...

  2. The amphipod genus Acidostoma

    NARCIS (Netherlands)

    Dahl, E.


    The genus Acidostoma was established by Lilljeborg (1865, p. 24) to receive Anonyx obesus Sp. Bate (1862, p. 74). Afterwards two further species have been added, viz. A. laticorne G. O. Sars (1879, p. 440) and A. nodiferum Stephensen (1923, p. 40). In the present paper it will be shown that A.

  3. Genomic homeology between Pennisetum purpureum and Pennisetum glaucum (Poaceae

    Directory of Open Access Journals (Sweden)

    Gabriela Barreto dos Reis


    Full Text Available The genus Pennisetum (Richard, 1805 includes two economically important tropical forage plants: Pennisetum purpureum (Schumacher, 1827 (elephant grass, with 2n = 4x = 28 chromosomes and genomes A'A'BB, and Pennisetum glaucum (Linnaeus, 1753 (pearl millet, with 2n = 2x = 14 chromosomes and genomes AA. The genetic proximity between them allows obtaining hybrids (2n = 3x = 21 that yield forage of higher quality in relation to the parents. The study of genomic relationships provides subsidies for the knowledge about phylogenetic relations and evolution, and is useful in breeding programs seeking gene introgression. Concerning elephant grass and pearl millet, the homeology between the genomes A and A', and between these and the genome B, has been reported by conventional cytogenetic techniques. The objective of the present study was to demonstrate the degree of homeology between these genomes by means of genomic in situ hybridization (GISH. The results confirmed the homeology between the genomes A of pearl millet and A'B of elephant grass, and showed that there are differences in the distribution and proportion of homologous regions after hybridization. Discussion regarding the evolutionary origin of P. purpureum and P. glaucum was also included.

  4. Spiky higher genus strings

    International Nuclear Information System (INIS)

    Ambjoern, J.; Bellini, A.; Johnston, D.


    It is clear from both the non-perturbative and perturbative approaches to two-dimensional quantum gravity that a new strong coupling regime is setting in at d=1, independent of the genus of the worldsheet being considered. It has been suggested that a Kosterlitz-Thouless (KT) phase transition in the Liouville theory is the cause of this behaviour. However, it has recently been pointed out that the XY model, which displays a KT transition on the plane and the sphere, is always in the strong coupling, disordered phase on a surface of constant negative curvature. A higher genus worldsheet can be represented as a fundamental region on just such a surface, which might seem to suggest that the KT picture predicts a strong coupling region for arbitrary d, contradicting the known results. We resolve the apparent paradox. (orig.)

  5. What is the genus?

    CERN Document Server

    Popescu-Pampu, Patrick


    Exploring several of the evolutionary branches of the mathematical notion of genus, this book traces the idea from its prehistory in problems of integration, through algebraic curves and their associated Riemann surfaces, into algebraic surfaces, and finally into higher dimensions. Its importance in analysis, algebraic geometry, number theory and topology is emphasized through many theorems. Almost every chapter is organized around excerpts from a research paper in which a new perspective was brought on the genus or on one of the objects to which this notion applies. The author was motivated by the belief that a subject may best be understood and communicated by studying its broad lines of development, feeling the way one arrives at the definitions of its fundamental notions, and appreciating the amount of effort spent in order to explore its phenomena.

  6. Genus Ranges of Chord Diagrams. (United States)

    Burns, Jonathan; Jonoska, Nataša; Saito, Masahico


    A chord diagram consists of a circle, called the backbone, with line segments, called chords, whose endpoints are attached to distinct points on the circle. The genus of a chord diagram is the genus of the orientable surface obtained by thickening the backbone to an annulus and attaching bands to the inner boundary circle at the ends of each chord. Variations of this construction are considered here, where bands are possibly attached to the outer boundary circle of the annulus. The genus range of a chord diagram is the genus values over all such variations of surfaces thus obtained from a given chord diagram. Genus ranges of chord diagrams for a fixed number of chords are studied. Integer intervals that can be, and those that cannot be, realized as genus ranges are investigated. Computer calculations are presented, and play a key role in discovering and proving the properties of genus ranges.

  7. Poaceae vs. Abiotic Stress: Focus on Drought and Salt Stress, Recent Insights and Perspectives

    Directory of Open Access Journals (Sweden)

    Simone Landi


    Full Text Available Poaceae represent the most important group of crops susceptible to abiotic stress. This large family of monocotyledonous plants, commonly known as grasses, counts several important cultivated species, namely wheat (Triticum aestivum, rice (Oryza sativa, maize (Zea mays, and barley (Hordeum vulgare. These crops, notably, show different behaviors under abiotic stress conditions: wheat and rice are considered sensitive, showing serious yield reduction upon water scarcity and soil salinity, while barley presents a natural drought and salt tolerance. During the green revolution (1940–1960, cereal breeding was very successful in developing high-yield crops varieties; however, these cultivars were maximized for highest yield under optimal conditions, and did not present suitable traits for tolerance under unfavorable conditions. The improvement of crop abiotic stress tolerance requires a deep knowledge of the phenomena underlying tolerance, to devise novel approaches and decipher the key components of agricultural production systems. Approaches to improve food production combining both enhanced water use efficiency (WUE and acceptable yields are critical to create a sustainable agriculture in the future. This paper analyzes the latest results on abiotic stress tolerance in Poaceae. In particular, the focus will be directed toward various aspects of water deprivation and salinity response efficiency in Poaceae. Aspects related to cell wall metabolism will be covered, given the importance of the plant cell wall in sensing environmental constraints and in mediating a response; the role of silicon (Si, an important element for monocots' normal growth and development, will also be discussed, since it activates a broad-spectrum response to different exogenous stresses. Perspectives valorizing studies on landraces conclude the survey, as they help identify key traits for breeding purposes.

  8. Identification of fine-leaved species of genus Festuca by molecular methods

    International Nuclear Information System (INIS)

    Stukonis, V.; Armoniene, R.; Kemesyte, V.


    Festuca (L.) is a taxonomically complex genus of family Poaceae. The fine-leaved species of fescue are well adapted to grow in sandy and dry habitats, therefore, they can be used for establishment of lawns of minimal maintenance as well as recultivations of damaged soils. Breeding for the new varieties to meet these purposes requires reliable methods for identification of the species. The discrimination of fine-leaved fescue species based on morphological features is rather difficult, therefore reliable molecular marker would greatly facilitate it and eliminate the need to wait till floral organs are fully formed. Seven fine-leaved species of genus Festuca collected in Lithuania, namely, F. ovina, F. trachyphylla, F. polesica, F. psammophila, F. sabulosa, F. pseudovina and F. wolgensis were investigated at the Institute of Agriculture, Lithuanian Research Centre for Agriculture and Forestry. The ISSR markers, seed storage proteins and isozymes were tested for their ability to distinguish between the fine-leaved species of the genus Festuca. Seed storage protein and ISSR fingerprint profiles could be used to distinguish between fine-leaved species of Festuca, except for closely related F. sabulosa and F. polesica species. Isozyme fingerprints did not contain sufficient number of species specific bands and were not feasible to discriminate between species. (author)

  9. Characterization of polymorphic microsatellites for the invasive grass Microstegium vimineum (Poaceae). (United States)

    Novy, Ari; Flory, S Luke; Honig, Joshua A; Bonos, Stacy; Hartman, Jean Marie


    Microsatellite markers were developed for the invasive plant Microstegium vimineum (Poaceae) to assess its population structure and to facilitate tracking of invasion expansion. Using 454 sequencing, 11 polymorphic and six monomorphic microsatellite primer sets were developed for M. vimineum. The primer sets were tested on individuals sampled from six populations in the United States and China. The polymorphic primers amplified di-, tri-, and tetranucleotide repeats with three to 10 alleles per locus. These markers will be useful for a variety of applications including tracking of invasion dynamics and population genetics studies.

  10. Cross-species amplification of 105 Lolium perenne SSR loci in 23 species within the Poaceae

    DEFF Research Database (Denmark)

    Jensen, Louise Bach; Holm, Preben Bach; Lübberstedt, Thomas


    Amplification of 105 Lolium perenne SSR markers was studied in 23 grass species representing seven tribes from three subfamilies of Poaceae. Twelve of the SSR markers are published for the first time. Between 2% and 96% of the SSR markers could be amplified within a given species. A subset of eight...... SSR markers was evaluated for polymorphism across nine of the 23 grass species. Four to seven of the markers were polymorphic within each species, with an average detection of 2.4 alleles per species....

  11. Novedades nomenclaturales en la tribu Stipeae (Poaceae, Pooideae para la Flora Argentina

    Directory of Open Access Journals (Sweden)

    Ana María Cialdella


    Full Text Available Durante la revisión de los géneros de Stipeae (Poaceae para la flora argentina y de acuerdo a los últimos estudios filogenéticos en la tribu, se confirmó la necesidad de transferir algunos taxones recientemente descriptos de Stipa a Nassella, Jarava o Pappostipa. En este trabajo se presentan 12 nuevas combinaciones: Jarava ichu var. pungens, Nassella brachyglumis, N. macrotricha, Pappostipa arenicola, P. choconensis, P. colloncurensis, P. frigida var. longifolia, P. jucunda, P. kieslingii, P. mapuche, P. marqueziana y P. zulmae. Se incluye también una clave para identificar los géneros de Stipeae en la Argentina.

  12. Phalaris canariensis L. (Poaceae: A new alien plant record for Kashmir Himalaya, India

    Directory of Open Access Journals (Sweden)

    Shugufta Rasheed


    Full Text Available The correct taxonomic identification assumes first and foremost priority in the scientific documentation of biodiversity. The Kashmir Himalaya, located in the north-western side of the Himalayan biodiversity hotspot, is well-known for its diverse flora which merits immediate scientific documentation. In this context, the present study reports Phalaris canariensis L. (Poaceae as a new alien plant record to the flora of Kashmir Himalaya, India. In this paper, a detailed description, photographs, and comparison of diagnostic characters with allied species are provided to scientifically validate this alien plant record for this Himalayan region.

  13. A new species of Rhopalosiphum (Hemiptera, Aphididae) on Chusquea tomentosa (Poaceae, Bambusoideae) from Costa Rica (United States)

    Hidalgo, Nicolás Pérez; Martínez-Torres, David; Collantes-Alegre, Jorge Mariano; Muller, William Villalobos; Nafría, Juan M. Nieto


    Abstract The new species Rhopalosiphum chusqueae Pérez Hidalgo & Villalobos Muller, is described from apterous viviparous females caught on Chusquea tomentosa in Cerro de la Muerte (Costa Rica). The identity of the species is supported both by the morphological features and by a molecular phylogenetic analysis based on a fragment of the mitochondrial DNA containing the 5’ region of the cytochrome c oxidase 1 (COI) and on the nuclear gene coding for the Elongation factor-1 alpha (EF1α). The taxonomic position of the new species is discussed. An identification key to the Aphidinae species living on plants of Bambusoideae (Poaceae) is presented. PMID:22328859

  14. The genus Vitex: A review


    Rani, Anita; Sharma, Anupam


    The review includes 161 references on the genus Vitex, and comprises ethnopharmacology, morphology and microscopy, phytoconstituents, pharmacological reports, clinical studies, and toxicology of the prominent species of Vitex. Essential oils, flavonoids, iridoid glycosides, diterpenoides and ligans constitute major classes of phytoconstituents of the genus. A few species of this genus have medicinal value, among these, leaves and fruits of V. agnus-castus Linn. (Verbenaceae) has been traditio...

  15. Reconstructing the Evolutionary History of Paralogous APETALA1/FRUITFULL-Like Genes in Grasses (Poaceae) (United States)

    Preston, Jill C.; Kellogg, Elizabeth A.


    Gene duplication is an important mechanism for the generation of evolutionary novelty. Paralogous genes that are not silenced may evolve new functions (neofunctionalization) that will alter the developmental outcome of preexisting genetic pathways, partition ancestral functions (subfunctionalization) into divergent developmental modules, or function redundantly. Functional divergence can occur by changes in the spatio-temporal patterns of gene expression and/or by changes in the activities of their protein products. We reconstructed the evolutionary history of two paralogous monocot MADS-box transcription factors, FUL1 and FUL2, and determined the evolution of sequence and gene expression in grass AP1/FUL-like genes. Monocot AP1/FUL-like genes duplicated at the base of Poaceae and codon substitutions occurred under relaxed selection mostly along the branch leading to FUL2. Following the duplication, FUL1 was apparently lost from early diverging taxa, a pattern consistent with major changes in grass floral morphology. Overlapping gene expression patterns in leaves and spikelets indicate that FUL1 and FUL2 probably share some redundant functions, but that FUL2 may have become temporally restricted under partial subfunctionalization to particular stages of floret development. These data have allowed us to reconstruct the history of AP1/FUL-like genes in Poaceae and to hypothesize a role for this gene duplication in the evolution of the grass spikelet. PMID:16816429

  16. Biodiversity of the genus Cladophialophora

    NARCIS (Netherlands)

    Badali, H.; Gueidan, C.; Najafzadeh, M.J.; Bonifaz, A.; Gerrits van den Ende, A.H.G.; de Hoog, G.S.


    Cladophialophora is a genus of black yeast-like fungi comprising a number of clinically highly significant species in addition to environmental taxa. The genus has previously been characterized by branched chains of ellipsoidal to fusiform conidia. However, this character was shown to have evolved

  17. Allotetraploid origin and divergence in Eleusine (Chloridoideae, Poaceae): evidence from low-copy nuclear gene phylogenies and a plastid gene chronogram. (United States)

    Liu, Qing; Triplett, Jimmy K; Wen, Jun; Peterson, Paul M


    Eleusine (Poaceae) is a small genus of the subfamily Chloridoideae exhibiting considerable morphological and ecological diversity in East Africa and the Americas. The interspecific phylogenetic relationships of Eleusine are investigated in order to identify its allotetraploid origin, and a chronogram is estimated to infer temporal relationships between palaeoenvironment changes and divergence of Eleusine in East Africa. Two low-copy nuclear (LCN) markers, Pepc4 and EF-1α, were analysed using parsimony, likelihood and Bayesian approaches. A chronogram of Eleusine was inferred from a combined data set of six plastid DNA markers (ndhA intron, ndhF, rps16-trnK, rps16 intron, rps3, and rpl32-trnL) using the Bayesian dating method. The monophyly of Eleusine is strongly supported by sequence data from two LCN markers. In the cpDNA phylogeny, three tetraploid species (E. africana, E. coracana and E. kigeziensis) share a common ancestor with the E. indica-E. tristachya clade, which is considered a source of maternal parents for allotetraploids. Two homoeologous loci are isolated from three tetraploid species in the Pepc4 phylogeny, and the maternal parents receive further support. The A-type EF-1α sequences possess three characters, i.e. a large number of variations of intron 2; clade E-A distantly diverged from clade E-B and other diploid species; and seven deletions in intron 2, implying a possible derivation through a gene duplication event. The crown age of Eleusine and the allotetraploid lineage are 3·89 million years ago (mya) and 1·40 mya, respectively. The molecular data support independent allotetraploid origins for E. kigeziensis and the E. africana-E. coracana clade. Both events may have involved diploids E. indica and E. tristachya as the maternal parents, but the paternal parents remain unidentified. The habitat-specific hypothesis is proposed to explain the divergence of Eleusine and its allotetraploid lineage.

  18. Models of genus one curves


    Sadek, Mohammad


    In this thesis we give insight into the minimisation problem of genus one curves defined by equations other than Weierstrass equations. We are interested in genus one curves given as double covers of P1, plane cubics, or complete intersections of two quadrics in P3. By minimising such a curve we mean making the invariants associated to its defining equations as small as possible using a suitable change of coordinates. We study the non-uniqueness of minimisations of the genus one curves des...

  19. Chemodiversity in the genus Aspergillus

    DEFF Research Database (Denmark)

    Frisvad, Jens Christian; Larsen, Thomas Ostenfeld


    to be characterized. The genus Aspergillus is cladistically holophyletic but phenotypically polythetic and very diverse and is associated to quite different sexual states. Following the one fungus one name system, the genus Aspergillus is restricted to a holophyletic clade that include the morphologically different...... biosynthetic family isoextrolites. However, it appears that secondary metabolites from one Aspergillus section have analogous metabolites in other sections (here also called heteroisoextrolites). In this review, we give a genus-wide overview of secondary metabolite production in Aspergillus species. Extrolites...

  20. In silico characterization of boron transporter (BOR1 protein sequences in Poaceae species

    Directory of Open Access Journals (Sweden)

    Ertuğrul Filiz


    Full Text Available Boron (B is essential for the plant growth and development, and its primary function is connected with formation of the cell wall. Moreover, boron toxicity is a shared problem in semiarid and arid regions. In this study, boron transporter protein (BOR1 sequences from some Poaceae species (Hordeum vulgare subsp. vulgare, Zea mays, Brachypodium distachyon, Oryza sativa subsp. japonica, Oryza sativa subsp. indica, Sorghum bicolor, Triticum aestivum were evaluated by bioinformatics tools. Physicochemical analyses revealed that most of BOR1 proteins were basic character and had generally aliphatic amino acids. Analysis of the domains showed that transmembrane domains were identified constantly and three motifs were detected with 50 amino acids length. Also, the motif SPNPWEPGSYDHWTVAKDMFNVPPAYIFGAFIPATMVAGLYYFDHSVASQ was found most frequently with 25 repeats. The phylogenetic tree showed divergence into two main clusters. B. distachyon species were clustered separately. Finally, this study contributes to the new BOR1 protein characterization in grasses and create scientific base for in silico analysis in future.

  1. La familia Poaceae del distrito de Arahuay (Canta, Lima, Perú

    Directory of Open Access Journals (Sweden)

    Paúl Gonzáles


    Full Text Available Se reportan para el distrito de Arahuay (Canta, Lima, Perú (zona baja y media un total de 49 especies de la familia Poaceae agrupadas en 28 géneros, 14 tribus y 4 subfamilias. El género Poa es el más diverso con cinco especies, seguido por Eragrostis y Nassella con cuatro especies cada una. Las especies Calamagrostis spiciformis Hack. ex Stuck., Chloris halophila Parodi, Lamprothyrsus peruvianus Hitchc., Festuca glyceriantha Pilg., Lolium multiflorum Lam. y Poa supina Schrad. son nuevos reportes para el departamento de Lima. Se presentan claves dicotómicas para la determinación de los géneros y para las especies en los casos pertinentes. Para cada especie se incluye datos sobre su hábitat, distribución y el material estudiado.

  2. The trophic plasticity of genus phelipanche pomel (orobanchaceae in bulgaria Trofichna plastichnost na rod phelipanche pomel (orobanchaceae v bulgaria

    Directory of Open Access Journals (Sweden)

    Kiril STOYANOV


    Full Text Available New data about the natural parasitism of Phelipanche ramosa (L Pomel, P. mutelii (Shultz Pomel, P. oxyloba, P. arenaria and P. purpurea in Bulgaria are collected. The information for the hosts describes 46 new trophic systems with species from the families: Brassicaceae, Solanaceae, Fabaceae, Asteraceae, Apiaceae, Poaceae, Lamiaceae, Scrophulariaceae, Chenopodiaceae, Caryophyllaceae, Araliaceae, Euphorbiaceae, Geraniaceae, Dioscoreaceae and Verbenaceae. The samples are collected outside the crop fields, far from the known host crops, from different parts of the country. Some of the registered hosts are new for Bulgaria. The voucher specimens with physical connection to the hosts are deposited in the Herbarium of The Agricultural University - Plovdiv (SOA. The collected data suggest that genus Phelipanche is represented by two trophic groups according to the known sections. Sect. Phelipanche unites the polyphags P. ramosa, P. oxyloba and P. mutelii. Sect. Arenariae consist oligophags - P. arenaria and P. purpurea.

  3. The genus Cladosporium (United States)

    Bensch, K.; Braun, U.; Groenewald, J.Z.; Crous, P.W.


    A monographic revision of the hyphomycete genus Cladosporium s. lat. (Cladosporiaceae, Capnodiales) is presented. It includes a detailed historic overview of Cladosporium and allied genera, with notes on their phylogeny, systematics and ecology. True species of Cladosporium s. str. (anamorphs of Davidiella), are characterised by having coronate conidiogenous loci and conidial hila, i.e., with a convex central dome surrounded by a raised periclinal rim. Recognised species are treated and illustrated with line drawings and photomicrographs (light as well as scanning electron microscopy). Species known from culture are described in vivo as well as in vitro on standardised media and under controlled conditions. Details on host range/substrates and the geographic distribution are given based on published accounts, and a re-examination of numerous herbarium specimens. Various keys are provided to support the identification of Cladosporium species in vivo and in vitro. Morphological datasets are supplemented by DNA barcodes (nuclear ribosomal RNA gene operon, including the internal transcribed spacer regions ITS1 and ITS2, the 5.8S nrDNA, as well as partial actin and translation elongation factor 1-α gene sequences) diagnostic for individual species. In total 993 names assigned to Cladosporium s. lat., including Heterosporium (854 in Cladosporium and 139 in Heterosporium), are treated, of which 169 are recognized in Cladosporium s. str. The other taxa are doubtful, insufficiently known or have been excluded from Cladosporium in its current circumscription and re-allocated to other genera by the authors of this monograph or previous authors. Taxonomic novelties: Cladosporium allicinum (Fr.: Fr.) Bensch, U. Braun & Crous, comb. nov., C. astroideum var. catalinense U. Braun, var. nov., Fusicladium tectonicola (Yong H. He & Z.Y. Zhang) U. Braun & Bensch, comb. nov., Septoidium uleanum (Henn.) U. Braun, comb. nov., Zasmidium adeniae (Hansf.) U. Braun, comb. nov., Zasmidium

  4. The genus Vitex: A review. (United States)

    Rani, Anita; Sharma, Anupam


    The review includes 161 references on the genus Vitex, and comprises ethnopharmacology, morphology and microscopy, phytoconstituents, pharmacological reports, clinical studies, and toxicology of the prominent species of Vitex. Essential oils, flavonoids, iridoid glycosides, diterpenoides and ligans constitute major classes of phytoconstituents of the genus. A few species of this genus have medicinal value, among these, leaves and fruits of V. agnus-castus Linn. (Verbenaceae) has been traditionally used in treatment of women complaints. V. agnus-castus has also been included in herbal remedies, which are in clinical use to regulate the menstrual cycle, reduce premenstrual symptom tension and anxiety, treat some menopausal symptoms as well as to treat hormonally induced acne. Despite a long tradition of use of some species, the genus has not been explored properly. In the concluding part, the future scope of Vitex species has been emphasized with a view to establish their multifarious biological activities and mode of action.

  5. Poaceae: Triticeae

    Indian Academy of Sciences (India)

    Department of Bioengineering and Biotechnology, Qingdao University of Science and Technology, Qingdao, Shandong ... entire chloroplast DNA sequence of common wheat (T. aes- ... a CTAB method as previously described by Liu et al.

  6. Poaceae: Paniceae

    Indian Academy of Sciences (India)

    1987; Bernini and Marin-Morales. 2001; Mendes-Bonato et al. 2002, 2006; Utsunomiya et al. 2005). More recently, a new number, x = 6, was determined for several accessions of B. dictyoneura (Risso-Pascotto et al. 2006), a species suggested to belong to the same agamic complex as B. humidicola (Renvoize et al. 1996).

  7. Revision of the genus Phaeanthus (Annonaceae)

    NARCIS (Netherlands)

    Mols, J.B.; Keßler, P.J.A.


    A revision of the genus Phaeanthus Hook.f. & Thomson (Annonaceae) is presented. The genus comprises 8 species. A key to the fruiting and/or flowering specimens of the genus is included. The genus consists of shrubs to small-sized trees from Malesia and Vietnam. It is characterised by sepals and

  8. Development of Simple Sequence Repeats (SSR) markers in Setaria italica (Poaceae) and cross-amplification in related species. (United States)

    Lin, Heng-Sheng; Chiang, Chih-Yun; Chang, Song-Bin; Kuoh, Chang-Sheng


    Foxtail millet is one of the world's oldest cultivated crops. It has been adopted as a model organism for providing a deeper understanding of plant biology. In this study, 45 simple sequence repeats (SSR) markers of Setaria italica were developed. These markers showing polymorphism were screened in 223 samples from 12 foxtail millet populations around Taiwan. The most common dinucleotide and trinucleotide repeat motifs are AC/TG (84.21%) and CAT (46.15%). The average number of alleles (N(a)), the average heterozygosities observed (H(o)) and expected (H(e)) are 3.73, 0.714, 0.587, respectively. In addition, 24 SSR markers had shown transferability to six related Poaceae species. These new markers provide tools for examining genetic relatedness among foxtail millet populations and other related species. It is suitable for germplasm management and protection in Poaceae.

  9. Development of Simple Sequence Repeats (SSR Markers in Setaria italica (Poaceae and Cross-Amplification in Related Species

    Directory of Open Access Journals (Sweden)

    Chih-Yun Chiang


    Full Text Available Foxtail millet is one of the world’s oldest cultivated crops. It has been adopted as a model organism for providing a deeper understanding of plant biology. In this study, 45 simple sequence repeats (SSR markers of Setaria italica were developed. These markers showing polymorphism were screened in 223 samples from 12 foxtail millet populations around Taiwan. The most common dinucleotide and trinucleotide repeat motifs are AC/TG (84.21% and CAT (46.15%. The average number of alleles (Na, the average heterozygosities observed (Ho and expected (He are 3.73, 0.714, 0.587, respectively. In addition, 24 SSR markers had shown transferability to six related Poaceae species. These new markers provide tools for examining genetic relatedness among foxtail millet populations and other related species. It is suitable for germplasm management and protection in Poaceae.

  10. Molecular, phylogenetic and comparative genomic analysis of the cytokinin oxidase/dehydrogenase gene family in the Poaceae. (United States)

    Mameaux, Sabine; Cockram, James; Thiel, Thomas; Steuernagel, Burkhard; Stein, Nils; Taudien, Stefan; Jack, Peter; Werner, Peter; Gray, John C; Greenland, Andy J; Powell, Wayne


    The genomes of cereals such as wheat (Triticum aestivum) and barley (Hordeum vulgare) are large and therefore problematic for the map-based cloning of agronomicaly important traits. However, comparative approaches within the Poaceae permit transfer of molecular knowledge between species, despite their divergence from a common ancestor sixty million years ago. The finding that null variants of the rice gene cytokinin oxidase/dehydrogenase 2 (OsCKX2) result in large yield increases provides an opportunity to explore whether similar gains could be achieved in other Poaceae members. Here, phylogenetic, molecular and comparative analyses of CKX families in the sequenced grass species rice, brachypodium, sorghum, maize and foxtail millet, as well as members identified from the transcriptomes/genomes of wheat and barley, are presented. Phylogenetic analyses define four Poaceae CKX clades. Comparative analyses showed that CKX phylogenetic groupings can largely be explained by a combination of local gene duplication, and the whole-genome duplication event that predates their speciation. Full-length OsCKX2 homologues in barley (HvCKX2.1, HvCKX2.2) and wheat (TaCKX2.3, TaCKX2.4, TaCKX2.5) are characterized, with comparative analysis at the DNA, protein and genetic/physical map levels suggesting that true CKX2 orthologs have been identified. Furthermore, our analysis shows CKX2 genes in barley and wheat have undergone a Triticeae-specific gene-duplication event. Finally, by identifying ten of the eleven CKX genes predicted to be present in barley by comparative analyses, we show that next-generation sequencing approaches can efficiently determine the gene space of large-genome crops. Together, this work provides the foundation for future functional investigation of CKX family members within the Poaceae. © 2011 National Institute of Agricultural Botany (NIAB). Plant Biotechnology Journal © 2011 Society for Experimental Biology, Association of Applied Biologists and Blackwell

  11. Complete chloroplast genome sequence of common bermudagrass (Cynodon dactylon (L.) Pers.) and comparative analysis within the family Poaceae. (United States)

    Huang, Ya-Yi; Cho, Shu-Ting; Haryono, Mindia; Kuo, Chih-Horng


    Common bermudagrass (Cynodon dactylon (L.) Pers.) belongs to the subfamily Chloridoideae of the Poaceae family, one of the most important plant families ecologically and economically. This grass has a long connection with human culture but its systematics is relatively understudied. In this study, we sequenced and investigated the chloroplast genome of common bermudagrass, which is 134,297 bp in length with two single copy regions (LSC: 79,732 bp; SSC: 12,521 bp) and a pair of inverted repeat (IR) regions (21,022 bp). The annotation contains a total of 128 predicted genes, including 82 protein-coding, 38 tRNA, and 8 rRNA genes. Additionally, our in silico analyses identified 10 sets of repeats longer than 20 bp and predicted the presence of 36 RNA editing sites. Overall, the chloroplast genome of common bermudagrass resembles those from other Poaceae lineages. Compared to most angiosperms, the accD gene and the introns of both clpP and rpoC1 genes are missing. Additionally, the ycf1, ycf2, ycf15, and ycf68 genes are pseudogenized and two genome rearrangements exist. Our phylogenetic analysis based on 47 chloroplast protein-coding genes supported the placement of common bermudagrass within Chloridoideae. Our phylogenetic character mapping based on the parsimony principle further indicated that the loss of the accD gene and clpP introns, the pseudogenization of four ycf genes, and the two rearrangements occurred only once after the most recent common ancestor of the Poaceae diverged from other monocots, which could explain the unusual long branch leading to the Poaceae when phylogeny is inferred based on chloroplast sequences.

  12. THE GENUS CULLENIA Wight * (Bombacaceae

    Directory of Open Access Journals (Sweden)



    Full Text Available The monotypic genus Cullenia was established by Wight (IconesPI. Ind. or. 5 (1 : pi. 1761—62 & text, 1851, who differentiated it fromDurio Adans. mainly by the lack of a corolla and the position and shapeof the anthers. The only species, originally described as Durio ceylanicusby Gardner, was cited by Wight as Cullenia excelsa Wight. K. Schumanncorrected the specific epithet rather casually and atributed it (wronglyto Wight. Bentham (in Benth. & Hook., Gen. pi. 1: 212. 1867; Baillon(Hist. pi. 4: 159. 1872, Masters (in Hook, f., Fl. Br. Ind. 1: 350. 1874and Beccari (Malesia 3: 219. 1889 accepted the genus.Bakhuizen van den Brink (in Bull. Jard. bot. Buitenzorg III, 6: 228.1924 incorporated the genus in Durio.In my opinion Cullenia represents a "good" genus by its lack ofcorolla. Alston, although accepting Bakhuizen's reduction, informed mepersonally, that he, too, is inclined to consider Cullenia different fromDurio.The pollen were described as being naked and pedicellate by Gardner;this wrong statement was corrected by Wight; the anthers are pedicellateand one-celled.In this paper a new Cullenia species is described, which strengthensthe position of the genus; both species are restricted to the rain forestregion of Ceylon and the Southern Indian Peninsula.

  13. Ribosomal DNA in diploid and polyploid Setaria (Poaceae) species: number and distribution


    Nani, Thaís Furtado; Cenzi, Gisele; Pereira, Daniele Lais; Davide, Lisete Chamma; Techio, Vania Helena


    Abstract Setaria Beauvois, 1812 is a genus of economically important forage species, including Setaria italica (Linnaeus, 1753) Beauvois, 1812 and Setaria viridis (Linnaeus, 1753) Beauvois, 1812, closely related species and considered as model systems for studies of C4 plants. However, complications and uncertainties related to taxonomy of other species of the genus are frequent due to the existence of numerous synonyms for the same species or multiple species with the same name, and overlapp...

  14. Phylogeny of the Genus Drosophila (United States)

    O’Grady, Patrick M.; DeSalle, Rob


    Understanding phylogenetic relationships among taxa is key to designing and implementing comparative analyses. The genus Drosophila, which contains over 1600 species, is one of the most important model systems in the biological sciences. For over a century, one species in this group, Drosophila melanogaster, has been key to studies of animal development and genetics, genome organization and evolution, and human disease. As whole-genome sequencing becomes more cost-effective, there is increasing interest in other members of this morphologically, ecologically, and behaviorally diverse genus. Phylogenetic relationships within Drosophila are complicated, and the goal of this paper is to provide a review of the recent taxonomic changes and phylogenetic relationships in this genus to aid in further comparative studies. PMID:29716983

  15. Seed storage protein gene promoters contain conserved DNA motifs in Brassicaceae, Fabaceae and Poaceae (United States)

    Fauteux, François; Strömvik, Martina V


    Background Accurate computational identification of cis-regulatory motifs is difficult, particularly in eukaryotic promoters, which typically contain multiple short and degenerate DNA sequences bound by several interacting factors. Enrichment in combinations of rare motifs in the promoter sequence of functionally or evolutionarily related genes among several species is an indicator of conserved transcriptional regulatory mechanisms. This provides a basis for the computational identification of cis-regulatory motifs. Results We have used a discriminative seeding DNA motif discovery algorithm for an in-depth analysis of 54 seed storage protein (SSP) gene promoters from three plant families, namely Brassicaceae (mustards), Fabaceae (legumes) and Poaceae (grasses) using backgrounds based on complete sets of promoters from a representative species in each family, namely Arabidopsis (Arabidopsis thaliana (L.) Heynh.), soybean (Glycine max (L.) Merr.) and rice (Oryza sativa L.) respectively. We have identified three conserved motifs (two RY-like and one ACGT-like) in Brassicaceae and Fabaceae SSP gene promoters that are similar to experimentally characterized seed-specific cis-regulatory elements. Fabaceae SSP gene promoter sequences are also enriched in a novel, seed-specific E2Fb-like motif. Conserved motifs identified in Poaceae SSP gene promoters include a GCN4-like motif, two prolamin-box-like motifs and an Skn-1-like motif. Evidence of the presence of a variant of the TATA-box is found in the SSP gene promoters from the three plant families. Motifs discovered in SSP gene promoters were used to score whole-genome sets of promoters from Arabidopsis, soybean and rice. The highest-scoring promoters are associated with genes coding for different subunits or precursors of seed storage proteins. Conclusion Seed storage protein gene promoter motifs are conserved in diverse species, and different plant families are characterized by a distinct combination of conserved motifs

  16. Seed storage protein gene promoters contain conserved DNA motifs in Brassicaceae, Fabaceae and Poaceae

    Directory of Open Access Journals (Sweden)

    Fauteux François


    Full Text Available Abstract Background Accurate computational identification of cis-regulatory motifs is difficult, particularly in eukaryotic promoters, which typically contain multiple short and degenerate DNA sequences bound by several interacting factors. Enrichment in combinations of rare motifs in the promoter sequence of functionally or evolutionarily related genes among several species is an indicator of conserved transcriptional regulatory mechanisms. This provides a basis for the computational identification of cis-regulatory motifs. Results We have used a discriminative seeding DNA motif discovery algorithm for an in-depth analysis of 54 seed storage protein (SSP gene promoters from three plant families, namely Brassicaceae (mustards, Fabaceae (legumes and Poaceae (grasses using backgrounds based on complete sets of promoters from a representative species in each family, namely Arabidopsis (Arabidopsis thaliana (L. Heynh., soybean (Glycine max (L. Merr. and rice (Oryza sativa L. respectively. We have identified three conserved motifs (two RY-like and one ACGT-like in Brassicaceae and Fabaceae SSP gene promoters that are similar to experimentally characterized seed-specific cis-regulatory elements. Fabaceae SSP gene promoter sequences are also enriched in a novel, seed-specific E2Fb-like motif. Conserved motifs identified in Poaceae SSP gene promoters include a GCN4-like motif, two prolamin-box-like motifs and an Skn-1-like motif. Evidence of the presence of a variant of the TATA-box is found in the SSP gene promoters from the three plant families. Motifs discovered in SSP gene promoters were used to score whole-genome sets of promoters from Arabidopsis, soybean and rice. The highest-scoring promoters are associated with genes coding for different subunits or precursors of seed storage proteins. Conclusion Seed storage protein gene promoter motifs are conserved in diverse species, and different plant families are characterized by a distinct combination

  17. Bordasia Krapov., new Malvaceae genus

    Directory of Open Access Journals (Sweden)

    Antonio Krapovickas


    Full Text Available Bordasia bicornis Krapov. new genus and species is described from northwestern ParaguayanChaco. It is related to Sida from which it differs by the mericarp with two apical horns, by theleaves dimorphic and coriaceous and by the fannel-shaped calyx

  18. The genus Actiniceps Berk. & Br

    NARCIS (Netherlands)

    Boedijn, K.B.


    The genus Actiniceps Berk. & Br. is shown to be a Basidiomycete. Wiesnerina Höhn. and Dimorphocystis Corner are regarded synonymous. The type species A. thwaitesii Berk. & Br. is redescribed with D. capitatus Corner as synonym. The following new combinations are proposed: A. horrida (Höhn.) Boedijn,

  19. Intergenomic rearrangements after polyploidization of Kengyilia thoroldiana (Poaceae: Triticeae) affected by environmental factors. (United States)

    Wang, Qiuxia; Liu, Huitao; Gao, Ainong; Yang, Xinming; Liu, Weihua; Li, Xiuquan; Li, Lihui


    Polyploidization is a major evolutionary process. Approximately 70-75% species of Triticeae (Poaceae) are polyploids, involving 23 genomes. To investigate intergenomic rearrangements after polyploidization of Triticeae species and to determine the effects of environmental factors on them, nine populations of a typical polyploid Triticeae species, Kengyilia thoroldiana (Keng) J.L.Yang et al. (2n = 6x = 42, StStPPYY), collected from different environments, were studied using genome in situ hybridization (GISH). We found that intergenomic rearrangements occurred between the relatively large P genome and the small genomes, St (8.15%) and Y (22.22%), in polyploid species via various types of translocations compared to their diploid progenitors. However, no translocation was found between the relatively small St and Y chromosomes. Environmental factors may affect rearrangements among the three genomes. Chromosome translocations were significantly more frequent in populations from cold alpine and grassland environments than in populations from valley and lake-basin habitats (P<0.05). The relationship between types of chromosome translocations and altitude was significant (r = 0.809, P<0.01). Intergenomic rearrangements associated with environmental factors and genetic differentiation of a single basic genome should be considered as equally important genetic processes during species' ecotype evolution.

  20. Morphology and anatomy of the diaspores and seedling of Paspalum (Poaceae, Poales

    Directory of Open Access Journals (Sweden)



    Full Text Available ABSTRACT The knowledge regarding of the diaspore and post-seminal development of Paspalum L. is important for grassland biodiversity conservation, based on their representativeness and genetic improvement of forage. The morphology of the diaspore and the post-seminal development of Paspalum dilatatum Poir. (rhizomatous, P. mandiocanum Trin. var. subaequiglume Barreto (stoloniferous, P. pumilum Nees. (decumbent caespitose and P. urvillei Steud. (erect caespitose was described to distinguish species with different growth forms and to survey the characters useful for taxonomy. P. dilatatum differs by presenting oval diaspores larger than the others, with five prominent nerves and trichomes; P. urvillei presents diaspores with one central nerve that is more developed than the two lateral nerves and trichomes; P. mandiocanum var. subaequiglume presents diaspores with trichomes only in the margin; and P. pumilum differs by presenting glabrous diaspores. The caryopsis involves the seed that presents the differentiated embryo and disposed laterally, an elliptical hilum in all of the studied species and a rostellum in P. dilatatum and P. mandiocanum var. subaequiglume. The post-seminal development is similar in the four species and begins with germination that is marked by the emergence of the coleorhiza, followed by the coleoptile. These characteristics are common to other Poaceae previously studied, indicating a pattern to the family and do not distinguish the growth forms.

  1. Intergenomic rearrangements after polyploidization of Kengyilia thoroldiana (Poaceae: Triticeae affected by environmental factors.

    Directory of Open Access Journals (Sweden)

    Qiuxia Wang

    Full Text Available Polyploidization is a major evolutionary process. Approximately 70-75% species of Triticeae (Poaceae are polyploids, involving 23 genomes. To investigate intergenomic rearrangements after polyploidization of Triticeae species and to determine the effects of environmental factors on them, nine populations of a typical polyploid Triticeae species, Kengyilia thoroldiana (Keng J.L.Yang et al. (2n = 6x = 42, StStPPYY, collected from different environments, were studied using genome in situ hybridization (GISH. We found that intergenomic rearrangements occurred between the relatively large P genome and the small genomes, St (8.15% and Y (22.22%, in polyploid species via various types of translocations compared to their diploid progenitors. However, no translocation was found between the relatively small St and Y chromosomes. Environmental factors may affect rearrangements among the three genomes. Chromosome translocations were significantly more frequent in populations from cold alpine and grassland environments than in populations from valley and lake-basin habitats (P<0.05. The relationship between types of chromosome translocations and altitude was significant (r = 0.809, P<0.01. Intergenomic rearrangements associated with environmental factors and genetic differentiation of a single basic genome should be considered as equally important genetic processes during species' ecotype evolution.

  2. Transcriptomic analysis, genic SSR development, and genetic diversity of proso millet (Panicum miliaceum; Poaceae). (United States)

    Hou, Siyu; Sun, Zhaoxia; Li, Yaoshen; Wang, Yijie; Ling, Hubin; Xing, Guofang; Han, Yuanhuai; Li, Hongying


    Proso millet ( Panicum miliaceum ; Poaceae) is a minor crop with good nutritional qualities and strong tolerance to drought stress and soil infertility. However, studies on genetic diversity have been limited due to a lack of efficient genetic markers. Illumina sequencing technology was used to generate short read sequences of proso millet, and de novo transcriptome assemblies were used to develop a de novo assembly of proso millet. Genic simple sequence repeat (SSR) markers were identified and used to detect polymorphism among 56 accessions. Population structure and genetic similarity coefficient were estimated. In total, 25,341 unique gene sequences and 4724 SSR loci were obtained from the transcriptome, of which 229 pairs of SSR primers were validated, which resulted in 14 polymorphic genic SSR primers exhibiting 43 total alleles. According to the ratio of polymorphic markers (6.1%, 14/229), there are potentially 288 polymorphic genic SSR markers available for genetic assay development in the future. Bayesian population analyses showed that the 56 accessions comprised two distinct groups. A genetic structure and cluster assay indicated that the accessions from the Loess Plateau of China shared a high genetic similarity coefficient with those from other regions and that there was no correlation between genetic diversity and geographic origin. The transcriptome sequencing data and millet-specific SSR markers developed in this study establish an excellent resource for gene discovery and may improve the development of breeding programs in proso millet in the future.

  3. Transcriptomic analysis, genic SSR development, and genetic diversity of proso millet (Panicum miliaceum; Poaceae)1 (United States)

    Hou, Siyu; Sun, Zhaoxia; Li, Yaoshen; Wang, Yijie; Ling, Hubin; Xing, Guofang; Han, Yuanhuai; Li, Hongying


    Premise of the study: Proso millet (Panicum miliaceum; Poaceae) is a minor crop with good nutritional qualities and strong tolerance to drought stress and soil infertility. However, studies on genetic diversity have been limited due to a lack of efficient genetic markers. Methods: Illumina sequencing technology was used to generate short read sequences of proso millet, and de novo transcriptome assemblies were used to develop a de novo assembly of proso millet. Genic simple sequence repeat (SSR) markers were identified and used to detect polymorphism among 56 accessions. Population structure and genetic similarity coefficient were estimated. Results: In total, 25,341 unique gene sequences and 4724 SSR loci were obtained from the transcriptome, of which 229 pairs of SSR primers were validated, which resulted in 14 polymorphic genic SSR primers exhibiting 43 total alleles. According to the ratio of polymorphic markers (6.1%, 14/229), there are potentially 288 polymorphic genic SSR markers available for genetic assay development in the future. Bayesian population analyses showed that the 56 accessions comprised two distinct groups. Discussion: A genetic structure and cluster assay indicated that the accessions from the Loess Plateau of China shared a high genetic similarity coefficient with those from other regions and that there was no correlation between genetic diversity and geographic origin. The transcriptome sequencing data and millet-specific SSR markers developed in this study establish an excellent resource for gene discovery and may improve the development of breeding programs in proso millet in the future. PMID:28791202

  4. Rank Two Affine Manifolds in Genus 3


    Aulicino, David; Nguyen, Duc-Manh


    We complete the classification of rank two affine manifolds in the moduli space of translation surfaces in genus three. Combined with a recent result of Mirzakhani and Wright, this completes the classification of higher rank affine manifolds in genus three.

  5. A review of the genus Erycibe Roxb

    NARCIS (Netherlands)

    Hoogland, R.D.


    In this paper I intend to give a review of the genus Erycibe Roxb. in. which all the names published in the genus will be accounted for. The representatives from Malaysia have been dealt with more extensively in the revision of the genus in Flora Malesiana, Ser. I, Vol. 4, 4th instalment, 1953, pp.

  6. Symbiotic diversity in the cosmopolitan genus Acacia (United States)

    James K. Leary; Paul W. Singleton; Paul G. Scowcroft; Dulal Borthakur


    Acacia is the second largest genus within the Leguminosae, with 1352 species identified. This genus is now known to be polyphyletic and the international scientific community will presumably split Acacia into five new genera. This review examines the diversity of biological nitrogen fixation symbiosis within Acacia as a single genus. Due to its global importance, an...

  7. Development of ent-kaurene Oxidase-Based Conserved Intron Spanning Primers for Species Identification in the Genus Poa (Poaceae; Bluegrass)


    Jonathan M. LaMantia; Ambika Chandra; David R. Huff


    Interspecific hybridization has been attempted to combine the heat and drought of Poa arachnifera Torr. with the turf quality characteristics of several Poa species. Confirmation of an F1 hybrid through morphological analysis of vegetative and flowering characteristics is often time consuming and ambiguous. Ent-kaurene oxidase (KO) has been sequenced in rice, barley, and wheat. In rice, each of the five copies of KO gene has unique lengths for the first intron. Conserved intron spanning prime...

  8. Development of ent-kaurene Oxidase-Based Conserved Intron Spanning Primers for Species Identification in the Genus Poa (Poaceae; Bluegrass

    Directory of Open Access Journals (Sweden)

    Jonathan M. LaMantia


    Full Text Available Interspecific hybridization has been attempted to combine the heat and drought of Poa arachnifera Torr. with the turf quality characteristics of several Poa species. Confirmation of an F1 hybrid through morphological analysis of vegetative and flowering characteristics is often time consuming and ambiguous. Ent-kaurene oxidase (KO has been sequenced in rice, barley, and wheat. In rice, each of the five copies of KO gene has unique lengths for the first intron. Conserved intron spanning primers (CISP can be used as a DNA marker to exploit variations of intron lengths that flank conserved gene sequences. In the present study, we developed CISP to sequence partial genomic fragments of the KO gene from seven Poa species. Through sequence analysis, species-specific primers were also developed to produce co-dominant markers that can be used to identify interspecific hybrids between Texas bluegrass and six other Poa species used in the present study.

  9. Radiomodulatory potential of hydroalcoholic extract of a medicinal plant Cynodon dactylon (Family: Poaceae), against radiation-induced cytogenetic damage

    International Nuclear Information System (INIS)

    Satish Rao, B.S.; Upadhya, D.; Adiga, S.K.


    The exposure of humans to ionizing radiations may be advertently by routine diagnostic and therapeutic purposes or inadvertently during natural, occupational and nuclear accident situations. Therefore, in order to overcome the deleterious biological effects of radiation several chemical agents have been studied for their radioprotective potential. The medicinal plants being one of the resources for such clinically important natural agents, used extensively in several drug discovery related research. Here the radiomodulatory potential of hydroalcoholic extract of a medicinal plant Cynodon dactylon (Family: Poaceae), against radiation-induced cytogenetic damage was analyzed using Chinese hamster fibroblast cells (V79) and human peripheral blood lymphocytes (HPBLs) growing in vitro is reported

  10. Study of the chemical composition of essential oils and floral waters of Cymbopogon citratus (DC.) Stapf (Poaceae) from Senegal


    Diop, Serigne Mbacké; Guèye, Momar Talla; Ndiaye, Ibrahima; Diop, Michel Bakar; Ndiaye, El Hadji Barka; Thiam, Abdoulaye; Fauconnier, Marie-Laure; Lognay, Georges


    This work aimed to study the chemical composition of essential oils and floral waters of Cymbopogon citratus (DC.) Stapf (Poaceae) from Senegal. The plants were collected in two different localities, Dakar and Kaolack. The extracts were obtained by steam distillation from both fresh and dried plants and analyses carried out by GC/FID and GC/MS. Oils from Dakar were dominated by geranial which represented 46.0-43.9%, neral 31.8-31.0%, myrcene 10.8-11.7% and geraniol 2.7-4.2% in the fresh and d...

  11. Scavenging in the genus Natrix

    Directory of Open Access Journals (Sweden)

    Cesar Ayres


    Full Text Available Scavenging is reported as an unusual behaviour of snakes. However, it is likely more common than is supposed. Here I report the use of dead newts as prey source by water snakes of the genus Natrix at a dam in north-western Spain. Juveniles and adults viperine snakes (Natrix maura, and also an adult grass snake (Natrix natrix were found feeding on newt carcasses.


    Directory of Open Access Journals (Sweden)

    Alexander Vasilievich Pinevich


    Full Text Available Green cyanobacteria are distinguished from blue-green ones by the possession of a chlorophyll-containing light harvesting antenna. Three genera of green cyanobacteria, namely Acaryochloris, Prochlorococcus and Prochloron, are unicellular and of marine habitat; Prochlorococcus marinus attracts most attention due to its outstanding role in prime productivity. The fourth genus, Prochlorothrix, is represented by filamentous freshwater strains. Unlike the rest of green cyanobacteria, Prochlorothrix is paradoxically rare: it has been isolated from two European locations only. Taking into account fluctuating blooms, morphological resemblance with Planktothrix and Pseudanabaena, and unsuccessful enrichment of Prochlorothrix, the preferred strategy of search for this cyanobacterium is based on PCR with natural DNA and specific primers. This approach already demonstrates a broader distribution of Prochlorothrix: marker genes have been found in at least two additional locations. Despite the growing evidence for naturally occurring Prochlorothrix, there are only a few cultivated strains, and only one of them (PCC 9006 is claimed to be axenic. In multixenic cultures, Prochlorothrix is accompanied by heterotrophic bacteria, indicating a consortium-type association. The genus Prochlorothrix includes two species: P. hollandica and P. scandica based on distinctions in genomic DNA, cell size, temperature optimum, and fatty acid composition of membrane lipids. In this short review, the properties of cyanobacteria of the genus Prochlorothrix are described, and the evolutionary scenario of green cyanobacteria, especially taking into account their role in the origin of simple chloroplast is given.

  13. Biodiversity of the genus Cladophialophora (United States)

    Badali, H.; Gueidan, C.; Najafzadeh, M.J.; Bonifaz, A.; van den Ende, A.H.G. Gerrits; de Hoog, G.S.


    Cladophialophora is a genus of black yeast-like fungi comprising a number of clinically highly significant species in addition to environmental taxa. The genus has previously been characterized by branched chains of ellipsoidal to fusiform conidia. However, this character was shown to have evolved several times independently in the order Chaetothyriales. On the basis of a multigene phylogeny (nucLSU, nucSSU, RPB1), most of the species of Cladophialophora (including its generic type C. carrionii) belong to a monophyletic group comprising two main clades (carrionii- and bantiana-clades). The genus includes species causing chromoblastomycosis and other skin infections, as well as disseminated and cerebral infections, often in immunocompetent individuals. In the present study, multilocus phylogenetic analyses were combined to a morphological study to characterize phenetically similar Cladophialophora strains. Sequences of the ITS region, partial Translation Elongation Factor 1-α and β-Tubulin genes were analysed for a set of 48 strains. Four novel species were discovered, originating from soft drinks, alkylbenzene-polluted soil, and infected patients. Membership of the both carrionii and bantiana clades might be indicative of potential virulence to humans. PMID:19287540

  14. On genus expansion of superpolynomials

    Energy Technology Data Exchange (ETDEWEB)

    Mironov, Andrei, E-mail: [Lebedev Physics Institute, Moscow 119991 (Russian Federation); ITEP, Moscow 117218 (Russian Federation); National Research Nuclear University MEPhI, Moscow 115409 (Russian Federation); Morozov, Alexei, E-mail: [ITEP, Moscow 117218 (Russian Federation); National Research Nuclear University MEPhI, Moscow 115409 (Russian Federation); Sleptsov, Alexei, E-mail: [ITEP, Moscow 117218 (Russian Federation); Laboratory of Quantum Topology, Chelyabinsk State University, Chelyabinsk 454001 (Russian Federation); KdVI, University of Amsterdam (Netherlands); Smirnov, Andrey, E-mail: [ITEP, Moscow 117218 (Russian Federation); Columbia University, Department of Mathematics, New York (United States)


    Recently it was shown that the (Ooguri–Vafa) generating function of HOMFLY polynomials is the Hurwitz partition function, i.e. that the dependence of the HOMFLY polynomials on representation R is naturally captured by symmetric group characters (cut-and-join eigenvalues). The genus expansion and expansion through Vassiliev invariants explicitly demonstrate this phenomenon. In the present paper we claim that the superpolynomials are not functions of such a type: symmetric group characters do not provide an adequate linear basis for their expansions. Deformation to superpolynomials is, however, straightforward in the multiplicative basis: the Casimir operators are β-deformed to Hamiltonians of the Calogero–Moser–Sutherland system. Applying this trick to the genus and Vassiliev expansions, we observe that the deformation is fully straightforward only for the thin knots. Beyond the family of thin knots additional algebraically independent terms appear in the Vassiliev and genus expansions. This can suggest that the superpolynomials do in fact contain more information about knots than the colored HOMFLY and Kauffman polynomials. However, even for the thin knots the beta-deformation is non-innocent: already in the simplest examples it seems inconsistent with the positivity of colored superpolynomials in non-(anti)symmetric representations, which also happens in I. Cherednik's (DAHA-based) approach to the torus knots.

  15. An updated review on the Oenothera genus. (United States)

    Singh, Sumitra; Kaur, Rupinder; Sharma, Surendra Kr


    Oenothera genus (Onagraceae) has been used as a folk remedy since ancient times for the treatment of asthma, gastrointestinal disorders, neuralgia, skin diseases, and hepatic and kidney diseases. Different chemical constituents like lipids, flavonoids, tannins, steroids and triterpenes have been isolated from this genus. The various notable pharmacological activities reported from the genus are antioxidant, cytotoxic, antibacterial, antiviral, anti-inflammatory, antihyperlipidaemic, thrombolytic and antidiarrhoeal. The present paper is to summarize the worldwide reported biological activities and phytoconstituents associated with this genus for about 50 years and highlight the medicinally important species belonging to this genus so that these species can be further explored and used as therapeutic agents for various diseases.

  16. Phylogeny and biogeography of North-American wild rice (Zizania L.Poaceae) (United States)

    The wild-rice genus Zizania includes four species disjunctly distributed in eastern Asia and North America, with three species (Z. aquatica, Z. palustris, and Z. texana) in North America and one (Z. latifolia) in eastern Asia. The phylogeny and biogeography of Zizania were explored using sequences o...

  17. On the concordance genus of topologically slice knots


    Hom, Jennifer


    The concordance genus of a knot K is the minimum Seifert genus of all knots smoothly concordant to K. Concordance genus is bounded below by the 4-ball genus and above by the Seifert genus. We give a lower bound for the concordance genus of K coming from the knot Floer complex of K. As an application, we prove that there are topologically slice knots with 4-ball genus equal to one and arbitrarily large concordance genus.

  18. Acrapex azumai Sugi (Lepidoptera, Noctuidae) as a possible biological control agent of the invasive weed Imperata cylindrica (L.) Beauv. (Poaceae) in the United States (United States)

    Lepidopteran larvae were discovered boring in the basal stems of Imperata cylindrica (L.) Beauv. (Poaceae) in Itoshima city, Fukuoka Prefecture, Kyushu, Japan. Adults reared from these larvae were identified as Acrapex azumai Sugi (Lepidoptera: Noctuidae). Sequencing of the CO1 (cytochrome oxidase 1...

  19. Chemotaxonomy of the genus Stemphylium

    DEFF Research Database (Denmark)

    Olsen, Kresten Jon Kromphardt; Andersen, Birgitte


    The filamentous fungal genus Stemphylium (Anamophic Pleospora) is often found on various crops, and especially the common animal feed plant Medicago sativa (alfalfa) is often infected by this plant pathogen. With this in mind it is important to consider what consequences such a contamination can...... have, e.g. production of mycotoxins. (Firsvad et al. (2009)) A clade of Stemphylium spp. i.e. S. herbarum, S. alfalfae, S. sedicola, S. tomatonis and S. vesicariumare troublesome to distinguish as they share both morphological and molecular characteristics. This study has focused on using chemotaxonomy...

  20. Chromosome number, microsporogenesis, microgametogenesis, and pollen viability in the Brazilian native grass Mesosetum chaseae (Poaceae). (United States)

    Silva, L A C; Pagliarini, M S; Santos, S A; Silva, N; Souza, V F


    The genus Mesosetum is a primarily South American genus with 42 species. Mesosetum chaseae, regionally known as 'grama-do-cerrado', is abundant in the Pantanal Matogrossense (Brazil); it is a valuable resource for livestock and for environmental conservation. We collected specimens from the Nhecolandia sub-region of the Brazilian Pantanal, located in Corumbá, Mato Grosso do Sul, Brazil. We examined chromosome number, ploidy level, meiotic behavior, microgametogenesis, and pollen viability of 10 accessions. All the accessions were diploid, derived from x = 8, presenting 2n = 2x = 16 chromosomes. Chromosomes paired as bivalents showing, predominantly, two terminal chiasmata. Interstitial chiasmata were rare. Meiosis was quite normal producing only a few abnormal tetrads in some accessions. Microgametogenesis, after two mitotic divisions, produced three-celled pollen grains. Pollen viability was variable among plant and accessions and was not correlated with meiotic abnormalities.

  1. NSR superstring measures in genus 5

    International Nuclear Information System (INIS)

    Dunin-Barkowski, Petr; Sleptsov, Alexey; Stern, Abel


    Currently there are two proposed ansätze for NSR superstring measures: the Grushevsky ansatz and the OPSMY ansatz, which for genera g⩽4 are known to coincide. However, neither the Grushevsky nor the OPSMY ansatz leads to a vanishing two-point function in genus four, which can be constructed from the genus five expressions for the respective ansätze. This is inconsistent with the known properties of superstring amplitudes. In the present paper we show that the Grushevsky and OPSMY ansätze do not coincide in genus five. Then, by combining these ansätze, we propose a new ansatz for genus five, which now leads to a vanishing two-point function in genus four. We also show that one cannot construct an ansatz from the currently known forms in genus 6 that satisfies all known requirements for superstring measures

  2. Chloroplast phylogenomic analyses resolve deep-level relationships of an intractable bamboo tribe Arundinarieae (poaceae). (United States)

    Ma, Peng-Fei; Zhang, Yu-Xiao; Zeng, Chun-Xia; Guo, Zhen-Hua; Li, De-Zhu


    The temperate woody bamboos constitute a distinct tribe Arundinarieae (Poaceae: Bambusoideae) with high species diversity. Estimating phylogenetic relationships among the 11 major lineages of Arundinarieae has been particularly difficult, owing to a possible rapid radiation and the extremely low rate of sequence divergence. Here, we explore the use of chloroplast genome sequencing for phylogenetic inference. We sampled 25 species (22 temperate bamboos and 3 outgroups) for the complete genome representing eight major lineages of Arundinarieae in an attempt to resolve backbone relationships. Phylogenetic analyses of coding versus noncoding sequences, and of different regions of the genome (large single copy and small single copy, and inverted repeat regions) yielded no well-supported contradicting topologies but potential incongruence was found between the coding and noncoding sequences. The use of various data partitioning schemes in analysis of the complete sequences resulted in nearly identical topologies and node support values, although the partitioning schemes were decisively different from each other as to the fit to the data. Our full genomic data set substantially increased resolution along the backbone and provided strong support for most relationships despite the very short internodes and long branches in the tree. The inferred relationships were also robust to potential confounding factors (e.g., long-branch attraction) and received support from independent indels in the genome. We then added taxa from the three Arundinarieae lineages that were not included in the full-genome data set; each of these were sampled for more than 50% genome sequences. The resulting trees not only corroborated the reconstructed deep-level relationships but also largely resolved the phylogenetic placements of these three additional lineages. Furthermore, adding 129 additional taxa sampled for only eight chloroplast loci to the combined data set yielded almost identical

  3. The genus Retiboletus in China. (United States)

    Zeng, Nian-Kai; Liang, Zhi-Qun; Wu, Gang; Li, Yan-Chun; Yang, Zhu L; Liang, Zhi-Qun


    Species of the genus Retiboletus (Boletaceae, Boletales) in China are investigated based on morphology and phylogenetic analyses of DNA sequences from nuc rDNA internal transcribed spacer (ITS) and partial 28S regions and sequences from the translation elongation factor 1-a gene (tef1a). Six lineages are recovered among the collections studied. Five of these are documented and presented in the present paper, including three new species and two new combinations. The remaining species is not described due to the paucity of material. The specimens from China identified as "R. ornatipes" or "R. retipes" are in fact R. sinensis or R. kauffmanii, those labeled "R. griseus" are either R. fuscus or R. pseudogriseus A key to all known taxa of the genus is provided. Phylogenetic relationships of taxa within Retiboletus are partially resolved. A preliminary biogeographical analysis shows that allied species of Retiboletus between eastern Asia and North/Central America are common but there are no Retiboletus species common to both continents. Species of Retiboletus in Japan and southern China are conspecific or closely related. © 2016 by The Mycological Society of America.

  4. Disentangling the effects of feedback structure and climate on Poaceae annual airborne pollen fluctuations and the possible consequences of climate change. (United States)

    García de León, David; García-Mozo, Herminia; Galán, Carmen; Alcázar, Purificación; Lima, Mauricio; González-Andújar, José L


    Pollen allergies are the most common form of respiratory allergic disease in Europe. Most studies have emphasized the role of environmental processes, as the drivers of airborne pollen fluctuations, implicitly considering pollen production as a random walk. This work shows that internal self-regulating processes of the plants (negative feedback) should be included in pollen dynamic systems in order to give a better explanation of the observed pollen temporal patterns. This article proposes a novel methodological approach based on dynamic systems to investigate the interaction between feedback structure of plant populations and climate in shaping long-term airborne Poaceae pollen fluctuations and to quantify the effects of climate change on future airborne pollen concentrations. Long-term historical airborne Poaceae pollen data (30 years) from Cordoba city (Southern Spain) were analyzed. A set of models, combining feedback structure, temperature and actual evapotranspiration effects on airborne Poaceae pollen were built and compared, using a model selection approach. Our results highlight the importance of first-order negative feedback and mean annual maximum temperature in driving airborne Poaceae pollen dynamics. The best model was used to predict the effects of climate change under two standardized scenarios representing contrasting temporal patterns of economic development and CO2 emissions. Our results predict an increase in pollen levels in southern Spain by 2070 ranging from 28.5% to 44.3%. The findings from this study provide a greater understanding of airborne pollen dynamics and how climate change might impact the future evolution of airborne Poaceae pollen concentrations and thus the future evolution of related pollen allergies. Copyright © 2015 Elsevier B.V. All rights reserved.

  5. 2+1 gravity for genus >1

    International Nuclear Information System (INIS)

    Nelson, J.E.; Regge, T.


    We analysed the algebra of observables for the simple case of a genus 1 initial data surface Σ 2 for 2+1 De Sitter gravity. Here we extend the analysis to higher genus. We construct for genus 2 the group of automorphisms H of the homotopy group π 1 induced by the mapping class group. The group H induces a group D of canonical transformations on the algebra of observables which is related to the braid group for 6 threads. (orig.)

  6. The genus Lolium : taxonomy and genetic resources


    Loos, B.P.


    Several aspects of variation within the genus Lolium, and more in detail within Lolium perenne (perennial ryegrass) have been highlighted. As the results are extensively discussed in each chapter, the general discussion is focused on two aspects of the research.

    It is clear that the genus Lolium is a very variable genus. The variation within the species reduces the clarity o...

  7. Aspidonepsis (Asclepiadaceae, a new southern African genus

    Directory of Open Access Journals (Sweden)

    A. Nicholas


    Full Text Available Aspidonepsis, an endemic southern African genus, is described and compared to the closely allied genus Aspidoglossum. This newly described genus is composed of two subgenera, Aspidonepsis and Unguilobium. consisting of three and two species respectively.  Asclepias diploglossa, A. flava, A. cognata and A. reneensis are transferred to Aspidonepsis. and A. shebae is newly described. All species are discussed, illustrated and a key is given to aid in their identification.


    Directory of Open Access Journals (Sweden)



    Full Text Available 1. The present notes on Teijsmanniodendron are based on a study of the spec- imens from Herbarium Bogoriense and the Herbarium of the Singapore Botanic Garden. 2. The taxonomic value of the principal characters and their variation are discussed. Each of the species recognized is annotated. 3. A delimitation and subdivision of the genus in two sections,  Plurifoliolatae Kosterm.  and 'Unifoliolatae Kosterm  is proposed. 4. A key to the 12 species and 1 variety distinguished, is included. 5. One new species is provisionally described (but not named, and one new variety, Teijsmanniodendron pteropodum var. auriculatum Kosterm, is published. 6. The following new combinations are made: Teijsmanniodendron coriaceum B. Clarke Kosterm,, T. hollrungii (Warb. Kosterm. T. holophyllum (Bak. Kos- term, T.novoguineense (Kan. & Hatus. Kosterm., T. sarawakanum (H. H. W. Pears. Kosterm., T. smilacifolium (H. H. W. Pears. Kosterm., and T. subspieatum (Hallier f. Kosterm. 7. The genus Xerocarpa H. 3. Lam (non Spach is rejected; its only species, X. avicenniaefoliola H. J. Lam, is referred to Teijsmanniodendron ahernianum (Merr. Bakh. In addition, the following reductions are made: Teijsmanniodendron mono- phyllum Kurata = T. hollrungii (Warb. Kosterm.; Vitex bankae H. J. Lam = T. ahernianum (Merr. Bakh., V. bogoriensis H. J. Lam = T. ahernianum (Merr. Bakh.; V. koordersii H. J. Lam t= T. pteropodum (Miq. Bakh.; V. tetragona Hallier f. = T. sarawakanum (H. H. W. Pears. Kosterm.; V. venosa H. J. Lam = T. coriaceum (C. B. Clarke Kosterm. Possible identity of T. longifolium (Merr. Merr. and T. bogoriense is suggested: the identity of T. simplicifolium Merr. and T. smilacifolium (H. H-, W. Pears. Kosterm. is indicated as probable. 8. Vitex subspicata Hallier f. and V. holophylla Bak. included by Lam in vitex hollrungii Warb. are reinstated as distinct species of Teijsmanniodendron.

  9. Evolution of the Genus Homo (United States)

    Tattersall, Ian; Schwartz, Jeffrey H.


    Definition of the genus Homo is almost as fraught as the definition of Homo sapiens. We look at the evidence for “early Homo,” finding little morphological basis for extending our genus to any of the 2.5-1.6-myr-old fossil forms assigned to “early Homo” or Homo habilis/rudolfensis. We also point to heterogeneity among “early African Homo erectus,” and the lack of apomorphies linking these fossils to the Asian Homo erectus group, a cohesive regional clade that shows some internal variation, including brain size increase over time. The first truly cosmopolitan Homo species is Homo heidelbergensis, known from Africa, Europe, and China following 600 kyr ago. One species sympatric with it included the >500-kyr-old Sima de los Huesos fossils from Spain, clearly distinct from Homo heidelbergensis and the oldest hominids assignable to the clade additionally containing Homo neanderthalensis. This clade also shows evidence of brain size expansion with time; but although Homo neanderthalensis had a large brain, it left no unequivocal evidence of the symbolic consciousness that makes our species unique. Homo sapiens clearly originated in Africa, where it existed as a physical entity before it began (also in that continent) to show the first stirrings of symbolism. Most likely, the biological underpinnings of symbolic consciousness were exaptively acquired in the radical developmental reorganization that gave rise to the highly characteristic osteological structure of Homo sapiens, but lay fallow for tens of thousands of years before being “discovered” by a cultural stimulus, plausibly the invention of language.

  10. A new species of Otatea (Poaceae: Bambusoideae: Bambuseae) from Querétaro, Mexico


    Ruiz-Sánchez, Eduardo


    Based on recent systematic studies of the genus Otatea, that included an extensive taxonomic investigation of herbaria specimens, and recent fieldwork in the Mexican state of Querétaro, a new Otatea species, O. ramirezii, is here described and illustrated. The new species is endemic to the Sierra Gorda in Querétaro, Mexico. It is compared with Otatea acuminata, O. carrilloi and O. glauca, from which it can be separated by the presence of only one (rarely two) branches per node, erect culm lea...

  11. A taxonomic revision of the genus Podocarpus

    NARCIS (Netherlands)

    Laubenfels, de D.J.


    In connection with the forthcoming revision of the Coniferae for the Flora Malesiana, the author thought it necessary to revise the genus Podocarpus. Although this genus has a substantial representation in Malesia (30 species), the revision is too involved to be appropriate with the Flora Malesiana

  12. Phylogeny of the Peckia-genus group

    DEFF Research Database (Denmark)

    Buenaventura Ruiz, Ingrid Eliana; Pape, Thomas


    Peckia is the most species-rich necrophagous genus among the Neotropical sarcophagids, encompassing 67 species distributed in 5 subgenera. Recent phylogenetic studies have challenged the monophyly of this genus with regard to species of the genera Peckiamyia, Titanogrypa, and Villegasia, and the ...

  13. The elliptic genus and Hidden symmetry

    International Nuclear Information System (INIS)

    Jaffe, A.


    We study the elliptic genus (a partition function) in certain interacting, twist quantum field theories. Without twists, these theories have N=2 supersymmetry. The twists provide a regularization, and also partially break the supersymmetry. In spite of the regularization, one can establish a homotopy of the elliptic genus in a coupling parameter. Our construction relies on a priori estimates and other methods from constructive quantum field theory; this mathematical underpinning allows us to justify evaluating the elliptic genus at one endpoint of the homotopy. We obtain a version of Witten's proposed formula for the elliptic genus in terms of classical theta functions. As a consequence, the elliptic genus has a hidden SL(2,Z) symmetry characteristic of conformal theory, even though the underlying theory is not conformal. (orig.)

  14. Plant Responses to Climate Change: The Case Study of Betulaceae and Poaceae Pollen Seasons (Northern Italy, Vignola, Emilia-Romagna

    Directory of Open Access Journals (Sweden)

    Anna Maria Mercuri


    Full Text Available Aerobiological data have especially demonstrated that there is correlation between climate warming and the pollination season of plants. This paper focuses on airborne pollen monitoring of Betulaceae and Poaceae, two of the main plant groups with anemophilous pollen and allergenic proprieties in Northern Italy. The aim is to investigate plant responses to temperature variations by considering long-term pollen series. The 15-year aerobiological analysis is reported from the monitoring station of Vignola (located near Modena, in the Emilia-Romagna region that had operated in the years 1990–2004 with a Hirst spore trap. The Yearly Pollen Index calculated for these two botanical families has shown contrasting trends in pollen production and release. These trends were well identifiable but fairly variable, depending on both meteorological variables and anthropogenic causes. Based on recent reference literature, we considered that some oscillations in pollen concentration could have been a main effect of temperature variability reflecting global warming. The duration of pollen seasons of Betulaceae and Poaceae, depending on the different species included in each family, has not unequivocally been determined. Phenological responses were particularly evident in Alnus and especially in Corylus as a general moving up of the end of pollination. The study shows that these trees can be affected by global warming more than other, more tolerant, plants. The research can be a contribution to the understanding of phenological plant responses to climate change and suggests that alder and hazelnut trees have to be taken into high consideration as sensible markers of plant responses to climate change.

  15. Plant Responses to Climate Change: The Case Study of Betulaceae and Poaceae Pollen Seasons (Northern Italy, Vignola, Emilia-Romagna) (United States)

    Mercuri, Anna Maria; Torri, Paola; Fornaciari, Rita; Florenzano, Assunta


    Aerobiological data have especially demonstrated that there is correlation between climate warming and the pollination season of plants. This paper focuses on airborne pollen monitoring of Betulaceae and Poaceae, two of the main plant groups with anemophilous pollen and allergenic proprieties in Northern Italy. The aim is to investigate plant responses to temperature variations by considering long-term pollen series. The 15-year aerobiological analysis is reported from the monitoring station of Vignola (located near Modena, in the Emilia-Romagna region) that had operated in the years 1990–2004 with a Hirst spore trap. The Yearly Pollen Index calculated for these two botanical families has shown contrasting trends in pollen production and release. These trends were well identifiable but fairly variable, depending on both meteorological variables and anthropogenic causes. Based on recent reference literature, we considered that some oscillations in pollen concentration could have been a main effect of temperature variability reflecting global warming. The duration of pollen seasons of Betulaceae and Poaceae, depending on the different species included in each family, has not unequivocally been determined. Phenological responses were particularly evident in Alnus and especially in Corylus as a general moving up of the end of pollination. The study shows that these trees can be affected by global warming more than other, more tolerant, plants. The research can be a contribution to the understanding of phenological plant responses to climate change and suggests that alder and hazelnut trees have to be taken into high consideration as sensible markers of plant responses to climate change. PMID:27929423

  16. Global grass (Poaceae) success underpinned by traits facilitating colonization, persistence and habitat transformation. (United States)

    Linder, H P; Lehmann, Caroline E R; Archibald, Sally; Osborne, Colin P; Richardson, David M


    Poaceae (the grasses) is arguably the most successful plant family, in terms of its global occurrence in (almost) all ecosystems with angiosperms, its ecological dominance in many ecosystems, and high species richness. We suggest that the success of grasses is best understood in context of their capacity to colonize, persist, and transform environments (the "Viking syndrome"). This results from combining effective long-distance dispersal, efficacious establishment biology, ecological flexibility, resilience to disturbance and the capacity to modify environments by changing the nature of fire and mammalian herbivory. We identify a diverse set of functional traits linked to dispersal, establishment and competitive abilities. Enhanced long-distance dispersal is determined by anemochory, epizoochory and endozoochory and is facilitated via the spikelet (and especially the awned lemma) which functions as the dispersal unit. Establishment success could be a consequence of the precocious embryo and large starch reserves, which may underpin the extremely short generation times in grasses. Post-establishment genetic bottlenecks may be mitigated by wind pollination and the widespread occurrence of polyploidy, in combination with gametic self-incompatibility. The ecological competitiveness of grasses is corroborated by their dominance across the range of environmental extremes tolerated by angiosperms, facilitated by both C 3 and C 4 photosynthesis, well-developed frost tolerance in several clades, and a sympodial growth form that enabled the evolution of both annual and long-lived life forms. Finally, absence of investment in wood (except in bamboos), and the presence of persistent buds at or below ground level, provides tolerance of repeated defoliation (whether by fire, frost, drought or herbivores). Biotic modification of environments via feedbacks with herbivory or fire reinforce grass dominance leading to open ecosystems. Grasses can be both palatable and productive

  17. Ribosomal DNA variation in finger millet and wild species of Eleusine (Poaceae). (United States)

    Hilu, K W; Johnson, J L


    Finger millet is an important cereal crop in the semi-arid regions of Africa and India. The crop belongs to the grass genus Eleusine, which includes nine annual and perennial species native to Africa except for the New World species E. tristachya. Ribosomal DNA (rDNA) variation in finger millet and related wild species was used to provide information on the origin of the genomes of this tetraploid crop and point out genetic relationships of the crop to other species in the genus. The restriction endonucleases used revealed a lack of variability in the rDNA spacer region in domesticated finger millet. All the rDNA variants of the crop were found in the proposed direct tetraploid ancestor, E. coracana subsp. africana. Wild and domesticated finger millet displayed the phenotypes found in diploid E. indica. Diploid Eleusine tristachya showed some similarity to the crop in some restriction sites. The remaining species were quite distinct in rDNA fragment patterns. The study supports the direct origin of finger millet from subspecies africana shows E. indica to be one of the genome donors of the crop, and demonstrates that none of the other species examined could have donated the second genome of the crop. The rDNA data raise the possibility that wild and domesticated finger millet could have originated as infraspecific polyploid hybrids from different varieties of E. indica.

  18. Beta genus papillomaviruses and skin cancer. (United States)

    Howley, Peter M; Pfister, Herbert J


    A role for the beta genus HPVs in keratinocyte carcinoma (KC) remains to be established. In this article we examine the potential role of the beta HPVs in cancer revealed by the epidemiology associating these viruses with KC and supported by oncogenic properties of the beta HPV proteins. Unlike the cancer associated alpha genus HPVs, in which transcriptionally active viral genomes are invariably found associated with the cancers, that is not the case for the beta genus HPVs and keratinocyte carcinomas. Thus a role for the beta HPVs in KC would necessarily be in the carcinogenesis initiation and not in the maintenance of the tumor. Copyright © 2015 Elsevier Inc. All rights reserved.

  19. Leaf anatomy of the South African Danthonieae (Poaceae. XIII. Pentameris macrocalycina and P. obtusifolia

    Directory of Open Access Journals (Sweden)

    R. P. Ellis


    Full Text Available The leaf blade anatomy of Peniameris macrocalycina (Steud. Schweick. and P. obtusifolia (Hochst, Schweick. is described and illustrated. The leaf anatomy of these two species shows many similarities suggesting a close relationship between them. A slight problem appears to exist with the circumscription of P. obtusifolia and a minor taxonomic adjustment may result in a classification which agrees totally with that based on leaf anatomy. This would result in details of the leaf outline being diagnostic for these two taxa. The nomenclature of P. obtusifolia is also very confusing and clarification is needed by reference to the relevant type specimens. P. macrocalycina and P. obtusifolia together with  P. longiglumis (Nees Stapf, appear to form a distinct genus and do not bear close anatomical resemblances to either P. thuarri Beauv. or P. dregeana Stapf.

  20. Ribosomal DNA in diploid and polyploid Setaria (Poaceae) species: number and distribution (United States)

    Nani, Thaís Furtado; Cenzi, Gisele; Pereira, Daniele Lais; Davide, Lisete Chamma; Techio, Vânia Helena


    Abstract Setaria Beauvois, 1812 is a genus of economically important forage species, including Setaria italica (Linnaeus, 1753) Beauvois, 1812 and Setaria viridis (Linnaeus, 1753) Beauvois, 1812, closely related species and considered as model systems for studies of C4 plants. However, complications and uncertainties related to taxonomy of other species of the genus are frequent due to the existence of numerous synonyms for the same species or multiple species with the same name, and overlapping of morphological characteristics. Cytogenetic studies in Setaria can be useful for taxonomic and evolutionary studies as well as for applications in breeding. Thus, this study is aimed at locating 45S and 5S rDNA sites through fluorescent in situ hybridization (FISH) in Setaria italica, Setaria viridis and Setaria sphacelata (Schumacher, 1827) Stapf, Hubbard, Moss, 1929 cultivars (cvs.) Narok and Nandi. Setaria italica and Setaria viridis have 18 chromosomes with karyotype formulas 6m + 3sm and 9m, respectively. The location of 45S and 5S rDNA for these species was in different chromosome pairs among the evaluated species. Setaria viridis presented a more symmetrical karyotype, strengthening the ancestral relationship with Setaria italica. Setaria sphacelata cvs. Narok and Nandi have 36 chromosomes, and karyotype formulas 11m+7sm and 16m+2sm, respectively. The 45S rDNA signals for both cultivars were also observed in distinct chromosome pairs; however chromosomes bearing 5S rDNA are conserved. Karyotypic variations found among the studied species are evidence of chromosomal rearrangements. PMID:26753080

  1. Anti-methicillin-resistant Staphylococcus aureus (MRSA) activity of Rubiaceae, Fabaceae and Poaceae plants: A search for new sources of useful alternative antibacterials against MRSA infections. (United States)

    Sharifi-Rad, M; Iriti, M; Sharifi-Rad, M; Gibbons, S; Sharifi-Rad, J


    In this study, we evaluated the effects of the extracts of the leaves of species from the Rubiaceae (Galium aparine L. and Asperula arvensis L.), Fabaceae (Lathyrus aphaca L. and Vicia narbonensis L.) and Poaceae (Digitaria sanguinalis (L.) Scop. and Hordeum murinum L.) plant families on a wide and extensive panel of isolated methicillin-resistant Staphylococcus aureus strains (MRSA). The effects of the methanolic leaf extracts of Rubiaceae, Fabaceae and Poaceae plants on MRSA were evaluated by the disc diffusion assay and the broth dilution method. Among a total of 177 S. aureus isolates, 92 (51.97%) were found to be methicillin-resistant in an antibiogram and this was confirmed by the presence of the mecA gene in polymerase chain reaction method. All MRSA isolates were sensitive to all extracts. There were dose-dependent inhibitions on tested microorganisms for all plant extracts which showed maximum inhibition zones at a concentration of 300 mg/L. L. aphaca, G. aparine and H. murinum exhibited the highest antibacterial activity on the MRSA strains compared to the positive control (P Fabaceae), G. aparine (Rubiaceae), and H. murinum (Poaceae) proved to have high antibacterial activity on MRSA isolates, thus representing promising antimicrobial agents in clinical settings.

  2. Evaluating sampling strategy for DNA barcoding study of coastal and inland halo-tolerant Poaceae and Chenopodiaceae: A case study for increased sample size. (United States)

    Yao, Peng-Cheng; Gao, Hai-Yan; Wei, Ya-Nan; Zhang, Jian-Hang; Chen, Xiao-Yong; Li, Hong-Qing


    Environmental conditions in coastal salt marsh habitats have led to the development of specialist genetic adaptations. We evaluated six DNA barcode loci of the 53 species of Poaceae and 15 species of Chenopodiaceae from China's coastal salt marsh area and inland area. Our results indicate that the optimum DNA barcode was ITS for coastal salt-tolerant Poaceae and matK for the Chenopodiaceae. Sampling strategies for ten common species of Poaceae and Chenopodiaceae were analyzed according to optimum barcode. We found that by increasing the number of samples collected from the coastal salt marsh area on the basis of inland samples, the number of haplotypes of Arundinella hirta, Digitaria ciliaris, Eleusine indica, Imperata cylindrica, Setaria viridis, and Chenopodium glaucum increased, with a principal coordinate plot clearly showing increased distribution points. The results of a Mann-Whitney test showed that for Digitaria ciliaris, Eleusine indica, Imperata cylindrica, and Setaria viridis, the distribution of intraspecific genetic distances was significantly different when samples from the coastal salt marsh area were included (P Imperata cylindrica and Chenopodium album, average intraspecific distance tended to reach stability. These results indicate that the sample size for DNA barcode of globally distributed species should be increased to 11-15.

  3. Ecological niche differentiation of polyploidization is not supported by environmental differences among species in a cosmopolitan grass genus. (United States)

    Visser, Vernon; Molofsky, Jane


    • Polyploidization frequently results in the creation of new plant species, the establishment of which is thought to often be facilitated by ecological niche differentiation from the diploid species. We tested this hypothesis using the cosmopolitan grass genus Phalaris (Poaceae), consisting of 19 species that range from diploid to tetraploid to hexaploid. Specifically, we tested whether (1) polyploids occupy more extreme environments and/or (2) have broader niche breadths and/or (3) whether the polyploid species' distributions indicate a niche shift from diploid species.• We employed a bootstrapping approach using distribution data for each species and eight environmental variables to investigate differences between species in the means, extremes, and breadths of each environmental variable. We used a kernel smoothing technique to quantify niche overlap between species.• Although we found some support for the three hypotheses for a few diploid-polyploid pairs and for specific environmental variables, none of these hypotheses were generally supported.• Our results suggest that these commonly held hypotheses about the effects of polyploidization on ecological distributions are not universally applicable. Correlative biogeographic studies like ours provide a necessary first step for suggesting specific hypotheses that require experimental verification. A combination of genetic, physiological, and ecological studies will be required to achieve a better understanding of the role of polyploidization in niche evolution. © 2015 Botanical Society of America, Inc.

  4. Genus Pouteria: chemistry and biological activity

    Directory of Open Access Journals (Sweden)

    Cíntia A. M. Silva

    Full Text Available The genus Pouteria belongs to the family Sapotaceae and can be widely found around the World. These plants have been used as building material, as food, because the eatable fruits, as well as remedies in folk medicine. Some biological activities have been reported to species of this genus such as antioxidant, anti-inflammatory, antibacterial and antifungal. However, the real potential of this genus as source of new drugs or phytomedicines remains unknown. Therefore, a review of the so far known chemical composition and biological activities of this genus is presented to stimulate new studies about the species already reported moreover that species have no reference about chemistry or biological activities could be found until now.

  5. Genomic Diversity in the Genus of Aspergillus

    DEFF Research Database (Denmark)

    Rasmussen, Jane Lind Nybo

    , sections and genus of Aspergillus. The work uncovers a large genomic diversity across all studied groups of species. The genomic diversity was especially evident on the section level, where the proteins shared by all species only represents ⇠55% of the proteome. This number decreases even further, to 38......, sections Nigri, Usti and Cavericolus, clade Tubingensis, and species A. niger. It lastly uses these results to predict genetic traits that take part in fungal speciation. Within a few years the Aspergillus whole-genus sequencing project will have published all currently-accepted Aspergillus genomes......Aspergillus is a highly important genus of saprotrophic filamentous fungi. It is a very diverse genus that is inextricably intertwined with human a↵airs on a daily basis, holding species relevant to plant and human pathology, enzyme and bulk chemistry production, food and beverage biotechnology...

  6. Infinite genus surfaces and irrational polygonal billiards


    Valdez, Ferrán


    We prove that the natural invariant surface associated with the billiard game on an irrational polygonal table is homeomorphic to the Loch Ness monster, that is, the only orientable infinite genus topological real surface with exactly one end.

  7. Phylogeny and taxonomy of the genus Gliocephalotrichum

    NARCIS (Netherlands)

    Lombard, L.; Serrato-Diaz, L.M.; Cheewangkoon, R.; French-Monar, R.D.; Decock, C.; Crous, P.W.


    Species in the genus Gliocephalotrichum (= Leuconectria) (Hypocreales, Nectriaceae) are soilborne fungi, associated with post-harvest fruit spoilage of several important tropical fruit crops. Contemporary taxonomic studies of these fungi have relied on morphology and DNA sequence comparisons of the

  8. Phylogeny and taxonomy of the genus Gliocephalotrichum

    NARCIS (Netherlands)

    Lombard, L.; Serrato-Diaz, L. M.; Cheewangkoon, R.; French-Monar, R. D.; Decock, C.; Crous, P. W.

    Species in the genus Gliocephalotrichum (= Leuconectria) (Hypocreales, Nectriaceae) are soilborne fungi, associated with post-harvest fruit spoilage of several important tropical fruit crops. Contemporary taxonomic studies of these fungi have relied on morphology and DNA sequence comparisons of the

  9. Generalized regular genus for manifolds with boundary

    Directory of Open Access Journals (Sweden)

    Paola Cristofori


    Full Text Available We introduce a generalization of the regular genus, a combinatorial invariant of PL manifolds ([10], which is proved to be strictly related, in dimension three, to generalized Heegaard splittings defined in [12].

  10. Kops genus - en værkstedsrapport

    DEFF Research Database (Denmark)

    Gudiksen, Asgerd


     Inden for Ømålsområdet optræder ordet kop både i genus femininum, masku­linum og neutrum. På Sjælland, hvor trekønssystemet er under af­vikling, kan ordet desuden være genus commune. Der kan konstateres en vis dialektgeografisk fordeling af de tre (fire) genera, men især på Sjælland er...

  11. A taxonomic revision of the genus Podocarpus


    Laubenfels, de, D.J.


    In connection with the forthcoming revision of the Coniferae for the Flora Malesiana, the author thought it necessary to revise the genus Podocarpus. Although this genus has a substantial representation in Malesia (30 species), the revision is too involved to be appropriate with the Flora Malesiana per se. One new subgenus and 17 new sections are described, and 94 species are enumerated, of which 11 species and 1 variety are described as new, and 3 varieties have been raised to specific rank....

  12. Anther and pollen development in some species of Poaceae (Poales Desenvolvimento da antera e do grão de pólen em espécies de Poaceae (Poales

    Directory of Open Access Journals (Sweden)

    AT. Nakamura


    Full Text Available Anther and pollen development were studied in Olyra humilis Nees, Sucrea monophylla Soderstr, (Bambusoideae, Axonopus aureus P. Beauv., Paspalum polyphyllum Nees ex Trin. (Panicoideae, Eragrostis solida Nees, and Chloris elata Desv. (Chloridoideae. The objective of this study was to characterise, embryologically, these species of subfamilies which are considered basal, intermediate and derivate, respectively. The species are similar to each other and to other Poaceae. They present the following characters: tetrasporangiate anthers; monocotyledonous-type anther wall development, endothecium showing annular thickenings, secretory tapetum; successive microsporogenesis; isobilateral tetrads; spheroidal, tricellular, monoporate pollen grains with annulus and operculum. Nevertheless, the exine patterns of the species studied are distinct. Olyra humilis and Sucrea monophylla (Bambusoideae show a granulose pattern, whereas in the other species, it is insular. In addition, Axonopus aureus and Paspalum polyphyllum (Panicoideae have a compactly insular spinule pattern, while Chloris elata and Eragrostis solida (Chloridoideae show a sparsely insular spinule pattern. The exine ornamentation may be considered an important feature at the infrafamiliar level.O desenvolvimento da antera e do grão de pólen de Olyra humilis Nees, Sucrea monophylla Soderstr. (Bambusoideae, Axonopus aureus P. Beauv., Paspalum polyphyllum Nees ex Trin. (Panicoideae, Eragrostis solida Nees and Chloris elata Desv. (Chloridoideae foi estudado visando caracterizar embriologicamente essas espécies de subfamílias consideradas basal, intermediária e derivada, respectivamente. As espécies são similares entre si e entre as demais Poaceae. Apresentam os seguintes caracteres: anteras tetrasporangiadas; desenvolvimento da parede da antera do tipo monocotiledôneo, endotécio com espessamento de parede anelar, tapete secretor; microsporogênese sucessiva; tétrades isobilaterais; grãos de

  13. Ultraestructura del bambú Guadua macclurei (Poaceae: Bambusoideae de Costa Rica

    Directory of Open Access Journals (Sweden)

    Mayra Montiel


    Full Text Available Se evaluaron ultraestructuralmente secciones de la lámina de la hoja, vaina de la hoja y rama, de una planta adulta de Guadua macclurei. Las brácteas del culmo carecen de setas orales. En la superficie adaxial de la lámina foliar se observó un patrón celular diferente al de otras especies de este género. Además, hay tricomas tricelulares y bandas de estomas de alto domo muy ordenadas y evidentes, característica que la podría diferenciar de otras especies en el género. Esta es la primera descripción microscópica de esta especie.We studied the ultrastructure of sections of leaf lamina, leaf sheath and branches of an adult plant of Guadua macclurei. Culm sheaths lack fimbriae (oral setae. The adaxial section of the leaf lamina has a particular cellular pattern, previously unreported in this genus. The tricellular trichomes, and the evident and ordered bands of high dome stomata may be useful for taxonomic purposes. To the best of our knowledge, this is the first microscopic description of this species. Rev. Biol. Trop. 54(Suppl. 2: 35-42. Epub 2006 Dec. 01.

  14. Genomic diversity within the haloalkaliphilic genus Thioalkalivibrio. (United States)

    Ahn, Anne-Catherine; Meier-Kolthoff, Jan P; Overmars, Lex; Richter, Michael; Woyke, Tanja; Sorokin, Dimitry Y; Muyzer, Gerard


    Thioalkalivibrio is a genus of obligate chemolithoautotrophic haloalkaliphilic sulfur-oxidizing bacteria. Their habitat are soda lakes which are dual extreme environments with a pH range from 9.5 to 11 and salt concentrations up to saturation. More than 100 strains of this genus have been isolated from various soda lakes all over the world, but only ten species have been effectively described yet. Therefore, the assignment of the remaining strains to either existing or novel species is important and will further elucidate their genomic diversity as well as give a better general understanding of this genus. Recently, the genomes of 76 Thioalkalivibrio strains were sequenced. On these, we applied different methods including (i) 16S rRNA gene sequence analysis, (ii) Multilocus Sequence Analysis (MLSA) based on eight housekeeping genes, (iii) Average Nucleotide Identity based on BLAST (ANIb) and MUMmer (ANIm), (iv) Tetranucleotide frequency correlation coefficients (TETRA), (v) digital DNA:DNA hybridization (dDDH) as well as (vi) nucleotide- and amino acid-based Genome BLAST Distance Phylogeny (GBDP) analyses. We detected a high genomic diversity by revealing 15 new "genomic" species and 16 new "genomic" subspecies in addition to the ten already described species. Phylogenetic and phylogenomic analyses showed that the genus is not monophyletic, because four strains were clearly separated from the other Thioalkalivibrio by type strains from other genera. Therefore, it is recommended to classify the latter group as a novel genus. The biogeographic distribution of Thioalkalivibrio suggested that the different "genomic" species can be classified as candidate disjunct or candidate endemic species. This study is a detailed genome-based classification and identification of members within the genus Thioalkalivibrio. However, future phenotypical and chemotaxonomical studies will be needed for a full species description of this genus.

  15. The genus Isodon (Schrad. ex Benth. Spach in Africa and a new genus Rabdosiella Codd (Lamiaceae

    Directory of Open Access Journals (Sweden)

    L. E. Codd


    Full Text Available The typification of the genus Isodon (Schrad. ex Benth. Spach and its occurrence in Africa are discussed; an allied genus Rabdosiella Codd is described and the combinations R. calycina (Benth. Codd and R. ternifolia (D.Don Codd (the latter an Indian species are effected.

  16. Identification and nomenclature of the genus Penicillium. (United States)

    Visagie, C M; Houbraken, J; Frisvad, J C; Hong, S-B; Klaassen, C H W; Perrone, G; Seifert, K A; Varga, J; Yaguchi, T; Samson, R A


    Penicillium is a diverse genus occurring worldwide and its species play important roles as decomposers of organic materials and cause destructive rots in the food industry where they produce a wide range of mycotoxins. Other species are considered enzyme factories or are common indoor air allergens. Although DNA sequences are essential for robust identification of Penicillium species, there is currently no comprehensive, verified reference database for the genus. To coincide with the move to one fungus one name in the International Code of Nomenclature for algae, fungi and plants, the generic concept of Penicillium was re-defined to accommodate species from other genera, such as Chromocleista, Eladia, Eupenicillium, Torulomyces and Thysanophora, which together comprise a large monophyletic clade. As a result of this, and the many new species described in recent years, it was necessary to update the list of accepted species in Penicillium. The genus currently contains 354 accepted species, including new combinations for Aspergillus crystallinus, A. malodoratus and A. paradoxus, which belong to Penicillium section Paradoxa. To add to the taxonomic value of the list, we also provide information on each accepted species MycoBank number, living ex-type strains and provide GenBank accession numbers to ITS, β-tubulin, calmodulin and RPB2 sequences, thereby supplying a verified set of sequences for each species of the genus. In addition to the nomenclatural list, we recommend a standard working method for species descriptions and identifications to be adopted by laboratories working on this genus.

  17. Anatomía ecológica de algunas especies del género Paspalum (Poaceae, Panicoideae, Paniceae

    Directory of Open Access Journals (Sweden)

    Sandra S. Aliscioni


    Full Text Available Aliscioni, S. S. 2000. Anatomía ecológica de algunas especies del género Paspalum(Poaceae, Panicoideae, Paniceae. Darwiniana 38(3-4: 187-207.El género Paspalum L. presenta un elevado número de especies, con una amplia variabilidadmorfológica y una extensa distribución geográfica. Sus especies crecen en hábitats sumamente diversos,desde ambientes muy húmedos o acuáticos, a lugares secos de suelos arcillosos o arenosos, muchas vecessalinos. Dada la diversidad de ambientes en los que puede hallarse Paspalum, se estudiaron lascaracterísticas anatómico-foliares presentes en el género con la finalidad de interpretar diferentesestrategias adaptativas en distintas especies. Se presenta una descripción general de la anatomía foliar delgénero y se discuten ciertos caracteres anatómicos, interpretando su posible relación con las condicionesdel hábitat

  18. Black Rice (Oryza sativa L., Poaceae) Extract Reduces Hippocampal Neuronal Cell Death Induced by Transient Global Cerebral Ischemia in Mice. (United States)

    Hwang, Sun-Nyoung; Kim, Jae-Cheon; Bhuiyan, Mohammad Iqbal Hossain; Kim, Joo Youn; Yang, Ji Seon; Yoon, Shin Hee; Yoon, Kee Dong; Kim, Seong Yun


    Rice is the most commonly consumed grain in the world. Black rice has been suggested to contain various bioactive compounds including anthocyanin antioxidants. There is currently little information about the nutritional benefits of black rice on brain pathology. Here, we investigated the effects of black rice ( Oryza sativa L ., Poaceae) extract (BRE) on the hippocampal neuronal damage induced by ischemic insult. BRE (300 mg/kg) was orally administered to adult male C57BL/6 mice once a day for 21 days. Bilateral common carotid artery occlusion (BCCAO) was performed for 23 min on the 8th day of BRE or vehicle administration. Histological analyses conducted on the 22nd day of BRE or vehicle administration revealed that administering BRE profoundly attenuated neuronal cell death, inhibited reactive astrogliosis, and prevented loss of glutathione peroxidase expression in the hippocampus when compared to vehicle treatment. In addition, BRE considerably ameliorated BCCAO-induced memory impairment on the Morris water maze test from the 15th day to the 22nd day of BRE or vehicle administration. These results indicate that chronic administration of BRE is potentially beneficial in cerebral ischemia.

  19. Cytomorphological studies in some members of tribe Paniceae (Poaceae) from district Kangra of Himachal Pradesh (Western Himalayas). (United States)

    Kaur, H; Kumari, S; Gupta, R C


    The present paper deals with cytological studies on the population basis of 21 species belonging to 9 genera of tribe Paniceae of family Poaceae from cytologically unexplored area of Western Himalayas i.e. district Kangra of Himachal Pradesh for the assessment of genetic diversity of grass flora. On world-wide basis, the chromosome counts have been made for the first time for three species such as Brachiaria remota (n = 16), Digitaria granularis (n = 36) and Isachne albens (n = 5). Similarly, on India basis, altogether new records are made for two species such as Echinochloa cruspavonis (n = 27) and Paspalum distichum (2n = 50). A comparison of the different euploid cytotypes studied at present for Digitaria adscendens, D. setigera and Oplismenus compositus revealed significant variations in their morphology, depicting increase in some of the characters of polyploid cytotypes. The course of meiosis has been observed to be normal in all the studied populations with high pollen fertility except for two species such as Paspalum dilatatum and P. distichum marked with abnormal meiosis and reduced pollen fertility.

  20. Molecular analysis of the genera eremopyrum (ledeb). jaub. and spach and agropyron gaertner (poaceae) by pcr methods

    International Nuclear Information System (INIS)

    Yilmaz, R.; Cabi, E.; Dogan, M.


    RAPD-PCR (Random Amplified Polymorphic DNA Polymerase Chain Reaction) and Post PCR (Polymerase Chain Reaction) Melting Curve Analysis (MCA) have been used to investigate the pattern of genetic variation among some species in the genera Eremopyrum (Ledeb.) Jaub. and Spach and Agropyron Gaertner (Poaceae). Thirteen primers have been used in the study based on the RAPD-PCR and MCA analyses. Each species produced a distinct pattern of DNA fragments which have been used as a measure of the degree of relationship between species by means of using the RAPD-PCR results with three primers selected for identifying the genetic similarities. Polymorphic melting profiles have been obtained with Post PCR MCA method using three primers. Genetic similarities are calculated for all the species studied with RAPD-PCR and MCA methods, the dendrograms are obtained with the MVSP (Multi Variate Statistical Package) software using UPGMA (Unweighted Pair Group Method with Arithmetic Averages) and Jaccard's Coefficient. Polymorphism between 18 populations of Eremopyrum and 6 Agropyron populations and within the species are determined by using RAPD-PCR and Post PCR melting curve analysis (MCA) respectively. (author)

  1. Chemical composition and cardiovascular effects induced by the essential oil of Cymbopogon citratus DC. Stapf, Poaceae, in rats

    Directory of Open Access Journals (Sweden)

    Flávia V. Moreira


    Full Text Available Cymbopogon citratus DC. Stapf, Poaceae, is used in the folk medicine for hypertension treatment. This work investigated the chemical composition and cardiovascular effects in rats of C. citratus essential oil (EOCC. A phytochemical screening demonstrated the presence of eight constituents, being geranial the major compound (43.08%. In rats, EOCC (1, 5, 10, and 20 mg/kg, i.v. induced transient hypotension and bradycardia that were attenuated by atropine and sodium thiopental, but not by L-NAME or indomethacin. In rings of rat superior mesenteric artery pre-contracted with phenylephrine, EOCC (1 to 3000 µg/mL induced relaxation that was not affected after removal of the endothelium, after TEA or in rings pre-contracted with KCl (80 mM. Furthermore, EOCC (1000 µg/mL was not able to induce additional effect on maximal relaxation of nifedipine (10 µM. In conclusions, EOCC induces hypotension, possibly by reduction in vascular resistance caused by inhibition of the Ca2+ influx, and bradycardia probably due to an activation of cardiac muscarinic receptors.

  2. Karyotype characterization and comparison of three hexaploid species of Bromus Linnaeus, 1753 (Poaceae

    Directory of Open Access Journals (Sweden)

    Leonardo Luís Artico


    Full Text Available Chromosome morphometry and nuclear DNA content are useful data for cytotaxonomy and to understand the evolutionary history of different taxa. For the genus Bromus Linnaeus, 1753, distinct ploidy levels have been reported, occurring from diploid to duodecaploid species. The geographic distribution of Bromus species has been correlated with chromosome number and ploidy level. In this study, the aims were to determine the nuclear genome size and characterize the karyotype of the South American Bromus species: Bromus auleticus Trinius ex Nees, 1829, Bromus brachyanthera Döll, 1878 and Bromus catharticus Vahl, 1791. The mean nuclear 2C value ranged from 2C = 12.64 pg for B. catharticus to 2C = 17.92 pg for B. auleticus, meaning a maximum variation of 2C = 5.28 pg, equivalent to 41.70%. Despite this significant difference in 2C value, the three species exhibit the same chromosome number, 2n = 6x = 42, which confirms their hexaploid origin. Corroborating the genome size, the chromosome morphometry (total, short- and long-arm length and, consequently, the class differed among the karyotypes of the species. Based on the first karyograms for these Bromus species, some morphologically similar and several distinct chromosome pairs were found. Therefore, the karyotype characterization confirmed the hexaploid origin of the studied Bromus species, which differ in relation to the karyogram and the nuclear 2C value. Considering this, cytogenetics and flow cytometry can be used to discriminate Bromus species, contributing to taxonomy and systematic studies and providing information on the evolutionary history of this taxa.

  3. Karyotype characterization and comparison of three hexaploid species of Bromus Linnaeus, 1753 (Poaceae). (United States)

    Artico, Leonardo Luís; Mazzocato, Ana Cristina; Ferreira, Juliano Lino; Carvalho, Carlos Roberto; Clarindo, Wellington Ronildo


    Chromosome morphometry and nuclear DNA content are useful data for cytotaxonomy and to understand the evolutionary history of different taxa. For the genus Bromus Linnaeus, 1753, distinct ploidy levels have been reported, occurring from diploid to duodecaploid species. The geographic distribution of Bromus species has been correlated with chromosome number and ploidy level. In this study, the aims were to determine the nuclear genome size and characterize the karyotype of the South American Bromus species: Bromus auleticus Trinius ex Nees, 1829, Bromus brachyanthera Döll, 1878 and Bromus catharticus Vahl, 1791. The mean nuclear 2C value ranged from 2C = 12.64 pg for B. catharticus to 2C = 17.92 pg for B. auleticus , meaning a maximum variation of 2C = 5.28 pg, equivalent to 41.70%. Despite this significant difference in 2C value, the three species exhibit the same chromosome number, 2n = 6x = 42, which confirms their hexaploid origin. Corroborating the genome size, the chromosome morphometry (total, short- and long-arm length) and, consequently, the class differed among the karyotypes of the species. Based on the first karyograms for these Bromus species, some morphologically similar and several distinct chromosome pairs were found. Therefore, the karyotype characterization confirmed the hexaploid origin of the studied Bromus species, which differ in relation to the karyogram and the nuclear 2C value. Considering this, cytogenetics and flow cytometry can be used to discriminate Bromus species, contributing to taxonomy and systematic studies and providing information on the evolutionary history of this taxa.

  4. Identification and nomenclature of the genus Penicillium

    DEFF Research Database (Denmark)

    Visagie, C.M.; Houbraken, J.; Frisvad, Jens Christian


    Penicillium is a diverse genus occurring worldwide and its species play important roles as decomposers of organic materials and cause destructive rots in the food industry where they produce a wide range of mycotoxins. Other species are considered enzyme factories or are common indoor air allergens....... Although DNA sequences are essential for robust identification of Penicillium species, there is currently no comprehensive, verified reference database for the genus. To coincide with the move to one fungus one name in the International Code of Nomenclature for algae, fungi and plants, the generic concept...... of accepted species in Penicillium. The genus currently contains 354 accepted species, including new combinations for Aspergillus crystallinus, A. malodoratus and A. paradoxus, which belong to Penicillium section Paradoxa. To add to the taxonomic value of the list, we also provide information on each accepted...

  5. The genus curve of the Abell clusters (United States)

    Rhoads, James E.; Gott, J. Richard, III; Postman, Marc


    We study the topology of large-scale structure through a genus curve measurement of the recent Abell catalog redshift survey of Postman, Huchra, and Geller (1992). The structure is found to be spongelike near median density and to exhibit isolated superclusters and voids at high and low densities, respectively. The genus curve shows a slight shift toward 'meatball' topology, but remains consistent with the hypothesis of Gaussian random phase initial conditions. The amplitude of the genus curve corresponds to a power-law spectrum with index n = 0.21-0.47+0.43 on scales of 48/h Mpc or to a cold dark matter power spectrum with omega h = 0.36-0.17+0.46.

  6. The genus curve of the Abell clusters (United States)

    Rhoads, James E.; Gott, J. Richard, III; Postman, Marc


    We study the topology of large-scale structure through a genus curve measurement of the recent Abell catalog redshift survey of Postman, Huchra, and Geller (1992). The structure is found to be spongelike near median density and to exhibit isolated superclusters and voids at high and low densities, respectively. The genus curve shows a slight shift toward 'meatball' topology, but remains consistent with the hypothesis of Gaussian random phase initial conditions. The amplitude of the genus curve corresponds to a power-law spectrum with index n = 0.21(sub -0.47 sup +0.43) on scales of 48/h Mpc or to a cold dark matter power spectrum with omega h = 0.36(sub -0.17 sup +0.46).

  7. Therapeutic value of the genus Alpinia, Zingiberaceae

    Directory of Open Access Journals (Sweden)

    Cristiane P. Victório


    Full Text Available Plants containing bioactive substances have increasingly become the object of research studies, particularly those plants with therapeutic value. Many species of the genus Alpinia provide a variety of medicinal properties, such as, Alpinia zerumbet (Pers. Burtt et Smith and A. purpurata (Vieill K. Schum, which have a significant presence in Brazil. These species have been commercialized in the food and cosmetic industries. However, their greatest importance arises from the medicinal properties of their essential oils containing flavonoids, terpenoids and kavalactones which have been used in folk medicine to treat, for example, arterial hypertension and inflammatory processes. In addition, such species are also used in multidisciplinary studies, including phytochemistry, ethnobotany and biology, indicating the key pharmacological role of this genus in everyday life. Therefore, this work aims to present a bibliographic review of the genus Alpinia and its significance in therapeutic applications.

  8. Notes on the genus Punctelia in Denmark

    DEFF Research Database (Denmark)

    Christensen, Steen; Søchting, Ulrik


    establishing the genus Punctelia, did not re-combine P. ulophylla, nor include it in the accompanying key. She probably considered it as a synonym of P. subrudecta. In a study on European Punctelia species with lecanoric acid, van Herk & Aptroot (2000) accepted the taxon and made the combination Punctelia...... name at species level, proposed the combination Punctelia jeckeri, and lectotypified the name. As a preparatory work to a forthcoming revision of the Danish lichen checklist (Søchting & Alstrup 2007) it was decided to examine the Danish material of the genus Punctelia....

  9. Diazotrophic bacteria isolated from wild rice Oryza glumaepatula (Poaceae in the Brazilian Amazon

    Directory of Open Access Journals (Sweden)

    Paulo Ivan Fernandes Júnior


    Full Text Available The association of wild grasses with diazotrophic bacteria in Brazilian biomes is poorly understood. The isolation and characterization of bacteria associated with wild grasses can contribute to understand the diazotrophic ecology as well as to identify bacteria with biotechnological applications. In this study, we isolated and characterized diazotrophic bacterial isolates from Oryza glumaepatula collected in Cerrado and Forest areas of the Amazon in Roraima State, Brazil. Healthy O. glumepatula plants were collected at five sampling sites at Forest and seven at Cerrado, respectively. The plants were collected at the Cerrado areas in September 2008 while the Forest plants were collected in June/2008 and April/2009. The plants and the soil adhering to the roots were transferred to pots and grown for 35 days in greenhouse conditions. During the harvest, the shoots and the roots were crushed separately in a saline solution; the suspension was diluted serially and inoculated in Petri dishes containing Dyg’s medium. All distinct bacterial colonies were purified in the same medium. The diazotrophic capacity of each bacterium in microaerophilic conditions was assessed in semisolid BMGM medium. In addition, the pellicles forming bacterial isolates were also evaluated by PCR amplification for nifH gene. The diversity of nifH+ bacteria was analyzed by Box-PCR fingerprinting. For selected strains, the growth promoting capacity of O. sativa as a model plant was also evaluated. A total of 992 bacterial isolates were obtained. Fifty- one bacteria were able to form pellicles in the semisolid medium and 38 also positively amplified the 360bp nifH gene fragment. Among the 38 nifH+ isolates, 24 were obtained from the shoots, while 14 originated from the roots. The Box-PCR profiles showed that the bacterial isolates obtained in this study presented a low similarity with the reference strains belonging to the Herbaspirillum, Azospirillum and Burkholderia genus

  10. Diazotrophic bacteria isolated from wild rice Oryza glumaepatula (Poaceae) in the Brazilian Amazon. (United States)

    Júnior, Paulo Ivan Fernandes; Pereira, Gilmara Maria Duarte; Perin, Liamara; da Silva, Luana Mesquita; Baraúna, Alexandre Cardoso; Alvess, Francilene Muniz; Passos, Samuel Ribeiro; Zilli, Jerri Edson


    The association of wild grasses with diazotrophic bacteria in Brazilian biomes is poorly understood. The isolation and characterization of bacteria associated with wild grasses can contribute to understand the diazotrophic ecology as well as to identify bacteria with biotechnological applications. In this study, we isolated and characterized diazotrophic bacterial isolates from Oryza glumaepatula collected in Cerrado and Forest areas of the Amazon in Roraima State, Brazil. Healthy O. glumepatula plants were collected at five sampling sites at Forest and seven at Cerrado, respectively. The plants were collected at the Cerrado areas in September 2008 while the Forest plants were collected in June/2008 and April/2009. The plants and the soil adhering to the roots were transferred to pots and grown for 35 days in greenhouse conditions. During the harvest, the shoots and the roots were crushed separately in a saline solution; the suspension was diluted serially and inoculated in Petri dishes containing Dyg's medium. All distinct bacterial colonies were purified in the same medium. The diazotrophic capacity of each bacterium in microaerophilic conditions was assessed in semisolid BMGM medium. In addition, the pellicles forming bacterial isolates were also evaluated by PCR amplification for nifH gene. The diversity of nifH bacteria was analyzed by Box-PCR fingerprinting. For selected strains, the growth promoting capacity of O. sativa as a model plant was also evaluated. A total of 992 bacterial isolates were obtained. Fifty-one bacteria were able to form pellicles in the semisolid medium and 38 also positively amplified the 360 bp nifH gene fragment. Among the 38 nifH+ isolates, 24 were obtained from the shoots, while 14 originated from the roots. The Box-PCR profiles showed that the bacterial isolates obtained in this study presented a low similarity with the reference strains belonging to the Herbaspirillum, Azospirillum and Burkholderia genus. The growth

  11. Evaluating sampling strategy for DNA barcoding study of coastal and inland halo-tolerant Poaceae and Chenopodiaceae: A case study for increased sample size.

    Directory of Open Access Journals (Sweden)

    Peng-Cheng Yao

    Full Text Available Environmental conditions in coastal salt marsh habitats have led to the development of specialist genetic adaptations. We evaluated six DNA barcode loci of the 53 species of Poaceae and 15 species of Chenopodiaceae from China's coastal salt marsh area and inland area. Our results indicate that the optimum DNA barcode was ITS for coastal salt-tolerant Poaceae and matK for the Chenopodiaceae. Sampling strategies for ten common species of Poaceae and Chenopodiaceae were analyzed according to optimum barcode. We found that by increasing the number of samples collected from the coastal salt marsh area on the basis of inland samples, the number of haplotypes of Arundinella hirta, Digitaria ciliaris, Eleusine indica, Imperata cylindrica, Setaria viridis, and Chenopodium glaucum increased, with a principal coordinate plot clearly showing increased distribution points. The results of a Mann-Whitney test showed that for Digitaria ciliaris, Eleusine indica, Imperata cylindrica, and Setaria viridis, the distribution of intraspecific genetic distances was significantly different when samples from the coastal salt marsh area were included (P < 0.01. These results suggest that increasing the sample size in specialist habitats can improve measurements of intraspecific genetic diversity, and will have a positive effect on the application of the DNA barcodes in widely distributed species. The results of random sampling showed that when sample size reached 11 for Chloris virgata, Chenopodium glaucum, and Dysphania ambrosioides, 13 for Setaria viridis, and 15 for Eleusine indica, Imperata cylindrica and Chenopodium album, average intraspecific distance tended to reach stability. These results indicate that the sample size for DNA barcode of globally distributed species should be increased to 11-15.


    Directory of Open Access Journals (Sweden)

    RE Holttum


    Full Text Available The distribution of the genus is discussed, and the Malesian species distinguished and described. Two new combinations are effected, Trigono-spora calcarata (Bl. Holtt. and T. koorderSiiH (Chr. Holtt.; the latter is here recognized for the first time as closely related to T. calcarata,.

  13. Palynology of the Genus Stachytarpheta Vahl. (Verbenaceae

    Directory of Open Access Journals (Sweden)

    Olubukola ADEDEJI


    Full Text Available The exine morphology of pollen grains of Stachytarpheta indica (Linn. Vahl, Stachytarpheta cayennensis (Rich. Vahl and Stachytarpheta angustifolia (Mill. Vahl is reported. This study was carried out with a light microscope. Pollen grains from fresh anthers were collected and aceolysed. Statistical analysis used to analyse the data collected include cluster analysis, correlation analysis, similarity and distance indices. The pollen grains are spheroidal to oblate to sub-oblate in shape. They are aperturate, both colpate and porate. Tricolpate types occur most frequently, acolpate, monocolpate, bicolpate and tetracolpate types less frequently. The multicolpate and multiporate attributes in all the species indicate that the genus is not primitive in evolutionary history and this species probably, evolved around in the same time. According to the size, the pollen grains of the genus falls into groups permagna (pollen diameter 100-200 ?m and giganta (pollen diameter greater than 200 ?m. S. cayennensis and S. anguistifolia belong to group permagna and S. indica only in the group giganta. This separates S. indica from the other two species. The large pollen grain size in the genus clearly supports the fact that the flowers in the genus are more insect-and-bird pollinated than wind pollinated. The similarity and distance indices of the species showed that S. cayennensis and S. angustifolia are the closest. S. indica is closer to S. angustifolia but farther from S. cayennensis.

  14. Some genus 3 curves with many points

    NARCIS (Netherlands)

    Auer, R; Top, J; Fieker, C; Kohel, DR


    We explain a naive approach towards the problem of finding genus 3 curves C over any given finite field F-q of odd characteristic, with a number of rational points close to the Hasse-Weil-Serre upper bound q+1+3[2rootq]. The method turns out to be successful at least in characteristic 3.

  15. Phylogeny of the plant genus Pachypodium (Apocynaceae

    Directory of Open Access Journals (Sweden)

    Dylan O. Burge


    Full Text Available Background. The genus Pachypodium contains 21 species of succulent, generally spinescent shrubs and trees found in southern Africa and Madagascar. Pachypodium has diversified mostly into arid and semi-arid habitats of Madagascar, and has been cited as an example of a plant group that links the highly diverse arid-adapted floras of Africa and Madagascar. However, a lack of knowledge about phylogenetic relationships within the genus has prevented testing of this and other hypotheses about the group.Methodology/Principal Findings. We use DNA sequence data from the nuclear ribosomal ITS and chloroplast trnL-F region for all 21 Pachypodium species to reconstruct evolutionary relationships within the genus. We compare phylogenetic results to previous taxonomic classifications and geography. Results support three infrageneric taxa from the most recent classification of Pachypodium, and suggest that a group of African species (P. namaquanum, P. succulentum and P. bispinosum may deserve taxonomic recognition as an infrageneric taxon. However, our results do not resolve relationships among major African and Malagasy lineages of the genus.Conclusions/Significance. We present the first molecular phylogenetic analysis of Pachypodium. Our work has revealed five distinct lineages, most of which correspond to groups recognized in past taxonomic classifications. Our work also suggests that there is a complex biogeographic relationship between Pachypodium of Africa and Madagascar.

  16. A revision of the genus Mastixia (Cornaceae)

    NARCIS (Netherlands)

    Matthew, K.M.


    A revision of the genus in its entire range of distribution is presented. Out of more than 50 published specific names, 9 species (with 13 subspecies or varieties) are recognized, in addition to 4 new species and one new subspecies. The two subgenera Pentamastixia and Tetramastixia of Wangerin

  17. Chloothamnus, a neglected genus of Bambusaceae

    NARCIS (Netherlands)

    Henrard, J.Th.


    Chloothamnus BUSE ap. MIQUEL, Pl. Jungh. 1854, 386 — Oreiostachys GAMBLE ap. KOORDERS, Verh. Kon. Ak. Wet. 16, 1908, 657.. Hab.: Malay Archipelago. 1. C. chilianthus BUSE, l.c., type species of the genus — Schizostachyum chilianthum (BUSE) KURZ, Journ. As. Soc. Beng. 39, ii, 1870, 88 — non Melocanna

  18. The genus Malassezia and human disease

    Directory of Open Access Journals (Sweden)

    Inamadar A


    Full Text Available Sabouraud's Pityrosporum is now recognized as Malassezia. With taxonomic revision of the genus, newer species have been included. The role of this member of the normal human skin flora in different cutaneous and systemic disorders is becoming clearer. The immunological responses it induces in the human body are conflicting and their relevance to clinical features is yet to be explored.

  19. The genus Lolium : taxonomy and genetic resources

    NARCIS (Netherlands)

    Loos, B.P.


    Several aspects of variation within the genus Lolium, and more in detail within Lolium perenne (perennial ryegrass) have been highlighted. As the results are extensively discussed in each chapter, the general discussion is focused on two aspects of

  20. A revision of the genus Phacellaria (Santalaceae)

    NARCIS (Netherlands)

    Danser, B.H.


    On several occasions the author received specimens for determination under the name of Loranthaceae, which in reality appeared to be Phacellarias, usually parasitic on Loranthaceae. When trying to name these Phacellarias, he preceived how difficult it was to survey the literature of the genus.

  1. Conspectus of the genus Amyema Tieghem (Loranthaceae)

    NARCIS (Netherlands)

    Barlow, Bryan A.


    The Australasian/Malesian genus Amyema is reviewed. Particular attention is given to the species of the Malesian region, as a precursor to a treatment of Loranthaceae for Flora Malesiana. Amyema comprises 92 species, and is distributed from the southeast Asian mainland (Malaya, Thailand) throughout

  2. Phylogeny and taxonomy of the genus Cylindrocladiella

    NARCIS (Netherlands)

    Lombard, L.; Shivas, R.G.; To-anun, C.; Crous, P.W.


    The genus Cylindrocladiella was established to accommodate Cylindrocladium-like fungi that have small, cylindrical conidia and aseptate stipe extensions. Contemporary taxonomic studies of these fungi have relied on morphology and to a lesser extent on DNA sequence comparisons of the internal

  3. Phylogeny and taxonomy of the genus Gliocladiopsis

    NARCIS (Netherlands)

    Lombard, L.; Crous, P.W.


    Using a global set of isolates and a phylogenetic approach employing DNA sequence data from five genes (β-tubulin, histone H3, internal transcribed spacer region, 28S large subunit region and translation elongation factor 1-α), the taxonomic status of the genus Gliocladiopsis (Glionectria)

  4. Phylogeny and taxonomy of the genus Gliocladiopsis

    NARCIS (Netherlands)

    Lombard, L.; Crous, P.W.


    Using a global set of isolates and a phylogenetic approach employing DNA sequence data from five genes (ß-tubulin, histone H3, internal transcribed spacer region, 28S large subunit region and translation elongation factor 1-a), the taxonomic status of the genus Gliocladiopsis (Glionectria)

  5. Records of the genus Coccygidium Saussure (Hymenoptera ...

    African Journals Online (AJOL)

    Coccygidium arabica sp. nov., (Hym., Braconidae, Agathidinae) is described from Saudi Arabia. Morphological diagnostic characters of the new species were figured and compared with those of the related species Coccygidium angostura. The genus Coccygidium Saussure is recorded for the first time from Saudi Arabia.

  6. Chemotaxonomy of the genus Nuxia (Buddlejaceae)

    DEFF Research Database (Denmark)

    Jensen, Søren Rosendal


    An investigation of two species of Nuxia (Buddlejaceae) showed that this genus is characterised by the presence of the eight-carbon iridoid glucoside unedoside and/or its derivatives. From N. floribunda was isolated unedoside, nuxioside (6-O-a-L-rhamnopyranosyl-unedoside) and 2''-acetyl-3...

  7. A new genus of Blacinae (Hymenoptera: Braconidae) (United States)

    Lester P. Gibson


    A new genus, Canalicephalus, of the subfamily Blacinae is described along with 4 new species, C. orientalis from Borneo, C. novus from New Guinea, and C. bakeri and C. mindanao, both from the Philippines. Keys are included to separate these 2 genera and the 4...

  8. Thermoregulation of the subterranean rodent genus Bathyergus ...

    African Journals Online (AJOL)

    The thermoregulation of the largest subterranean rodent, genus Bathyergus, comprising two species, B. suillus and B. janetta,occurring in mesic and semiarid habitats respectively, was investigated and compared with that of other subterranean rodents. Both species display low resting metabolic rates and low body ...

  9. (Lepidoptera: Zygaenoidea) The genus Psycharium Herrich ...

    African Journals Online (AJOL)

    The genus Psycharium is revised for the first time. Until now, only a drawing of the female type species was known. The male and female of the type species, P. pellucens Herrich-Schaffer, and four new species, montanum, kammanassiense, bamardi and natalense,are comprehensively described. A key to the species of ...

  10. Biological advances in Bergenia genus plant

    African Journals Online (AJOL)



    Aug 8, 2011 ... Bergenia, a genus belonging to Saxifragaceae family, is one of the most important medicinal plants, has high application values for human. Currently, wild Bergenia is becoming lacking, due to destruction of ecological environment and excessive excavation; furthermore, the study on it is not deep enough,.

  11. Phytochemical and Pharmacological Properties of the Genus ...

    African Journals Online (AJOL)

    Melodinus is an important genus comprising of approximately 53 species of medicinal plants (Apocynaceae). Some species have been used in Chinese folk medicine for the treatment of meningitis in children, rheumatic heart diseases, and diuresis, as well as a decongestive against migraine and sinusitis. This paper is a ...

  12. The genus Kochia (Chenopodiaceae) in North America (United States)

    Ge-Lin Chu; Stewart Sanderson


    The genus Kochia and Bassia with which it has been combined, of Chenopodiaceae tribe Camphorosmeae, were at one time considered to include plants native to Eurasia, Australia, and North America, and included species of both C3 and C4 photosynthetic types. This aggregate has been reduced in size by removal of a large group of C3 Australian genera and species. Because of...

  13. A study in the genus Vulpia

    NARCIS (Netherlands)

    Henrard, J.Th.


    In conclusion, we propose the following nomenclatural alterations. For a good classification, the genus Vulpia is to be accepted as a member of the Festuceae. Various names of Vulpia are fixed according to our present rules of nomenclature, viz. V. bromoides (L.) GRAY, V. membranacea (L.) LINK, V.

  14. The genus Gymnospermium (Berberidaceae) in the Balkans

    DEFF Research Database (Denmark)

    Tan, Kit; Shuka, Lulezim; Siljak-Yakovlev, Sonja


    A revision of the genus Gymnospermium (Berberidaceae) in the Balkan Peninsula is carried out. Three species are recognised. Gymnospermium maloi is described as a new species from Mt. Picari in Gjirokastra district, southern Albania. It is compared with the closely related G. scipetarum which has...

  15. Polyphasic taxonomy of the genus Talaromyces

    DEFF Research Database (Denmark)

    Yilmaz, N.; Visagie, C.M.; Houbraken, J.


    The genus Talaromyces was described by Benjamin in 1955 as a sexual state of Penicillium that produces soft walled ascomata covered with interwoven hyphae. Phylogenetic information revealed that Penicillium subgenus Biverticillium and Talaromyces form a monophyletic clade distinct from the other...

  16. Interspecific hybridization in the genus Tulipa L.

    NARCIS (Netherlands)

    Creij, van M.G.M.


    The genus Tulipa L. comprises about 55 species. The tulip species are classified in two subgenera, Tulipa and Eriostemones, which are subdivided into five and three sections respectively. Commercial tulips are mainly cultivars

  17. Studies on the Genus Orbitolina (Foraminiferida)

    NARCIS (Netherlands)

    Hofker, J.


    The genus Orbitolina is described in detail and is shown to be represented by one species only: Orbitolina lenticularis (Blumenbach). This species can be subdivided into form-groups, based on the characteristics of the megalospheric embryonic apparatus. The evolution of the species is orthogenetic.

  18. Sarawakodendron, a new genus of Celastraceae

    NARCIS (Netherlands)

    Hou, Ding


    During my trip to Malaysia in 1966, sponsored by the Netherlands Foundation for the Advancement of Tropical Research (WOTRO), for doing field work on Anacardiaceae, a new tree genus was found in Sarawak belonging to the family Celastraceae which I have revised for the Flora Malesiana series I,

  19. The genus Lophopyxis Hook. f. (Lophopyxidaceae)

    NARCIS (Netherlands)

    Sleumer, H.


    When revising the Icacinaceae from SE. Asia and Malesia recently, my interest was drawn again to the genus Lophopyxis Hook. f. Designated by its author (1887) tentatively as a member of the Euphorbiaceae, it was rejected from this family by Pax as early as 1890. Engler (1893) transferred Lophopyxis

  20. A conspectus of the genus Bhesa (Celastraceae)

    NARCIS (Netherlands)

    Hou, Ding


    In his Numerical List Wallich inserted four specific epithets in the genus Kurrimia, viz 4334 K. pulcherrima Wall., 4335 K. calophylla Wall., 4336 K. paniculata Wall., and later 7200 K.? macrophylla Wall. The latter one was provided with a question mark; it was a new combination for Itea macrophylla

  1. The Mesozoic megafossil genus Linguifolium Arber 1917

    Directory of Open Access Journals (Sweden)

    Pattemore Gary A.


    Full Text Available The plant megafossil genus Linguifolium Arber 1917 is chiefly known from the Middle and Upper Triassic of Gondwana. The range of Linguifolium extended beyond Gondwana by the Late Triassic, persisting there through the earliest Jurassic (Hettangian. The parent plants probably grew in a well-watered, canopied environment.

  2. The Genus Diporochaeta (Oligochaeta Megascolecidae) in Queensland

    NARCIS (Netherlands)

    Jamieson, B.G.M.


    Perionychella is reassigned to Diporochaeta as a junior synonym. 9 new species are added to the 8 previously known Queensland species of Diporochaeta, all of which are redescribed, bringing the generic total for Australia to 77 named species. Distribution of the genus is disjunct, the Queensland

  3. On the genus Galidia and its species

    NARCIS (Netherlands)

    Jentink, F.A.


    In the year 1839 Is. Geoff. St. Hilaire ¹) described and figured three species of his new genus Galidia, viz: elegans, concolor and olivacea, all natives of Madagascar. It seems that Galidia olivacea has not been captured by the travellers who visited Madagascar after Bernier and Goudot: the only

  4. Helicoverpa zea (Lepidoptera: Noctuidae) and Spodoptera frugiperda (Lepidoptera: Noctuidae) Responses to Sorghum bicolor (Poales: Poaceae) Tissues From Lowered Lignin Lines. (United States)

    Dowd, Patrick F; Sattler, Scott E


    The presence of lignin within biomass impedes the production of liquid fuels. Plants with altered lignin content and composition are more amenable to lignocellulosic conversion to ethanol and other biofuels but may be more susceptible to insect damage where lignin is an important resistance factor. However, reduced lignin lines of switchgrasses still retained insect resistance in prior studies. Therefore, we hypothesized that sorghum lines with lowered lignin content will also retain insect resistance. Sorghum excised leaves and stalk pith Sorghum bicolor (L.) Moench (Poales: Poaceae) from near isogenic brown midrib (bmr) 6 and 12 mutants lines, which have lowered lignin content and increased lignocellulosic ethanol conversion efficiency, were examined for insect resistance relative to wild-type (normal BTx623). Greenhouse and growth chamber grown plant tissues were fed to first-instar larvae of corn earworms, Helicoverpa zea (Boddie) and fall armyworms Spodoptera frugiperda (J.E. Smith) (Lepidoptera: Noctuidae), two sorghum major pests. Younger bmr leaves had significantly greater feeding damage in some assays than wild-type leaves, but older bmr6 leaves generally had significantly less damage than wild-type leaves. Caterpillars feeding on the bmr6 leaves often weighed significantly less than those feeding on wild-type leaves, especially in the S. frugiperda assays. Larvae fed the pith from bmr stalks had significantly higher mortality compared with those larvae fed on wild-type pith, which suggested that bmr pith was more toxic. Thus, reducing lignin content or changing subunit composition of bioenergy grasses does not necessarily increase their susceptibility to insects and may result in increased resistance, which would contribute to sustainable production. Published by Oxford University Press on behalf of the Entomological Society of America 2015. This work is written by US Government employees and is in the public domain in the US.

  5. Linkage Maps of a Mediterranean × Continental Tall Fescue Population and their Comparative Analysis with Other Poaceae Species

    Directory of Open Access Journals (Sweden)

    Ryan Dierking


    Full Text Available Temperate grasses belonging to the complex are important throughout the world in pasture and grassland agriculture. Tall fescue ( Schreb. is the predominant species in the United States, covering approximately 15 million ha. Tall fescue has distinctive morphotypes, two of which are Continental (summer active and Mediterranean (summer semidormant. This is the first report of a linkage map created for Mediterranean tall fescue, while updating the Continental map with additional simple sequence repeat and sequence-tagged site markers. Additionally, this is the first time that diversity arrays technology (DArT markers were used in the construction of a tall fescue map. The male parent (Continental, R43-64, map consisted of 594 markers arranged in 22 linkage groups (LGs and covered a total of 1577 cM. The female parent (Mediterranean, 103-2, map was shorter (1258 cM and consisted of only 208 markers arranged in 29 LGs. Marker densities for R43-64 and 103-2 were 2.65 and 6.08 cM per marker, respectively. When compared with the other Poaceae species, meadow fescue ( Huds., annual ryegrass ( Lam., perennial ryegrass ( L., (L. Beauv., and barley ( L., a total of 171 and 98 orthologous or homologous sequences, identified by DArT analysis, were identified in R43-64 and 103-2, respectively. By using genomic in situ hybridization, we aimed to identify potential progenitors of both morphotypes. However, no clear conclusion on genomic constitution was reached. These maps will aid in the search for quantitative trait loci of various traits as well as help define and distinguish genetic differences between the two morphotypes.

  6. The phyletic status of the genus Planaria (Platyhelminthes, Turbellaria, Tricladida)

    NARCIS (Netherlands)

    Ball, Ian R.; Gourbault, Nicole


    The amphiatlantic distribution of the genus Planaria is incompatible with our current hypothesis of the historical biogeography of freshwater planarians. New anatomical studies suggest the possibility that the genus is not strictly monophyletic; new karyological data are strongly corroborative of

  7. Khmeriosicyos, a new monotypic genus of Cucurbitaceae from Cambodia

    NARCIS (Netherlands)

    Wilde, de W.J.J.O.; Duyfjes, B.E.E.; Ham, van der R.W.J.M.


    A new monotypic genus from Cambodia is described. The genus is defined by a unique combination of characters and has distinct pollen features. The only species is Khmeriosicyos harmandii W.J. de Wilde & Duyfjes.

  8. A preliminary survey of the genus Buchwaldoboletus (Boletales: Boletaceae) (United States)

    Beatriz Ortiz-Santana; Ernst E. Both


    Buchwaldoboletus is a small genus of about a dozen species with a world-wide distribution. The boletes of this genus are non-mycorrhizal, saprophytic and lignicolous. A preliminary survey is provided and seven new combinations are proposed.

  9. Modular functors are determined by their genus zero data

    DEFF Research Database (Denmark)

    Andersen, Jørgen Ellegaard; Ueno, Kenji


    We prove in this paper that the genus zero data of a modular functor determines the modular functor. We do this by establishing that the S-matrix in genus one with one point labeled arbitrarily can be expressed in terms of the genus zero information and we give an explicit formula. We do not assume...

  10. Topological classification and enumeration of RNA structures by genus

    DEFF Research Database (Denmark)

    Andersen, Joergen Ellegard; Penner, Robert C.; Reidys, Christian


    To an RNA pseudoknot structure is naturally associated a topological surface, which has its associated genus, and structures can thus be classified by the genus. Based on earlier work of Harer-Zagier, we compute the generating function for the number of those structures of fixed genus and minimum...

  11. A Comprehensive review on the genus Plumbago with focus on ...

    African Journals Online (AJOL)

    Background: The genus Plumbago distributed in warm tropical regions throughout the world is the largest genus in Plumbaginaceae. Medicinal plants are characteristic to the genus Plumbago and are cultivated and utilized worldwide. Plumbago auriculata Lam. is common in South Africa and is often cultivated for its ...

  12. Notes on the genus Digitaria, with descriptions of new species

    NARCIS (Netherlands)

    Henrard, J.Th.


    Some years ago I had the opportunity to study more extensively a very interesting group of grasses, belonging to what is now accepted as a distinct genus, the genus Digitaria, formerly belonging as a subgenus to the genus Panicum. As to living plants of this group I was familiar with two european

  13. A new name for the foraminiferal genus Heterospira

    NARCIS (Netherlands)

    Umbgrove, J.H.F.


    A short time ago I described a new foraminiferal genus from the Tertiary of Borneo 1). I gave this genus the name of Heterospira. Mr. P. H. Oehser of Washington drew my attention to the fact that E. Koken as early as 1896²) had used the name Heterospira for a genus of triassic gastropoda from

  14. Ultrastructural morphologic description of the wild rice species Oryza latifolia (Poaceae in Costa Rica

    Directory of Open Access Journals (Sweden)

    Ethel Sánchez


    Full Text Available The wild rice species Oryza latifolia is endemic to Tropical America, allotetraploid and has a CCDD genome type. It belongs to the officinalis group of the genus Oryza. This species is widely distributed through-out the lowlands of Costa Rica and it is found on different life zones, having great morphologic diversity. The purpose of this research is to perform a morphologic description of O. latifolia samples of three Costa Rican localities (Carara, Liberia and Cañas and to see if the phenotypic diversity of the species is reflected at the ultra-structure level. Structures such as the leaf blade, ligule, auricles and spikelet were analyzed. Leaf blade morphology of the specimens from the three localities is characterized by the presence of diamond-shaped stomata with papillae, zipper-like rows of silica cells; a variety of evenly distributed epicuticular wax papillae and bulky prickle trichomes. The central vein of the leaf blade from the Cañas populations is glabrous, while those from Carara and Liberia have abundant papillae. There are also differences among the borders of the leaf blade between these locations. Cañas and Liberia present alternating large and small prickle trichomes ca. 81 and 150 µm, while Carara exhibits even sized prickle trichomes of ca. 93 µm. Auricles from Cañas are rectangular and present long trichomes along the surface ca. 1.5 mm, while those of Liberia and Carara wrap the culm and exhibit trichomes only in the borders. The ligule from the plants of Carara has an acute distal tip, while that of Cañas and Liberia is blunt. The Liberia spikelet has large lignified spines while Cañas and Carara show flexible trichomes.La especie silvestre Oryza latifolia es endémica de América, tetraploide y de genoma CCDD. Pertenece a las especies del género Oryza del grupo officinalis. Presenta una amplia distribución en las tierras bajas de Costa Rica y se le encuentra en varias zonas de vida, mostrando una gran diversidad

  15. A holomorphic anomaly in the elliptic genus

    International Nuclear Information System (INIS)

    Murthy, Sameer


    We consider a class of gauged linear sigma models (GLSMs) in two dimensions that flow to non-compact (2,2) superconformal field theories in the infra-red, a prototype of which is the SL(2,ℝ)/U(1) (cigar) coset. We compute the elliptic genus of the GLSMs as a path-integral on the torus using supersymmetric localization. We find that the result is a Jacobi-like form that is non-holomorphic in the modular parameter τ of the torus, with mock modular behavior. This agrees with a previously-computed expression in the cigar coset. We show that the lack of holomorphicity of the elliptic genus arises from the contributions of a compact boson carrying momentum and winding excitations. This boson has an axionic shift symmetry and plays the role of a compensator field that is needed to cancel the chiral anomaly in the rest of the theory.

  16. Phylogeny and taxonomy of the genus Gliocephalotrichum. (United States)

    Lombard, L; Serrato-Diaz, L M; Cheewangkoon, R; French-Monar, R D; Decock, C; Crous, P W


    Species in the genus Gliocephalotrichum (= Leuconectria) (Hypocreales, Nectriaceae) are soilborne fungi, associated with post-harvest fruit spoilage of several important tropical fruit crops. Contemporary taxonomic studies of these fungi have relied on morphology and DNA sequence comparisons of the internal transcribed spacer region of the nuclear rDNA (ITS) and the β-tubulin gene regions. Employing DNA sequence data from four loci (β-tubulin, histone H3, ITS, and translation elongation factor 1-alpha) and morphological comparisons, the taxonomic status of the genus Gliocephalotrichum was re-evaluated. As a result five species are newly described, namely G. humicola (Taiwan, soil), G. mexicanum (rambutan fruit from Mexico), G. nephelii (rambutan fruit from Guatemala), G. queenslandicum (Australia, endophytic isolations) and G. simmonsii (rambutan fruit from Guatemala). Although species of Gliocephalotrichum are generally not regarded as important plant pathogens, their ability to cause post-harvest fruit rot could have an impact on fruit export and storage.

  17. Sexual Communication in the Drosophila Genus


    Gwénaëlle Bontonou; Claude Wicker-Thomas


    In insects, sexual behavior depends on chemical and non-chemical cues that might play an important role in sexual isolation. In this review, we present current knowledge about sexual behavior in the Drosophila genus. We describe courtship and signals involved in sexual communication, with a special focus on sex pheromones. We examine the role of cuticular hydrocarbons as sex pheromones, their implication in sexual isolation, and their evolution. Finally, we discuss the roles of male cuticular...

  18. The genus Artemisia: a comprehensive review. (United States)

    Bora, Kundan Singh; Sharma, Anupam


    Medicinal plants are nature's gift to human beings to make disease free healthy life, and play a vital role to preserve our health. They are believed to be much safer and proven elixir in the treatment of various ailments. The genus Artemisia (Astraceae) consists of about 500 species, occurring throughout the world. The present review comprises the ethnopharmacological, phytochemical and therapeutic potential of various species of Artemisia. The aim of this this review is to bring together most of the available scientific research conducted on the genus Artemisia, which is currently scattered across various publications. Through this review the authors hope to attract the attention of natural product researchers throughout the world to focus on the unexplored potential of Artemisia species. This review has been compiled using references from major databases such as Chemical Abstracts, Medicinal and Aromatic Plants Abstracts, ScienceDirect, SciFinder, PubMed, King's American Dispensatory, Henriette's Herbal Homepage, Dr. Duke's Phytochemical and Ethnobotanical Databases. An exhaustive survey of literature revealed that the different species of Artemisia have a vast range of biological activities including antimalarial, cytotoxic, antihepatotoxic, antibacterial, antifungal and antioxidant activity. Some very important drug leads have been discovered from this genus, notably artemisinin, the well known antimalarial drug isolated from the Chinese herb Artemisia annua. Terpenoids, flavonoids, coumarins, caffeoylquinic acids, sterols and acetylenes constitute major classes of phytoconstituents of the genus. Various species of Artemisia seems to hold great potential for in-depth investigation for various biological activities, especially their effects on the central nervous and cardiovascular systems.

  19. Wild translation surfaces and infinite genus


    Randecker, Anja


    The Gauss-Bonnet formula for classical translation surfaces relates the cone angle of the singularities (geometry) to the genus of the surface (topology). When considering more general translation surfaces, we observe so-called wild singularities for which the notion of cone angle is not applicable any more. In this article, we study whether there still exist relations between the geometry and the topology for translation surfaces with wild singularities. By considering short saddle connectio...

  20. The pangenome of the genus Clostridium. (United States)

    Udaondo, Zulema; Duque, Estrella; Ramos, Juan-Luis


    The pangenome for the genus Clostridium sensu stricto, which was obtained using highly curated and annotated genomes from 16 species is presented; some of these cause disease, while others are used for the production of added-value chemicals. Multilocus sequencing analysis revealed that species of this genus group into at least two clades that include non-pathogenic and pathogenic strains, suggesting that pathogenicity is dispersed across the phylogenetic tree. The core genome of the genus includes 546 protein families, which mainly comprise those involved in protein translation and DNA repair. The GS-GOGAT may represent the central pathway for generating organic nitrogen from inorganic nitrogen sources. Glycerol and glucose metabolism genes are well represented in the core genome together with a set of energy conservation systems. A metabolic network comprising proteins/enzymes, RNAs and metabolites, whose topological structure is a non-random and scale-free network with hierarchically structured modules was built. These modules shed light on the interactions between RNAs, proteins and metabolites, revealing biological features of transcription and translation, cell wall biosynthesis, C1 metabolism and N metabolism. Network analysis identified four nodes that function as hubs and bottlenecks, namely, coenzyme A, HPr kinases, S-adenosylmethionine and the ribonuclease P-protein, suggesting pivotal roles for them in Clostridium. © 2017 Society for Applied Microbiology and John Wiley & Sons Ltd.

  1. Biodegradation of chlorpyrifos by bacterial genus Pseudomonas. (United States)

    Gilani, Razia Alam; Rafique, Mazhar; Rehman, Abdul; Munis, Muhammad Farooq Hussain; Rehman, Shafiq Ur; Chaudhary, Hassan Javed


    Chlorpyrifos is an organophosphorus pesticide commonly used in agriculture. It is noxious to a variety of organisms that include living soil biota along with beneficial arthropods, fish, birds, humans, animals, and plants. Exposure to chlorpyrifos may cause detrimental effects as delayed seedling emergence, fruit deformities, and abnormal cell division. Contamination of chlorpyrifos has been found about 24 km from the site of its application. There are many physico-chemical and biological approaches to remove organophosphorus pesticides from the ecosystem, among them most promising is biodegradation. The 3,5,6-trichloro-2-pyridinol (TCP) and diethylthiophosphate (DETP) as primary products are made when chlorpyrifos is degraded by soil microorganisms which further break into nontoxic metabolites as CO(2), H(2)O, and NH(3). Pseudomonas is a diversified genus possessing a series of catabolic pathways and enzymes involved in pesticide degradation. Pseudomonas putida MAS-1 is reported to be more efficient in chlorpyrifos degradation by a rate of 90% in 24 h among Pseudomonas genus. The current review analyzed the comparative potential of bacterial species in Pseudomonas genus for degradation of chlorpyrifos thus, expressing an ecofriendly approach for the treatment of environmental contaminants like pesticides. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  2. Standardized gene nomenclature for the Brassica genus

    Directory of Open Access Journals (Sweden)

    King Graham J


    Full Text Available Abstract The genus Brassica (Brassicaceae, Brassiceae is closely related to the model plant Arabidopsis, and includes several important crop plants. Against the background of ongoing genome sequencing, and in line with efforts to standardize and simplify description of genetic entities, we propose a standard systematic gene nomenclature system for the Brassica genus. This is based upon concatenating abbreviated categories, where these are listed in descending order of significance from left to right (i.e. genus – species – genome – gene name – locus – allele. Indicative examples are provided, and the considerations and recommendations for use are discussed, including outlining the relationship with functionally well-characterized Arabidopsis orthologues. A Brassica Gene Registry has been established under the auspices of the Multinational Brassica Genome Project that will enable management of gene names within the research community, and includes provisional allocation of standard names to genes previously described in the literature or in sequence repositories. The proposed standardization of Brassica gene nomenclature has been distributed to editors of plant and genetics journals and curators of sequence repositories, so that it can be adopted universally.

  3. Genus Ranges of 4-Regular Rigid Vertex Graphs. (United States)

    Buck, Dorothy; Dolzhenko, Egor; Jonoska, Nataša; Saito, Masahico; Valencia, Karin


    A rigid vertex of a graph is one that has a prescribed cyclic order of its incident edges. We study orientable genus ranges of 4-regular rigid vertex graphs. The (orientable) genus range is a set of genera values over all orientable surfaces into which a graph is embedded cellularly, and the embeddings of rigid vertex graphs are required to preserve the prescribed cyclic order of incident edges at every vertex. The genus ranges of 4-regular rigid vertex graphs are sets of consecutive integers, and we address two questions: which intervals of integers appear as genus ranges of such graphs, and what types of graphs realize a given genus range. For graphs with 2 n vertices ( n > 1), we prove that all intervals [ a, b ] for all a genus ranges. For graphs with 2 n - 1 vertices ( n ≥ 1), we prove that all intervals [ a, b ] for all a genus ranges. We also provide constructions of graphs that realize these ranges.

  4. Testing efficacy of distance and tree-based methods for DNA barcoding of grasses (Poaceae tribe Poeae) in Australia. (United States)

    Birch, Joanne L; Walsh, Neville G; Cantrill, David J; Holmes, Gareth D; Murphy, Daniel J


    In Australia, Poaceae tribe Poeae are represented by 19 genera and 99 species, including economically and environmentally important native and introduced pasture grasses [e.g. Poa (Tussock-grasses) and Lolium (Ryegrasses)]. We used this tribe, which are well characterised in regards to morphological diversity and evolutionary relationships, to test the efficacy of DNA barcoding methods. A reference library was generated that included 93.9% of species in Australia (408 individuals, [Formula: see text] = 3.7 individuals per species). Molecular data were generated for official plant barcoding markers (rbcL, matK) and the nuclear ribosomal internal transcribed spacer (ITS) region. We investigated accuracy of specimen identifications using distance- (nearest neighbour, best-close match, and threshold identification) and tree-based (maximum likelihood, Bayesian inference) methods and applied species discovery methods (automatic barcode gap discovery, Poisson tree processes) based on molecular data to assess congruence with recognised species. Across all methods, success rate for specimen identification of genera was high (87.5-99.5%) and of species was low (25.6-44.6%). Distance- and tree-based methods were equally ineffective in providing accurate identifications for specimens to species rank (26.1-44.6% and 25.6-31.3%, respectively). The ITS marker achieved the highest success rate for specimen identification at both generic and species ranks across the majority of methods. For distance-based analyses the best-close match method provided the greatest accuracy for identification of individuals with a high percentage of "correct" (97.6%) and a low percentage of "incorrect" (0.3%) generic identifications, based on the ITS marker. For tribe Poeae, and likely for other grass lineages, sequence data in the standard DNA barcode markers are not variable enough for accurate identification of specimens to species rank. For recently diverged grass species similar challenges are

  5. Genomic characterization of the Taylorella genus.

    Directory of Open Access Journals (Sweden)

    Laurent Hébert

    Full Text Available The Taylorella genus comprises two species: Taylorella equigenitalis, which causes contagious equine metritis, and Taylorella asinigenitalis, a closely-related species mainly found in donkeys. We herein report on the first genome sequence of T. asinigenitalis, analyzing and comparing it with the recently-sequenced T. equigenitalis genome. The T. asinigenitalis genome contains a single circular chromosome of 1,638,559 bp with a 38.3% GC content and 1,534 coding sequences (CDS. While 212 CDSs were T. asinigenitalis-specific, 1,322 had orthologs in T. equigenitalis. Two hundred and thirty-four T. equigenitalis CDSs had no orthologs in T. asinigenitalis. Analysis of the basic nutrition metabolism of both Taylorella species showed that malate, glutamate and alpha-ketoglutarate may be their main carbon and energy sources. For both species, we identified four different secretion systems and several proteins potentially involved in binding and colonization of host cells, suggesting a strong potential for interaction with their host. T. equigenitalis seems better-equipped than T. asinigenitalis in terms of virulence since we identified numerous proteins potentially involved in pathogenicity, including hemagluttinin-related proteins, a type IV secretion system, TonB-dependent lactoferrin and transferrin receptors, and YadA and Hep_Hag domains containing proteins. This is the first molecular characterization of Taylorella genus members, and the first molecular identification of factors potentially involved in T. asinigenitalis and T. equigenitalis pathogenicity and host colonization. This study facilitates a genetic understanding of growth phenotypes, animal host preference and pathogenic capacity, paving the way for future functional investigations into this largely unknown genus.

  6. Sexual Communication in the Drosophila Genus. (United States)

    Bontonou, Gwénaëlle; Wicker-Thomas, Claude


    In insects, sexual behavior depends on chemical and non-chemical cues that might play an important role in sexual isolation. In this review, we present current knowledge about sexual behavior in the Drosophila genus. We describe courtship and signals involved in sexual communication, with a special focus on sex pheromones. We examine the role of cuticular hydrocarbons as sex pheromones, their implication in sexual isolation, and their evolution. Finally, we discuss the roles of male cuticular non-hydrocarbon pheromones that act after mating: cis-vaccenyl acetate, developing on its controversial role in courtship behavior and long-chain acetyldienylacetates and triacylglycerides, which act as anti-aphrodisiacs in mated females.

  7. Marine worms (genus Osedax) colonize cow bones


    Jones, William J; Johnson, Shannon B; Rouse, Greg W; Vrijenhoek, Robert C


    Bone-eating worms of the genus Osedax colonized and grew on cow bones deployed at depths ranging from 385 to 2893 m in Monterey Bay, California. Colonization occurred as rapidly as two months following deployment of the cow bones, similar to the time it takes to colonize exposed whalebones. Some Osedax females found on the cow bones were producing eggs and some hosted dwarf males in their tubes. Morphological and molecular examinations of these worms confirmed the presence of six Osedax speci...

  8. The genus Bryoerythrophyllum (Musci, Pottiaceae in Antarctica

    Directory of Open Access Journals (Sweden)

    Sollman Philip


    Full Text Available Antarctic material of the genus Bryoerythrophyllum P. C. Chen was studied from all specimens present in KRAM. Bryoerythrophyllum recurvirostrum (Hedw. P. C. Chen var. antarcticum L. I. Savicz & Smirnova is treated as a distinct species: B. antarcticum (L. I. Savicz & Smirnova P. Sollman, stat. nov. Three species are now known in the Antarctic region: B. antarcticum, B. recurvirostrum and B. rubrum (Jur. ex Geh. P. C. Chen. Bryoerythrophyllum rubrum is reported for the first time from the Antarctic. It is a bipolar species. A key to the taxa is given. These species are described and briefly discussed, with notes on illustrations, reproduction, habitat, world range, distribution and elevation in Antarctica.

  9. Operators and higher genus mirror curves

    Energy Technology Data Exchange (ETDEWEB)

    Codesido, Santiago [Département de Physique Théorique et section de Mathématiques,Université de Genève,Genève, CH-1211 (Switzerland); Gu, Jie [Laboratoire de Physique Théorique de l’École Normale Supérieure,CNRS, PSL Research University,Sorbonne Universités, UPMC, 75005 Paris (France); Mariño, Marcos [Département de Physique Théorique et section de Mathématiques,Université de Genève,Genève, CH-1211 (Switzerland)


    We perform further tests of the correspondence between spectral theory and topological strings, focusing on mirror curves of genus greater than one with nontrivial mass parameters. In particular, we analyze the geometry relevant to the SU(3) relativistic Toda lattice, and the resolved ℂ{sup 3}/ℤ{sub 6} orbifold. Furthermore, we give evidence that the correspondence holds for arbitrary values of the mass parameters, where the quantization problem leads to resonant states. We also explore the relation between this correspondence and cluster integrable systems.

  10. A review of the genus Curtisia (Curtisiaceae

    Directory of Open Access Journals (Sweden)

    E. YU Yembaturova


    Full Text Available A review of the monotypic southern African endemic genus Curtisia Aiton is presented. Detailed studies of the fruit and seed structure provided new evidence in support of a close relationship between the family Curtisiaceae and Comaceae. Comparisons with several other members of the Comales revealed carpological similarities to certain species of Comus s.I., sometimes treated as segregate genera Dendrobenthamia Hutch, and Benthamidia Spach. We also provide information on the history of the assegai tree, Curtisia dentata (Burm.f. C.A.Sm. and its uses, as well as a formal taxonomic revision, including nomenclature, typification, detailed description and geographical distribution.

  11. Heterogeneity in the genus Allovahlkampfia and the description of the new genus Parafumarolamoeba (Vahlkampfiidae; Heterolobosea). (United States)

    Geisen, Stefan; Bonkowski, Michael; Zhang, Junling; De Jonckheere, Johan F


    Heterolobosean amoebae are common and diverse members of soil protist communities. In this study, we isolated seven strains of amoebae from soil samples taken in Tibet (at high altitude), Sardinia and the Netherlands, all resembling to belong to a similar heterolobosean morphospecies. However, sequences of the small subunit (SSU) rDNA and internal transcribed spacers, including the 5.8S rDNA, revealed a high heterogeneity in the genus Allovahlkampfia to which six of the isolates belong. Some unnamed strains, of which the sequences had been published before, are also included within the genus Allovahlkampfia. One Allovahlkampfia isolated in the Netherlands harbors a twin-ribozyme, containing a His-Cys box, similar to the one found in strain BA of Allovahlkampfia. The other SSU rDNA sequence grouped in phylogenetic analyses with sequences obtained in environmental sequencing studies as sister to the genus Fumarolamoeba. This phylogenetic placement was supported by analyses of the 5.8S rDNA leading us to describe it as a new genus Parafumarolamoeba. Copyright © 2015 Elsevier GmbH. All rights reserved.

  12. Facilitation of a native pest of rice, Stenotus rubrovittatus (Hemiptera: Miridae), by the non-native Lolium multiflorum (Cyperales: Poaceae) in an agricultural landscape. (United States)

    Yoshioka, Akira; Takada, Mayura; Washitani, Izumi


    Source populations of polyphagous pests often occur on host plants other than the economically damaged crop. We evaluated the contribution of patches of a non-native meadow grass, Lolium multiflorum Lam. (Poaceae), and other weeds growing in fallow fields or meadows as source hosts of an important native pest of rice, Stenotus rubrovittatus (Matsumura) (Hemiptera: Miridae), in an agricultural landscape of northern Japan. Periodical censuses of this mirid bug by using the sweeping method, vegetation surveys, and statistical analysis revealed that L. multiflorum was the only plant species that was positively correlated with the density of adult S. rubrovittatus through two generations and thus may be the most stable and important host of the mirid bug early in the season before the colonization of rice paddies. The risk and cost of such an indirect negative effect on a crop plant through facilitation of a native pest by a non-native plant in the agricultural landscape should not be overlooked.

  13. Dataset on the structural characterization of organosolv lignin obtained from ensiled Poaceae grass and load-dependent molecular weight changes during thermoplastic processing

    Directory of Open Access Journals (Sweden)

    Jörg Dörrstein


    Full Text Available This article presents experimental data of organosolv lignin from Poacea grass and structural changes after compounding and injection molding as presented in the research article “Effects of high-lignin-loading on thermal, mechanical, and morphological properties of bioplastic composites” [1]. It supplements the article with morphological (SEM, spectroscopic (31P NMR, FT-IR and chromatographic (GPC, EA data of the starting lignin as well as molar mass characteristics (mass average molar mass (Mw and Polydispersity (D of the extracted lignin. Refer to Schwarz et al. [2] for a detailed description of the production of the organosolv residue and for further information on the raw material used for lignin extraction. The dataset is made publicly available and can be useful for extended lignin research and critical analyzes.

  14. Aggressive behavior in the genus Gallus sp

    Directory of Open Access Journals (Sweden)

    SA Queiroz


    Full Text Available The intensification of the production system in the poultry industry and the vertical integration of the poultry agribusiness have brought profound changes in the physical and social environment of domestic fowls in comparison to their ancestors and have modified the expression of aggression and submission. The present review has covered the studies focusing on the different aspects linked to aggressiveness in the genus Gallus. The evaluated studies have shown that aggressiveness and subordination are complex behavioral expressions that involve genetic differences between breeds, strains and individuals, and differences in the cerebral development during growth, in the hormonal metabolism, in the rearing conditions of individuals, including feed restriction, density, housing type (litter or cage, influence of the opposite sex during the growth period, existence of hostile stimuli (pain and frustration, ability to recognize individuals and social learning. The utilization of fighting birds as experimental material in the study of mechanisms that have influence on the manifestation of aggressiveness in the genus Gallus might comparatively help to elucidate important biological aspects of such behavior.

  15. [Advance in chemical constituents of genus Clematis]. (United States)

    Sun, Feng; Yang, Depo


    Progresses in the studies on chemical constituents of Clematis L. (belonging to the family Ranunculaceae) were systematiically reviewed in this article. The plants in this genus have a wide spectrum of constituents as follows: triterpenes, flavonoids, lignans, coumarins, alkaloids, volatile oils, steroids, organic acids, macrocyclic compounds and phenols, etc., among which triterpenoid saponins, flavonoids and lignans are the main components. The triterpenoid saponins are mainly oleanolic type and hederagenin type, most of which are bidesmosidic saponins, substituted with oligosaccharide chains at both C-3 and C-28, and some are substituted with acetyl, caffeoyl, isoferuloyl, p-methoxy cinnamyl and 3,4-dimethoxy cinnamyl groups in the oligosaccharide chains. The flavonoids from Clematis species are mainly flavones, flavonols, flavanones, isoflavones, xanthones and their glucosides (sugar moieties are connected to the aglycone through either the oxygen or the carbon atoms), the aglycones of which are mainly apigenin, kaempferol, luteolin and quercetin. The lignans from Clematis are mainly eupomatene lignans, cyclolignans, monoepoxylignans, bisepoxylignans and lignanolides. Clematis spp. are rich in resources, however, studies on their chemical constituents have only been carried out on twenty or so spp. As a result, it is necessary to expand our study on other spp. from this genus for better utilization of medicinal resources.

  16. Diterpenes from the Marine Algae of the Genus Dictyota. (United States)

    Chen, Jiayun; Li, Hong; Zhao, Zishuo; Xia, Xue; Li, Bo; Zhang, Jinrong; Yan, Xiaojun


    Species of the brown algae of the genus Dictyota are rich sources of bioactive secondary metabolites with diverse structural features. Excellent progress has been made in the discovery of diterpenes possessing broad chemical defensive activities from this genus. Most of these diterpenes exhibit significant biological activities, such as antiviral, cytotoxic and chemical defensive activities. In the present review, we summarized diterpenes isolated from the brown algae of the genus.

  17. Comparative Genomics Reveals High Genomic Diversity in the Genus Photobacterium


    Henrique Machado; Henrique Machado; Lone Gram


    Vibrionaceae is a large marine bacterial family, which can constitute up to 50% of the prokaryotic population in marine waters. Photobacterium is the second largest genus in the family and we used comparative genomics on 35 strains representing 16 of the 28 species described so far, to understand the genomic diversity present in the Photobacterium genus. Such understanding is important for ecophysiology studies of the genus. We used whole genome sequences to evaluate phylogenetic relationship...

  18. Genus-two characters of the Ising model

    International Nuclear Information System (INIS)

    Choi, J.H.; Koh, I.G.


    As a first step in studying conformal theories on a higher-genus Riemann surface, we construct genus-two characters of the Ising model from their behavior in zero- and nonzero-homology pinching limits, the Goddard-Kent-Oliveco set-space construction, and the branching coefficients in the level-two A 1 /sup (1)/ Kac-Moody characters on the higher-genus Riemann surface


    Directory of Open Access Journals (Sweden)



    Full Text Available 1. Seven species of the genus Diplodiscus are described, of which three(D. microlepis, D. parviflorus and D. decumbens are new to science, and one (D. hookerianus was formerly described as Pentace (for the description of D. decumbens cf. p. 264.2. The area of distribution of the genus covers the Malay Peninsula,Borneo and the Philippines.3. The affinities of the genus are discussed.4. A key to the species is presented.

  20. A plastome primer set for comprehensive quantitative real time RT-PCR analysis of Zea mays: a starter primer set for other Poaceae species

    Directory of Open Access Journals (Sweden)

    Dunn Sade N


    Full Text Available Abstract Background Quantitative Real Time RT-PCR (q2(RTPCR is a maturing technique which gives researchers the ability to quantify and compare very small amounts of nucleic acids. Primer design and optimization is an essential yet time consuming aspect of using q2(RTPCR. In this paper we describe the design and empirical optimization of primers to amplify and quantify plastid RNAs from Zea mays that are robust enough to use with other closely related species. Results Primers were designed and successfully optimized for 57 of the 104 reported genes in the maize plastome plus two nuclear genes. All 59 primer pairs produced single amplicons after end-point reverse transcriptase polymerase chain reactions (RT-PCR as visualized on agarose gels and subsequently verified by q2(RTPCR. Primer pairs were divided into several categories based on the optimization requirements or the uniqueness of the target gene. An in silico test suggested the majority of the primer sets should work with other members of the Poaceae family. An in vitro test of the primer set on two unsequenced species (Panicum virgatum and Miscanthus sinensis supported this assumption by successfully producing single amplicons for each primer pair. Conclusion Due to the highly conserved chloroplast genome in plant families it is possible to utilize primer pairs designed against one genomic sequence to detect the presence and abundance of plastid genes or transcripts from genomes that have yet to be sequenced. Analysis of steady state transcription of vital system genes is a necessary requirement to comprehensively elucidate gene expression in any organism. The primer pairs reported in this paper were designed for q2(RTPCR of maize chloroplast genes but should be useful for other members of the Poaceae family. Both in silico and in vitro data are presented to support this assumption.

  1. Comparative Genomics of Bacteriophage of the Genus Seuratvirus

    DEFF Research Database (Denmark)

    Sazinas, Pavelas; Redgwell, Tamsin; Rihtman, Branko


    polB and terL showed these bacteriophages to be closely related to members of the genus Seuratvirus. We performed a core-gene analysis using the 14 new and four closely related genomes. A total of 58 core genes were identified, the majority of which has no known function. These genes were used...... to construct a core-gene phylogeny, the results of which confirmed the new isolates to be part of the genus Seuratvirus and expanded the number of species within this genus to four. All bacteriophages within the genus contained the genes queCDE encoding enzymes involved in queuosine biosynthesis. We suggest...

  2. Transfer of Methanolobus siciliae to the genus Methanosarcina, naming it Methanosarcina siciliae, and emendation of the genus Methanosarcina (United States)

    Ni, S.; Woese, C. R.; Aldrich, H. C.; Boone, D. R.


    A sequence analysis of the 16S rRNA of Methanolobus siciliae T4/M(T) (T = type strain) showed that this strain is closely related to members of the genus Methanosarcina, especially Methanosarcina acetivorans C2A(T). Methanolobus siciliae T4/M(T) and HI350 were morphologically more similar to members of the genus Methanosarcina than to members of the genus Methanolobus in that they both formed massive cell aggregates with pseudosarcinae. Thus, we propose that Methanolobus siciliae should be transferred to the genus Methanosarcina as Methanosarcina siciliae.

  3. Revised concept of the fossil genus Oviparosiphum Shaposhnikov, 1979 with the description of a new genus (Hemiptera, Sternorrhyncha, Aphidomorpha

    Directory of Open Access Journals (Sweden)

    Dagmara Żyła


    Full Text Available This paper presents a revision of the aphid genus Oviparosiphum, which is known from the Cretaceous period. Redescriptions of two species: O. jakovlevi Shaposhnikov, 1979 and O. baissense Shaposhnikov & Wegierek, 1989 are made, and an updated diagnosis of this genus is provided. Oviparosiphum baissense is the type species of a newly described genus Archeoviparosiphum gen. n. Five other species of Oviparosiphum are also transferred to the new genus. The basis for their separation from Oviparosiphum is the structure of the siphunculi and ovipositor. A key is provided to the genera of Oviparosiphidae.

  4. Review: Natural products from Genus Selaginella (Selaginellaceae

    Directory of Open Access Journals (Sweden)



    Full Text Available Setyawan AD. 2011. Natural products from Genus Selaginella (Selaginellaceae. Nusantara Bioscience 3: 44-58. Selaginella is a potent medicinal-stuff, which contains diverse of natural products such as alkaloid, phenolic (flavonoid, and terpenoid. This species is traditionally used to cure several diseases especially for wound, after childbirth, and menstrual disorder. Biflavonoid, a dimeric form of flavonoids, is the most valuable natural products of Selaginella, which constituted at least 13 compounds, namely amentoflavone, 2',8''-biapigenin, delicaflavone, ginkgetin, heveaflavone, hinokiflavone, isocryptomerin, kayaflavone, ochnaflavone, podocarpusflavone A, robustaflavone, sumaflavone, and taiwaniaflavone. Ecologically, plants use biflavonoid to response environmental condition such as defense against pests, diseases, herbivory, and competitions; while human medically use biflavonoid especially for antioxidant, anti-inflammatory, and anti carcinogenic. Selaginella also contains valuable disaccharide, namely trehalose that has long been known for protecting from desiccation and allows surviving severe environmental stress. The compound has very prospects as molecular stabilizer in the industries based bioresources.

  5. The genus Schoenoxiphium (Cyperaceae. A preliminary account

    Directory of Open Access Journals (Sweden)

    I. Kukkonen


    Full Text Available The genus Schoenoxiphium of the tribe Cariceae of Cyperaceae is conservatively accepted as being restricted to the African continent and Madagascar. The special features of the inflorescence structure are described. The following species are provisionally recognized: S. basutorum Turrill, S. distinctum Kukkonen, S. ecklonii Nees, S.  filiforme Kükenthal, S. gracile Chermezon, S. lanceum (Thunberg Kukenthal, S. lehmannii (Nees Steudel, S.  madagascariense Chermezon, S. perdensum Kukkonen, S. rufum Nees, S. schweickerdtii Merxmiiller & Podlech, and  S. sparteum (Wahlenberg Kukenthal. A key to the species is provided and their distribution is roughly outlined. The morphological variation within the species suggests separation of taxa below specific level, or perhaps even at species level, but this will require more detailed information about the ecology, distribution and the cytology.

  6. Marine worms (genus Osedax) colonize cow bones. (United States)

    Jones, William J; Johnson, Shannon B; Rouse, Greg W; Vrijenhoek, Robert C


    Bone-eating worms of the genus Osedax colonized and grew on cow bones deployed at depths ranging from 385 to 2893m in Monterey Bay, California. Colonization occurred as rapidly as two months following deployment of the cow bones, similar to the time it takes to colonize exposed whalebones. Some Osedax females found on the cow bones were producing eggs and some hosted dwarf males in their tubes. Morphological and molecular examinations of these worms confirmed the presence of six Osedax species, out of the eight species presently known from Monterey Bay. The ability of Osedax species to colonize, grow and reproduce on cow bones challenges previous notions that these worms are 'whale-fall specialists.'

  7. A revision of the genus Microtypus Ratzeburg (Hymenoptera: Braconidae)

    NARCIS (Netherlands)

    Čapek, M.; Achterberg, van C.


    The genus Microtypus Ratzeburg, 1848 (Braconidae: Microtypinae) is revised, its species are keyed, and a new species, M. petiolatus van Achterberg spec. nov. is described. The type species is redescribed and fully illustrated. The genus Similearinus Glowacki & Karpinski, 1967 is a new junior synonym

  8. Revision of the genus Trypeticus Marseul (Coleoptera: Histeridae)

    NARCIS (Netherlands)

    Kanaar, P.


    The genus Trypeticus Marseul, 1864 is revised and figured. A key to the species is given. Redescriptions of the hitherto described species are presented. The number of species in this genus has been brought up to 100, of which 72 species are described as new: T. adebratti (Sabah, Brunei), T.

  9. Development of DNA barcodes of genus Lygus Hahn (Hemiptera: Miridae) (United States)

    The genus Lygus (Hemiptera: Miridae) is an important group of insects that contains 43 known species worldwide. Some species within this genus are important agricultural pests in North America. Annual economic impacts in cotton, Gossypium hirsutum L., from Lygus spp. due to yield losses and control ...

  10. Quantum field theory on higher-genus Riemann surfaces

    International Nuclear Information System (INIS)

    Kubo, Reijiro; Yoshii, Hisahiro; Ojima, Shuichi; Paul, S.K.


    Quantum field theory for b-c systems is formulated on Riemann surfaces with arbitrary genus. We make use of the formalism recently developed by Krichever and Novikov. Hamiltonian is defined properly, and the Ward-Takahashi identities are derived on higher-genus Riemann surfaces. (author)

  11. Seiridium (Sporocadaceae): an important genus of plant pathogenic fungi

    NARCIS (Netherlands)

    Bonthond, G.; Sandoval-Denis, M.; Groenewald, J.Z.; Crous, P.W.


    The genus Seiridium includes multiple plant pathogenic fungi well-known as causal organisms of cankers on Cupressaceae. Taxonomically, the status of several species has been a topic of debate, as the phylogeny of the genus remains unresolved and authentic ex-type cultures are mostly absent. In the

  12. The neotropical genus Opeatocerata Melander (Díptera, Empididae

    Directory of Open Access Journals (Sweden)

    Kenneth G. V. Smith


    Full Text Available The Neotropical empidid genus Opeatocerata Melander, hitherto known from only a sigle female from Mexico, is redefined in the light of new material, including males. Three new species are described and illustrated, a key provided and the presence of the genus now additionally established in Costa Rica, Panama, Bolivia, Ecuador, Trinidad and Brazil.

  13. On the entropy of random surfaces with arbitrary genus

    International Nuclear Information System (INIS)

    Kostov, I.K.; Krzywicki, A.


    We calculate the susceptibility critical exponent γ for Polyakov random surfaces with arbitrary genus, using the Liouville theory to one-loop order. Some rigorous results obtained for special dimensionalities in a discrete version of the model are also noted. In all cases γ grows linearly with the genus of the surface. (orig.)

  14. Biological activities of species in the genus Tulbaghia : A review ...

    African Journals Online (AJOL)

    Species of the genus Tulbaghia has been widely used in traditional medicine to treat various ailments such rheumatism, fits, fever, earache, tuberculosis etc. It is believed that the species possess several therapeutic properties. This paper evaluates some of the biological activities of the genus Tulbaghia. It is evident from ...

  15. PCR identification of Fusarium genus based on nuclear ribosomal ...

    African Journals Online (AJOL)

    We have developed two taxon-selective primers for quick identification of the Fusarium genus. These primers, ITS-Fu-f and ITS-Fu-r were designed by comparing the aligned sequences of internal transcribed spacer regions (ITS) of a range of Fusarium species. The primers showed good specificity for the genus Fusarium, ...

  16. Natural genetic variation in Calligonum Tunisian genus analyzed by ...

    African Journals Online (AJOL)

    The Calligonum genus is one of the most economically important resources of the Tunisian desert, playing an important role in the lives of desert local population. A great range of genetic diversity could be seen in diverse populations of this genus which are spread all over Tunisian areas. DNA-based molecular markers are ...

  17. Torsionfree Sheaves over a Nodal Curve of Arithmetic Genus One

    Indian Academy of Sciences (India)

    We classify all isomorphism classes of stable torsionfree sheaves on an irreducible nodal curve of arithmetic genus one defined over C C . Let be a nodal curve of arithmetic genus one defined over R R , with exactly one node, such that does not have any real points apart from the node. We classify all isomorphism ...

  18. Genetic diversity within the genus Cynotilapia and its phylogenetic ...

    African Journals Online (AJOL)

    Cynotilapia's unicuspid teeth, a unique character used to delineate it from all other mbuna genera, leaves evolutionary biologists wondering which is the closest relative to this genus among mbuna cichlids. This genus has only two described species out of the 10-13 species/taxa, whereby the undescribed taxa are either ...

  19. Karyotype evolution and species differentiation in the genus Rattus ...

    African Journals Online (AJOL)

    Rattus is the most studied genus all over the world but species of the genus are not thoroughly reported from Manipur. The present paper deals with the morphometric, cytotaxonomic and phylogenetic studies of Manipur, India. The different species of Rattus namely Rattus rattus, Rattus brunneusculus, Rattus tanezumi and ...

  20. Phytochemical and Ethno-Pharmacological Review of the Genus ...

    African Journals Online (AJOL)

    Distribution, traditional uses, isolated chemical constituents and pharmacological activities of some common species of the genus Araucaria are reviewed in this paper. Almost 19 species belong to the genus, Araucaria. It is indigenous to North. America. Biflavanoid, diterpene, phenyl propanoid and lignans are abundant in ...

  1. Phylogeny of the genus Morus (Urticales: Moraceae) inferred from ...

    African Journals Online (AJOL)

    Both nuclear ribosomal ITS and chloroplast trnL-F sequences were acquired from 13 mulberry genotypes belonging to nine species and three varieties, and one paper mulberry. The later belongs to genus B. papyrifera, designed as outgroup, and were analyzed. Within the genus Morus, the sequence diversity of ITS was ...

  2. The Polyakov relation for the sphere and higher genus surfaces

    International Nuclear Information System (INIS)

    Menotti, Pietro


    The Polyakov relation, which in the sphere topology gives the changes of the Liouville action under the variation of the position of the sources, is also related in the case of higher genus to the dependence of the action on the moduli of the surface. We write and prove such a relation for genus 1 and for all hyperelliptic surfaces. (paper)

  3. Calongea, a new genus of truffles in the Pezizaceae (Pezizales) (United States)

    Rosanne A. Healy; Gregory Bonito; James M. Trappe


    Phylogenetic analysis of the ITS and LSU rDNA of Pachyphloeus species from Europe and North America revealed a new truffle genus. These molecular analyses plus sequences downloaded from a BLAST search in GenBank indicated that Pachyphloeus prieguensis is within the Pezizaceae but well outside of the genus Pachyphloeus...

  4. Non-abelian bosonization in higher genus Riemann surfaces

    International Nuclear Information System (INIS)

    Koh, I.G.; Yu, M.


    We propose a generalization of the character formulas of the SU(2) Kac-Moody algebra to higher genus Riemann surfaces. With this construction, we show that the modular invariant partition funciton of the SO(4) k = 1 Wess-Zumino model is equivalent, in arbitrary genus Riemann surfaces, to that of free fermion theory. (orig.)

  5. Florae Malesianae Precursores XXX. The genus Scleria in Malaysia

    NARCIS (Netherlands)

    Kern, J.H.


    After Boeckeler's treatise on the species of Scleria known in his day (5), no comprehensive study on the genus has ever been published. The preparation of an up-to-date monograph would be an arduous task, not only owing to the large size of the genus, but also to the numerous problems encountered in

  6. A taxonomic revision of the Genus Origanum (Labiatae)

    NARCIS (Netherlands)

    Ietswaart, J.H.


    The present study deals with the systematics and taxonomy of the genus Origanum (Labiatae, Saturejeae). As this difficult genus was never before monographed, a revisional study was much needed. The data presented are mainly based on the study of herbarium specimens and in some cases of living ones.

  7. The genus Gloriosa (Colchicaceae) : ethnobotany, phylogeny and taxonomy

    NARCIS (Netherlands)

    Maroyi, A.


    This thesis focuses on the ethnobotany, phylogeny and taxonomy of the genus Gloriosa L. over its distributional range. Some Gloriosa species are known to have economic and commercial value, but the genus is also well known for its complex alpha taxonomy. An appropriate taxonomy for this group is of

  8. Molecular phylogeny and taxonomy of the genus Veloporphyrellus (United States)

    Yan-Chun Li; Beatriz Ortiz-Santana; Nian-Kai Zeng; Bang Feng; Zhu L. Yang


    Veloporphyrellus is a genus known from North and Central America, southeastern Asia, and Africa. Because species of this genus are phenotypically similar to some taxa in several genera, such as Boletellus, Leccinum, Strobilomyces, Suillus and Tylopilus s.l. belonging to Boletales, its phylogenetic disposition has...

  9. The genus Architeuthis was erected, without giving any diagnosis ...

    African Journals Online (AJOL)


    The genus Architeuthis was erected, without giving any diagnosis, by Steenstrup in 1857 for a specimen stranded on the Danish coast in 1853. In 1880, Verrill gave the first description of the genus. Pfeffer (1912) related this history and also mentioned that traditional narratives and illustrations of the 16th century had.

  10. Notes on the genus Pirdana Distant, 1886 (Lepidoptera: Hesperiidae)

    NARCIS (Netherlands)

    Jong, de R.; Treadaway, C.G.


    In the Oriental genus Pirdana Distant, 1886, the new species P. fusca is described from Samar (E Philippines). The phylogeny of the genus is discussed and as a consequence the endemic Sulawesi taxon P. hyela ismene (Felder & Felder, [1867]) is given back its species rank, bringing the total number

  11. On RNA-RNA interaction structures of fixed topological genus. (United States)

    Fu, Benjamin M M; Han, Hillary S W; Reidys, Christian M


    Interacting RNA complexes are studied via bicellular maps using a filtration via their topological genus. Our main result is a new bijection for RNA-RNA interaction structures and a linear time uniform sampling algorithm for RNA complexes of fixed topological genus. The bijection allows to either reduce the topological genus of a bicellular map directly, or to lose connectivity by decomposing the complex into a pair of single stranded RNA structures. Our main result is proved bijectively. It provides an explicit algorithm of how to rewire the corresponding complexes and an unambiguous decomposition grammar. Using the concept of genus induction, we construct bicellular maps of fixed topological genus g uniformly in linear time. We present various statistics on these topological RNA complexes and compare our findings with biological complexes. Furthermore we show how to construct loop-energy based complexes using our decomposition grammar. Copyright © 2015 Elsevier Inc. All rights reserved.

  12. Analysis of synonymous codon usage patterns in the genus Rhizobium. (United States)

    Wang, Xinxin; Wu, Liang; Zhou, Ping; Zhu, Shengfeng; An, Wei; Chen, Yu; Zhao, Lin


    The codon usage patterns of rhizobia have received increasing attention. However, little information is available regarding the conserved features of the codon usage patterns in a typical rhizobial genus. The codon usage patterns of six completely sequenced strains belonging to the genus Rhizobium were analysed as model rhizobia in the present study. The relative neutrality plot showed that selection pressure played a role in codon usage in the genus Rhizobium. Spearman's rank correlation analysis combined with correspondence analysis (COA) showed that the codon adaptation index and the effective number of codons (ENC) had strong correlation with the first axis of the COA, which indicated the important role of gene expression level and the ENC in the codon usage patterns in this genus. The relative synonymous codon usage of Cys codons had the strongest correlation with the second axis of the COA. Accordingly, the usage of Cys codons was another important factor that shaped the codon usage patterns in Rhizobium genomes and was a conserved feature of the genus. Moreover, the comparison of codon usage between highly and lowly expressed genes showed that 20 unique preferred codons were shared among Rhizobium genomes, revealing another conserved feature of the genus. This is the first report of the codon usage patterns in the genus Rhizobium.

  13. Genomes-based phylogeny of the genus Xanthomonas

    Directory of Open Access Journals (Sweden)

    Rodriguez-R Luis M


    Full Text Available Abstract Background The genus Xanthomonas comprises several plant pathogenic bacteria affecting a wide range of hosts. Despite the economic, industrial and biological importance of Xanthomonas, the classification and phylogenetic relationships within the genus are still under active debate. Some of the relationships between pathovars and species have not been thoroughly clarified, with old pathovars becoming new species. A change in the genus name has been recently suggested for Xanthomonas albilineans, an early branching species currently located in this genus, but a thorough phylogenomic reconstruction would aid in solving these and other discrepancies in this genus. Results Here we report the results of the genome-wide analysis of DNA sequences from 989 orthologous groups from 17 Xanthomonas spp. genomes available to date, representing all major lineages within the genus. The phylogenetic and computational analyses used in this study have been automated in a Perl package designated Unus, which provides a framework for phylogenomic analyses which can be applied to other datasets at the genomic level. Unus can also be easily incorporated into other phylogenomic pipelines. Conclusions Our phylogeny agrees with previous phylogenetic topologies on the genus, but revealed that the genomes of Xanthomonas citri and Xanthomonas fuscans belong to the same species, and that of Xanthomonas albilineans is basal to the joint clade of Xanthomonas and Xylella fastidiosa. Genome reduction was identified in the species Xanthomonas vasicola in addition to the previously identified reduction in Xanthomonas albilineans. Lateral gene transfer was also observed in two gene clusters.

  14. Mitochondrial DNA evolution in the genus Equus. (United States)

    George, M; Ryder, O A


    Employing mitochondrial DNA (mtDNA) restriction-endonuclease maps as the basis of comparison, we have investigated the evolutionary affinities of the seven species generally recognized as the genus Equus. Individual species' cleavage maps contained an average of 60 cleavage sites for 16 enzymes, of which 29 were invariant for all species. Based on an average divergence rate of 2%/Myr, the variation between species supports a divergence of extant lineages from a common ancestor approximately 3.9 Myr before the present. Comparisons of cleavage maps between Equus przewalskii (Mongolian wild horse) and E. caballus (domestic horse) yielded estimates of nucleotide sequence divergence ranging from 0.27% to 0.41%. This range was due to intraspecific variation, which was noted only for E. caballus. For pairwise comparisons within this family, estimates of sequence divergence ranged from 0% (E. hemionus onager vs. E. h. kulan) to 7.8% (E. przewalskii vs. E. h. onager). Trees constructed according to the parsimony principle, on the basis of 31 phylogenetically informative restriction sites, indicate that the three extant zebra species represent a monophyletic group with E. grevyi and E. burchelli antiquorum diverging most recently. The phylogenetic relationships of E. africanus and E. hemionus remain enigmatic on the basis of the mtDNA analysis, although a recent divergence is unsupported.

  15. The genus Cuscuta L. in East Asia

    Directory of Open Access Journals (Sweden)

    E. V. Aistova


    Full Text Available On the basis of published data, herbarium collections  and  our  own  research  the  overview  of  the spread  of  7  dodder  species  (genus  Cuscuta  on  the territory of  of the Russian Far East and East Asia is given. The  history  of  research  dodders  on  the  territory  of  the Russian Far East, ecological and spreading peculiarities are described. Certain eurytopic species (C. campestris Yunck., C. japonica Choisy and C. europaea L. growing on the territory of the Russian Far East have plasticity and  rapid  adaptive  response  for  changing  ecological and  geographical  conditions.  C.  epilinum  Weihe, C. epithymum (L. Nathh., C. tinei Insenga have not been naturalized in the Russian Far East.

  16. American Tertiary mollusks of the genus Clementia (United States)

    Woodring, W.P.


    Aside from its value as an aid in determining the age of Tertiary beds, the chief interest of the genus Clementia lies in the anomalous features of its present and former distribution. An attempt is made in this paper to trace its geologic history, to point out its paleobiologic significance, and to describe all the known American Tertiary species. The fossils from Colombia used in preparing this report were collected during explorations made under the direction of Dr. 0. B. Hopkins, chief geologist of the Imperial Oil Co. (Ltd.), who kindly donated them to the United States National Museum. Dr. T. Wayland Vaughan, of the Scripps Institution of Oceanography, furnished information relating to specimens collected by him in Mexico. Dr. Bruce L. Clark, of the University of California; Dr. G. Dallas Hanna, of the California Academy of Sciences; Dr. H. A. Pilsbry, of the Philadelphia Academy of Natural Sciences; and Dr. W. D. Matthew, of the American Museum of Natural History, generously loaned type specimens and other material. Doctor Clark and Doctor Hanna also gave information concerning the Tertiary species from California. Mr. Ralph B. Stewart, of the University of California, read the manuscript, and I have taken advantage of his suggestions. I am also indebted to Mr. L. R. Cox, of the British Museum, for information relating to the fossil species from Persia, Zanzibar, and Burma, and to Dr. Axel A. Olsson, of the International Petroleum Co., for data concerning undescribed Tertiary species from Peru.

  17. Sutorius: a new genus for Boletus eximius. (United States)

    Halling, Roy E; Nuhn, Mitchell; Fechner, Nigel A; Osmundson, Todd W; Soytong, Kasem; Arora, David; Hibbett, David S; Binder, Manfred


    Sutorius is described as a new genus of Boletaceae to accommodate Boletus robustus originally named illegitimately by C.C. Frost from eastern North America. The legitimate name, Boletus eximius, provided by C.H. Peck, has been used since for a dark purple to chocolate brown bolete with finely scaly stipe and reddish brown spore deposit. This iconic taxon has been documented on five continents. Despite the straightforward species identification from morphology, the interpretation of stipe macro-morphology and spore color has led to equivocal generic placement. Phylogenetic analyses of genes encoding large subunit rRNA and translation elongation factor 1α confirm Sutorius as a unique generic lineage in the Boletaceae. Two species are recognized based on multiple accessions: S. eximius, represented by collections from North America, Costa Rica, Guyana, Indonesia and Japan (molecular data are lacking for only the Guyanan and Japanese material); and S. australiensis, represented by material from Queensland, Australia. Additional collections from Zambia and Thailand represent independent lineages, but sampling is insufficient to describe new species for these entities.

  18. On the toroidal compactifications of bosonic strings in higher genus

    International Nuclear Information System (INIS)

    Semikhatov, A.M.


    For the bosonic string in a higher genus, compactified on the maximal torus of a simply laced Lie group, we discuss a possibility to construct an operator formalism involving only those operators that are well-defined globally over the whole Riemann surface. We find, in particular, higher genus extensions of (some combinations of) the vertex operators for the Kac-Moody algebra. This allows us to derive the relation between the Sugawara and Virasoro constructions of the energy-momentum tensor on Riemann surfaces, and to propose an operator mechanism underlying the construction of group current correlation functions in higher genus. (orig.)

  19. Early Homo and the role of the genus in paleoanthropology. (United States)

    Villmoare, Brian


    The history of the discovery of early fossils attributed to the genus Homo has been contentious, with scholars disagreeing over the generic assignment of fossils proposed as members of our genus. In this manuscript I review the history of discovery and debate over early Homo and evaluate the various taxonomic hypotheses for the genus. To get a sense of how hominin taxonomy compares to taxonomic practice outside paleoanthropology, I compare the diversity of Homo to genera in other vertebrate clades. Finally, I propose a taxonomic model that hews closely to current models for hominin phylogeny and is consistent with taxonomic practice across evolutionary biology. © 2018 American Association of Physical Anthropologists.

  20. Review of the Genus Pimpla (Hymenoptera: Ichneumonidae: Pimplinae from Korea

    Directory of Open Access Journals (Sweden)

    Jin-Kyung Choi


    Full Text Available We reviewed Korean species of the genus Pimpla and confirmed 12 species. In this genus, 36 species have been reported from the Eastern Palaearctic region, eight species were from Korea. Also, we report four species, Pimpla albociliata Kasparyan, 1974, Pimpla femorella Kasparyan, 1974, Pimpla kaszabi (Momoi, 1973 and Pimpla melanacrias Perkins, 1941, which were newly recorded for the first time from Korea. Among them, Pimpla nipponica Uchida, 1928 is recorded from United States and the Nearctic region for the first time. A key to Korean species of the genus Pimpla, diagnoses and illustrations of adult external structures are provided.

  1. Diversity of secondary metabolites from Genus Artocarpus (Moraceae

    Directory of Open Access Journals (Sweden)



    Full Text Available Hakim A. 2010. The diversity of secondary metabolites from Genus Artocarpus (Moraceae. Nusantara Bioscience 2:146-156. Several species of the Artocarpus genus (Moraceae have been investigated their natural product. The secondary metabolites successfully being isolatad from Artocarpus genus consist of terpenoid, flavonoids, stilbenoid, arylbenzofuran, neolignan, and adduct Diels-Alder. Flavonoid group represent the compound which is the most found from Artocarpus plant. The flavonoids compound which are successfully isolated from Artocarpus plant consist of the varied frameworks like chalcone, flavanone, flavan-3-ol, simple flavone, prenylflavone, oxepinoflavone, pyranoflavone, dihydrobenzoxanthone, furanodihydrobenzoxanthone, pyranodihydrobenzoxanthone, quinonoxanthone, cyclopentenoxanthone, xanthonolide, dihydroxanthone.

  2. Abradeosporangium, a new genus of Mucorales (Fungi: Zygomycetes from India

    Directory of Open Access Journals (Sweden)

    A. Subrahmanyam


    Full Text Available Abradeosporangium, a new genus of Mucorales with its type species A. variosporum, is described from India. The new genus is distinct in producing dimorphic sporangia and multispored, acolumellate and globose macrosporangia with persistent, thin peridium. Sparingly, portions of the sporangial wall at the top and bottom of the sporangia are dissolved at maturity to release the sporangiospores whilst, in its close ally Gilbertella, the sporangium breaks open via a longitudinal suture. Further, the smaller sporangia (microsporangia are without a longitudinal suture and produce variable number of spores. The sporangiospores are pale brown, longitudinally striated without any appendages. Besides, the new genus produces neither rhizoids nor zygospores.

  3. High degree of genetic diversity among genotypes of the forage grass Brachiaria ruziziensis (Poaceae) detected with ISSR markers. (United States)

    Azevedo, A L S; Costa, P P; Machado, M A; de Paula, C M P; Sobrinho, F S


    The grasses of the genus Brachiaria account for 80% of the cultivated pastures in Brazil. Despite its importance for livestock production, little information is available for breeding purposes. Embrapa has a population of B. ruziziensis from different regions of Brazil, representing most of existing variability. This population was used to initiate an improvement program based on recurrent selection. In order to assist the genetic improvement program, we estimated the molecular variability among 93 genotypes of Embrapa's collection using ISSR (inter-simple sequence repeat) markers. DNA was extracted from the leaves. Twelve ISSR primers generated 89 polymorphic bands in the 93 genotypes. The number of bands identified by each primer ranged from two to 13, with a mean of 7.41. Cluster analysis revealed a clearly distinct group, containing most of the B. ruziziensis genotypes apart from the outgroup genotypes. Genetic similarity coefficients ranged from 0.0 to 0.95, with a mean of 0.50 and analysis of molecular variance indicated higher variation within (73.43%) than among species (26.57%). We conclude that there is a high genetic diversity among these B. ruziziensis genotypes, which could be explored by breeding programs.

  4. Invertebrate fauna associated with Torpedograss, Panicum repens (Cyperales: Poaceae), in Lake Okeechobee, Florida, and prospects for biological control

    International Nuclear Information System (INIS)

    Cuda, J.P.; Dunford, J.C.; Leavengood, J.M. Jr.


    Torpedograss, Panicum repens L., is an adventive, rhizomatous grass species that has become an invasive weed of terrestrial, wetland, and aquatic environments in tropical and subtropical regions worldwide. Until recently, strategies for controlling torpedograss in the USA have focused almost exclusively on mechanical and chemical methods, either alone or in combination, with varied results. A survey of the arthropods and nematodes currently associated with the plant in Lake Okeechobee, Florida, was conducted as part of a feasibility study to determine whether torpedograss is an appropriate target for a classical biological control program. Overall, approximately 4,000 arthropods and 400 nematode specimens were collected. Sweep, clipped vegetation, and soil core samples were dominated by representatives of the arthropod orders Hemiptera, Hymenoptera, Diptera, and Acari. Lesion nematodes of the genus Pratylenchus were commonly associated with the roots of torpedograss. None of the organisms collected were torpedograss specialists. Although classical biological control of torpedograss is feasible based on the extent of the infestation, economic losses, resistance to conventional controls, and the report of a potentially host specific natural enemy in India, the botanical position of this grass weed will require a formal risk assessment before proceeding with a classical biological control program. (author) [es

  5. Sinopse das espécies nativas e subespontâneas de Andropogoneae Dumort. (Poaceae na Ilha de Santa Catarina, Brasil A synopsis of the Andropogoneae Dumort. (Poaceae native and subspontaneous to the Island of Santa Catarina, Florianópolis, SC, Brazil

    Directory of Open Access Journals (Sweden)

    Bárbara Toncic Neves


    Full Text Available O presente trabalho consiste no levantamento dos táxons da tribo Andropogoneae (Panicoideae - Poaceae ocorrentes na Ilha de Santa Catarina, Florianópolis, Brasil. A partir da revisão de materiais de herbários e coletas a campo foi confirmada a ocorrência de 10 gêneros e 20 espécies, 17 nativas e duas subespontâneas: Andropogon L. (7 spp., Bothriochloa Kuntze (2, Eriochrysis P. Beauv. (1, Hyparrhenia Andersson ex E. Fourn. (1, Imperata Cirillo (1, Ischaemum L. (1, Rhytachne Desv. (1, Saccharum L. (3, Schizachyrium Nees (2 e Sorghum Moench (1. Os gêneros Bothriochloa e Rhytachne são registrados pela primeira vez para a Ilha de Santa Catarina. São apresentadas chaves de identificação para gêneros e espécies, ilustrações, informações sobre distribuição geográfica, habitat, período de floração e comentários para cada táxon.The present work is a survey of the taxa in the tribe Andropogoneae (Panicoideae - Poaceae that occur on the Island of Santa Catarina, Florianópolis, Brazil. Based on a review of herbarium specimens and fieldwork, 20 species were recorded in the following 10 genera: Andropogon L. (7 spp., Bothriochloa Kuntze (2, Eriochrysis P. Beauv. (1, Hyparrhenia Andersson ex E. Fourn. (1, Imperata Cirillo (1, Ischaemum L. (1, Rhytachne Desv. (1, Saccharum L. (3, Schizachyrium Nees (2 and Sorghum Moench (1. Seventeen of the species are native, and two species are subspontaneous. Bothriochloa and Rhytachne are recorded here, for the first time, for the Island of Santa Catarina. This work provides key to the genera and species, as well as illustrations, information about geographic distribution, habitat, phenology, and comments about each taxon presented in the study.

  6. Atividade de glutationa S-transferase na metabolização de acetochlor, atrazine e oxyfluorfen em milho (Zea mays L., sorgo (Sorghum bicolor L. e trigo (Triticum aestivum L. (Poaceae Glutathione S-transferase activity in acetochlor, atrazine and oxyfluorfen metabolization in maize (Zea mays L., sorghum (Sorghum bicolor L. and wheat (Triticum aestivumL. (Poaceae

    Directory of Open Access Journals (Sweden)

    Ethel Lourenzi Barbosa Novelli


    Full Text Available Este experimento foi conduzido para avaliar a seletividade em plantas dos herbicidas acetochlor, atrazine e oxyfluorfen em relação à atividade da glutationa S-transferase (GST em plantas de milho (Zea mays L., sorgo (Sorghum bicolor L. e trigo (Triticum aestivum L. (Poaceae. A atividade da GST foi detectada às 24, 48 e 72 horas após as aplicaç��es dos tratamentos. Os tratamentos do experimento consistiram de aplicação com água (controle, acetochlor (3 L.ha-1, atrazine (4 L.ha-1 e oxyfluorfen (1 L.ha-1. As maiores atividades de GST foram observadas na presença de acetochlor, principalmente às 48 horas após o tratamento. Esses aumentos foram 105, 148 e 118% em relação ao controle para milho, sorgo e trigo, respectivamente. É sugerido que a GST pode ter papel na degradação de acetochlor e pode ser uma das razões para a seletividade desse herbicida para essas culturas.This experiment was conducted to evaluate the acetochlor, atrazine and oxyfluorfen herbicides plant selectivity, in relation to glutathione S-transferase activity (GST in maize (Zea mays L., sorghum (Sorghum bicolor L. and wheat (Triticum aestivum L (Poaceae plants. GST activity was detected 24, 48 and 72 hours after treatment applications. The experiment's treatments consisted of spraying plants with water (control, acetochlor (3 L.ha-1`, atrazine (4 L.ha-1 and oxyfluorfen (1 L.ha-1. The highest GST activities were observed in presence of acetochlor, mainly at 48 hours after treatment. These increments were 105, 148 and 118% when compared to maize, sorghum and wheat control groups, respectively. It is suggested that the GST may have a role in acetochlor degradation and it may be a reason for this herbicide's selectivity in these crops.

  7. Warionia (Asteraceae: a relict genus of Cichorieae?

    Directory of Open Access Journals (Sweden)

    Katinas, Liliana


    Full Text Available The genus Warionia, with its only species W. saharae, is endemic to the northwestern edge of the African Sahara desert. This is a somewhat thistle-like aromatic plant, with white latex, and fleshy, pinnately- partite leaves. Warionia is in many respects so different from any other genus of Asteraceae, that it has been tentatively placed in the tribes Cardueae, Cichorieae, Gundelieae, and Mutisieae. Until now, a comprehensive study of Warionia to have a complete context for discussing its taxonomic position is lacking. The general morphology, anatomy, palynology and chromosome number of W. saharae are investigated here, and the species is described and illustrated. Laticifers in leaves and stems indicate a relationship with Cichorieae, and are associated with the phloem, in contact with it or with the surrounding sclerenchyma sheath. The pollen features indicate a strong relation with Cardueae, namely the structure with Anthemoid pattern where the columellae are joined to the foot layer, the ectosexine with thin columellae, the endosexine with stout and ramified columellae, the conspicuous spines with globose bases and conspicuous apical channels, and the tectum surface very perforate. Chromosomal counts resulted in 2n = 34. The morphological and palynological evidence positions Warionia between the tribes Cardueae and Cichorieae suggesting that it could be a remnant of the ancestral stock that gave rise to both tribes.El género Warionia, y su única especie, W. saharae, es endémico del noroeste del desierto africano del Sahara. Es una planta semejante a un cardo, aromática, con látex blanco y hojas carnosas, pinnatipartidas. Warionia es tan diferente de otros géneros de Asteraceae que fue ubicada en las tribus Cardueae, Cichorieae, Gundelieae y Mutisieae. Hasta ahora, no existía un estudio global de Warionia como contexto para discutir su posición taxonómica. Se ha investigado aquí su morfología, anatomía, palinología y n

  8. The Genus Asparagus in Southern Africa*

    Directory of Open Access Journals (Sweden)

    J. P. Jessop


    Full Text Available A revision of the genus Asparagus in South Africa, South West Africa, Bechuanaland, Basutoland, and Swaziland has been undertaken. Notes are given on the value of most o f the characters which have been used in the separation of species, recent literature on the nature of  Asparagus assimilatory organs, and a technique for the examination of chromosomes. Chromosome counts are listed for ten taxa. There is a key to the forty species and four varieties. In the main part of the work these taxa are described, and their synonymy, taxonomy, distribution and habitats dealt with. Six species and one variety are new. The following are the new species and combinations:  A. setaceus (Kunth (Asparagopsis setacea Kunth, A. mueronatus, A. macowanii Bak. var. zuluensis (N. E. Br.  (A. zuluensis N. E. Br., A. rigidus, A. densiflorus (Kunth  {Asparagopsis densiflora Kunth,  A. aethiopicus L. var. angusticladus, A. falcatus L. var. ternifolius (Bak.  (A. aethiopicus L. var.  ternifolius Bak.,  A. aspergillus,  A. obermeyerae,  A. krebsianus (Kunth (Asparagopsis krebsiana Kunth,  A. acocksii.  A. crassicladus. Several plants o f horticultural importance occur in South Africa. The three best known are A. plumosus, which is reduced here to synonymy under  A. setaceus (Kunth Jessop, and  A. sprengeri and  A. myersii. A. sprengeri is being reduced to synonymy under  A. densiflorus (Kunth Jessop,.  A. myersii, which is a  nomen nudum, is also regarded as belonging to  A. densiflorus.

  9. Occurrence of genus Monostroma (Ulvales, Chlorophyta) from Ratnagiri (Maharashtra)

    Digital Repository Service at National Institute of Oceanography (India)

    Untawale, A; Agadi, V.V.; Dhargalkar, V.K.

    The occurrence of a genus Monostroma has been recorded from the Shirgaon creek at Ratnagiri along the central west coast of India. The Monostroma sp. was found in the brackish water environment with low salinity, high nutrients and thick mangrove...

  10. Anticancer Activity Of Plant Genus Clerodendrum (Lamiaceae: A Review

    Directory of Open Access Journals (Sweden)

    Donald Emilio Kalonio


    Full Text Available Plants of the genus Clerodendrum (Lamiaceae is widespread in tropical and subtropical regions. Plants of this genus are used both empirically and scientifically as anti-inflammatory, antidiabetic, antimalarial, antiviral, antihypertensive, hypolipidemic, antioxidant, and antitumor. Results of the molecular docking simulation of chemical content of these plants could potentially provide an anticancer effect. This paper aims to review the anticancer activity of plant genus Clerodendrum based on scientific data. The method used in this study is the literature study. Searches were conducted online (in the database PubMed, Science Direct and Google Scholar and on various books (Farmakope Herbal Indonesia and PROSEA. A total 12 plants of the genus Clerodendrum have anticancer activity in vitro and in vivo, thus potentially to be developed as a source of new active compounds with anticancer activity.

  11. Higher genus correlators from the hermitian one-matrix model

    International Nuclear Information System (INIS)

    Ambjoern, J.; Chekhov, L.; Makeenko, Yu.


    We develop an iterative algorithm for the genus expansion of the hermitian NxN one-matrix model (is the Penner model in an external field). By introducing moments of the external field, we prove that the genus g contribution to the m-loop correlator depends only on 3g-2+m lower moments (3g-2 for the partition function). We present the explicit results for the partition function and the one-loop correlator in genus one. We compare the correlators for the hermitian one-matrix model with those at zero momenta for c=1 CFT and show an agreement of the one-loop correlators for genus zero. (orig.)

  12. Comparative Genomics Reveals High Genomic Diversity in the Genus Photobacterium

    DEFF Research Database (Denmark)

    Machado, Henrique; Gram, Lone


    was widespread and abundant in the genus, suggesting a role in genomic evolution. The high genetic variability and indications of genetic exchange make it difficult to elucidate genome evolutionary paths and raise the awareness of the roles of foreign DNA in the genomic evolution of environmental organisms.......Vibrionaceae is a large marine bacterial family, which can constitute up to 50% of the prokaryotic population in marine waters. Photobacterium is the second largest genus in the family and we used comparative genomics on 35 strains representing 16 of the 28 species described so far, to understand...... the genomic diversity present in the Photobacterium genus. Such understanding is important for ecophysiology studies of the genus. We used whole genome sequences to evaluate phylogenetic relationships using several analyses (16S rRNA, MLSA, fur, amino-acid usage, ANI), which allowed us to identify two...

  13. Rational Points on Curves of Genus 2: Experiments and Speculations


    Stoll, Michael


    I will present results of computations providing statistics on rational points on (small) curves of genus 2 and use them to present several conjectures. Some of them are based on heuristic considerations, others are not.

  14. Degenerate conformal theories on higher-genus surfaces

    International Nuclear Information System (INIS)

    Gerasimov, A.A.


    Two-dimensional degenerate field theories on higher-genus surfaces are investigated. Objects are built on the space of moduli, whose linear combinations are hypothetically conformal blocks in degenerate theories

  15. Complete genome sequences of six strains of the genus methylobacterium

    Energy Technology Data Exchange (ETDEWEB)

    Marx, Christopher J [Harvard University; Bringel, Francoise O. [University of Strasbourg; Christoserdova, Ludmila [University of Washington, Seattle; Moulin, Lionel [UMR, France; Farhan Ul Haque, Muhammad [CNRS, Strasbourg, France; Fleischman, Darrell E. [Wright State University, Dayton, OH; Gruffaz, Christelle [CNRS, Strasbourg, France; Jourand, Philippe [UMR, France; Knief, Claudia [ETH Zurich, Switzerland; Lee, Ming-Chun [Harvard University; Muller, Emilie E. L. [CNRS, Strasbourg, France; Nadalig, Thierry [CNRS, Strasbourg, France; Peyraud, Remi [ETH Zurich, Switzerland; Roselli, Sandro [CNRS, Strasbourg, France; Russ, Lina [ETH Zurich, Switzerland; Aguero, Fernan [Universidad Nacional de General San Martin; Goodwin, Lynne A. [Los Alamos National Laboratory (LANL); Ivanova, N [U.S. Department of Energy, Joint Genome Institute; Kyrpides, Nikos C [U.S. Department of Energy, Joint Genome Institute; Lajus, Aurelie [Genoscope/Centre National de la Recherche Scientifique-Unite Mixte de Recherche; Land, Miriam L [ORNL; Medigue, Claudine [Genoscope/Centre National de la Recherche Scientifique-Unite Mixte de Recherche; Mikhailova, Natalia [U.S. Department of Energy, Joint Genome Institute; Nolan, Matt [U.S. Department of Energy, Joint Genome Institute; Woyke, Tanja [U.S. Department of Energy, Joint Genome Institute; Stolyar, Sergey [University of Washington; Vorholt, Julia A. [ETH Zurich, Switzerland; Vuilleumier, Stephane [University of Strasbourg


    The complete and assembled genome sequences were determined for six strains of the alphaproteobacterial genus Methylobacterium, chosen for their key adaptations to different plant-associated niches and environmental constraints.

  16. Complete Genome Sequences of Six Strains of the Genus Methylobacterium

    Energy Technology Data Exchange (ETDEWEB)

    Marx, Christopher J [Harvard University; Bringel, Francoise O. [University of Strasbourg; Christoserdova, Ludmila [University of Washington, Seattle; Moulin, Lionel [UMR, France; UI Hague, Muhammad Farhan [University of Strasbourg; Fleischman, Darrell E. [Wright State University, Dayton, OH; Gruffaz, Christelle [CNRS, Strasbourg, France; Jourand, Philippe [UMR, France; Knief, Claudia [ETH Zurich, Switzerland; Lee, Ming-Chun [Harvard University; Muller, Emilie E. L. [CNRS, Strasbourg, France; Nadalig, Thierry [CNRS, Strasbourg, France; Peyraud, Remi [ETH Zurich, Switzerland; Roselli, Sandro [CNRS, Strasbourg, France; Russ, Lina [ETH Zurich, Switzerland; Goodwin, Lynne A. [Los Alamos National Laboratory (LANL); Ivanov, Pavel S. [University of Wyoming, Laramie; Ivanova, N [U.S. Department of Energy, Joint Genome Institute; Kyrpides, Nikos C [U.S. Department of Energy, Joint Genome Institute; Lajus, Aurelie [Genoscope/Centre National de la Recherche Scientifique-Unite Mixte de Recherche; Land, Miriam L [ORNL; Medigue, Claudine [Genoscope/Centre National de la Recherche Scientifique-Unite Mixte de Recherche; Mikhailova, Natalia [U.S. Department of Energy, Joint Genome Institute; Nolan, Matt [U.S. Department of Energy, Joint Genome Institute; Woyke, Tanja [U.S. Department of Energy, Joint Genome Institute; Stolyar, Sergey [University of Washington; Vorholt, Julia A. [ETH Zurich, Switzerland; Vuilleumier, Stephane [University of Strasbourg


    The complete and assembled genome sequences were determined for six strains of the alphaproteobacterial genus Methylobacterium, chosen for their key adaptations to different plant-associated niches and environmental constraints.

  17. A new genus and species of Ceratocanthidae from Tanzania ...

    African Journals Online (AJOL)

    Coleoptera: Scarabaeoidea) from the Usambara Mountains (Tanzania), is described. The morphology of the clypeus and mesoepisternum is discussed, also with reference to other Ceratocanthidae. The affinities of the genus are discussed, and ...

  18. New evidence of homoplasy within the African genus Varicorhinus ...

    African Journals Online (AJOL)

    New evidence of homoplasy within the African genus Varicorhinus (Cyprinidae): an independent origin of specialized scraping forms in the adjacent drainage systems of Ethiopia inferred from mtDNA analysis.

  19. BRST quantization of superconformal theories on higher genus Riemann surfaces

    International Nuclear Information System (INIS)

    Leman Kuang


    A complex contour integral method is constructed and applied to the Becchi-Rouet-Stora-Tyutin (BRST) quantization procedure of string theories on higher genus Riemann surfaces with N=0 and 1 Krichever-Novikov (KN) algebras. This method makes calculations very simple. It is shown that the critical spacetime dimension of the string theories on a genus-g Riemann surface equals that of the string theories on a genus-zero Riemann surface, and that the 'Regge intercepts' in the genus-g case are α(g)=1-3/4g-9/8g 2 and 1/2-3/4g-17/16g 2 for bosonic strings and superstrings, respectively. (orig.)

  20. Some enigmatic aspects of the marine cyanobacterial genus, Trichodesmium

    Digital Repository Service at National Institute of Oceanography (India)

    Bhat, S.R.; Verlecar, X.N.

    Trichodesmium, an important nitrogen fixing marine genus has some coupled features that appear contrasting, either in their operational requirements or ecological dominance e.g. N2 fixation and photosynthesis take place in the same trichome, former...

  1. Title: Inventory of the genus Craterellus from Tanzania

    African Journals Online (AJOL)


    Table 1: Described species in the genus Craterellus Persoon as of year 2017. S/ ..... lamps. Each observed mushroom was photographed insitu, prior to picking from .... with other chanterelle mushrooms in the open market in the region.

  2. Cross-genus amplification and characterisation of microsatellite loci ...

    African Journals Online (AJOL)

    Cross-genus amplification and characterisation of microsatellite loci in the little free tailed bat, Chaerephon pumilus s. l. (Molossidae) from South Eastern Africa. Theshnie Naidoo, Angus Macdonald, Jennifer M Lamb ...

  3. Evolution and host specificity in the ectomycorrhizal genus Leccinum

    NARCIS (Netherlands)

    Bakker, den H.C.; Zuccarello, G.C.; Kuyper, T.W.; Noordeloos, M.E.


    Species of the ectomycorrhizal genus Leccinum are generally considered to be host specialists. We determined the phylogenetic relationships between species of Leccinum from Europe and North America based on second internal transcribed spacer (ITS2) and glyceraldehyde 3-phosphate dehydrogenase

  4. Title: Inventory of the genus Craterellus from Tanzania

    African Journals Online (AJOL)


    This study presents a preliminary inventory of the genus ... INTRODUCTION. Miombo ..... Sampling methods complies with that of. Tibuhwa (2010 ... in the floor of mixed miombo woodland species in ..... 2000 Concise description of Craterellus.

  5. A new caddisfly genus (Trichoptera, Odontoceridae) from Vietnam (United States)

    Arefina-Armitage, Tatiana I.; Armitage, Brian J.


    Abstract Cephalopsyche, a new genus of caddisfly (Trichoptera, Odontoceridae), is described from Vietnam. Two new species are placed in the genus: Cephalopsyche gorgona sp. n. and Cephalopsyche neboissi sp. n. The adult male and female of each species exhibit distinct sexual dimorphism, especially in head morphology. In males, there are hinged, chamber-like structures on the vertex of the head, containing filamentous, columnar tissue when exposed. Descriptions and illustrations of both species are provided. PMID:21594025

  6. A new caddisfly genus (Trichoptera, Odontoceridae from Vietnam

    Directory of Open Access Journals (Sweden)

    Tatiana Arefina-Armitage


    Full Text Available Cephalopsyche, a new genus of caddisfly (Trichoptera, Odontoceridae, is described from Vietnam. Two new species are placed in the genus: Cephalopsyche gorgona sp. n. and Cephalopsyche neboissi sp. n. The adult male and female of each species exhibit distinct sexual dimorphism, especially in head morphology. In males, there are hinged, chamber-like structures on the vertex of the head, containing filamentous, columnar tissue when exposed. Descriptions and illustrations of both species are provided.

  7. Evidence for Ecological Flexibility in the Cosmopolitan Genus Curtobacterium


    Chase, Alexander B.; Arevalo, Philip; Polz, Martin F.; Berlemont, Renaud; Martiny, Jennifer B. H.


    Assigning ecological roles to bacterial taxa remains imperative to understanding how microbial communities will respond to changing environmental conditions. Here we analyze the genus Curtobacterium as it was found to be the most abundant taxon in a leaf litter community in southern California. Traditional characterization of this taxon predominantly associates it as the causal pathogen in the agricultural crops of dry beans. Therefore, we seek to conduct a broad investigation into this genus...

  8. Higher Genus Abelian Functions Associated with Cyclic Trigonal Curves

    Directory of Open Access Journals (Sweden)

    Matthew England


    Full Text Available We develop the theory of Abelian functions associated with cyclic trigonal curves by considering two new cases. We investigate curves of genus six and seven and consider whether it is the trigonal nature or the genus which dictates certain areas of the theory. We present solutions to the Jacobi inversion problem, sets of relations between the Abelian function, links to the Boussinesq equation and a new addition formula.

  9. Elliptic genus of singular algebraic varieties and quotients (United States)

    Libgober, Anatoly


    This paper discusses the basic properties of various versions of the two-variable elliptic genus with special attention to the equivariant elliptic genus. The main applications are to the elliptic genera attached to non-compact GITs, including the theories regarding the elliptic genera of phases on N  =  2 introduced in Witten (1993 Nucl. Phys. B 403 159-222).

  10. On genus-two solutions for the ILW equation (United States)

    Tutiya, Y.


    The existence of theta function solutions of genus two for the intermediate long-wave equation is established. A numerical example is also presented. The method basically goes along with Krichever's construction of theta function solutions for soliton equations, such as the Kronecker product equation. This idea leads us to a question whether a Riemann surface exists which allows a peculiar abelian integral of the third kind. The answer is affirmative at least for genus-two curves.

  11. A new genus of Rhytirrhinini from Colombia (Coleoptera: Curculionidae)


    Morrone Juan J.


    Rupanius, new genus, comprises the single species R. carinatus, new species, endemic to the Paramo biogeographic province of Colombia. It is diagnosed based on the elytra subquadrate and with a conspicuous declivital carina, and is considered similar to Puranlus Germain and Acrorius Kirsch. The genus and species are described, illustrated, and compared with the other Colombian Rhytirrhinini.Rupanius, gen. n., comprende la única especie R. carinatus, sp. n., endémica de la provincia biogeográf...

  12. Genus of total graphs from rings: A survey

    Directory of Open Access Journals (Sweden)

    T. Tamizh Chelvam


    Full Text Available Let R be a commutative ring. The total graph T Γ ( R of R is the undirected graph with vertex set R and two distinct vertices x and y are adjacent if x + y is a zero divisor in R . In this paper, we present a survey of results on the genus of T Γ ( R and three of its generalizations. Keywords: Commutative ring, Total graph, Cayley graph, Genus, Planar

  13. A taxonomic revision of the genus Rafnia Thunb. (Fabaceae, Crotalarieae)



    M.Sc. A taxonomic revision of the genus Rafnia Thunb. (= Oedmannia Thunb., Vascoa DC., Pelecynthis E. Mey), a relatively poorly known papilionoid legume genus, is presented. Rafnia (family Fabaceae, tribe Crotalarieae) is subendemic to the fynbos region of the Western and Eastern Cape Provinces of South Africa, with one species having a distribution area reaching into KwaZulu-Natal. The species delimitation has been unsatisfactory, and the relationships among the taxa uncertain. Rafnia is ...

  14. Effects of livestock exclusion on density, survival and biomass of the perennial sagebrush grass Hymenachne pernambucense (Poaceae) from a temperate fluvial wetland (United States)

    Magnano, Andrea L.; Nanni, Analía S.; Krug, Pamela; Astrada, Elizabeth; Vicari, Ricardo; Quintana, Rubén D.


    In Argentina, the intensification of soybean production has displaced a substantial proportion of cattle ranching to fluvial wetlands such as those in the Delta of the Paraná River. Cattle grazing affects structure and dynamics of native forage plants but there is little information on this impact in populations from fluvial wetlands. This study addresses the effect of cattle ranching on density, survival, mean life-span and aerial biomass of Hymenachne pernambucense (Poaceae), an important forage species in the region. The study was carried out monthly for one year in permanents plots subject to continuous grazing and plots excluded from grazing in the Middle Delta of the Paraná River. In plots excluded from grazing, tillers showed significantly higher population density and survival, and a two-fold increase in mean life-span, while continuous grazing decreased survival of cohorts. The largest contribution to tiller density in ungrazed and grazed populations was made by spring and summer cohorts, respectively. Total and green biomass were significantly higher in the ungrazed population, with highest differences in late spring-early summer. Cattle grazing affected the relationship between tiller density and green biomass suggesting that cattle prefer sprouts because they are more palatable and nutritious than older tissue.

  15. The Representatives of Amelanchier Medik. Genus in Ukraine

    Directory of Open Access Journals (Sweden)

    Opalko Anatoliy Ivanovich


    Full Text Available The information on fruit and decorative value, honey and medicinal properties of the genus Amelanchier Medik. is generalized. Their biological characteristics, chemical composition and palatability traits of the fruit, the ways of consumption and processing, including drying, preparing juices, syrups, jams, candied fruit jellies, confiture, and fruit wine are specified. The environmental adaptability and effectiveness of using juneberry for phytomelioration are mentioned. Several versions of the origin of the genus Amelanchier name and interpretation of its specific epithets are described. The controversial issues of the genus Amelanchier system were discussed from the classical and molecular genetic approaches. The attention is focused on two main aspects of views on the place of the genus Amelanchier representatives of the family Rosaceae Juss. within the particular subfamily, namely the subfamily Pyroideae Burnett (Maloideae S. Weber or the subfamily Amygdaloideae Arn., which indicates the necessity for further comparative morphological and molecular genetic studies of the family Rosaceae. The directions of evolution, habitat and invasive ability of some species of the genus Amelanchier are characterised. The list of the genus Amelanchier representatives cultivated in Ukraine is given.

  16. Phylogenomic re-assessment of the thermophilic genus Geobacillus. (United States)

    Aliyu, Habibu; Lebre, Pedro; Blom, Jochen; Cowan, Don; De Maayer, Pieter


    Geobacillus is a genus of Gram-positive, aerobic, spore-forming obligate thermophiles. The descriptions and subsequent affiliations of the species in the genus have mostly been based on polyphasic taxonomy rules that include traditional sequence-based methods such as DNA-DNA hybridization and comparison of 16S rRNA gene sequences. Currently, there are fifteen validly described species within the genus. The availability of whole genome sequences has provided an opportunity to validate and/or re-assess these conventional estimates of genome relatedness. We have applied whole genome approaches to estimate the phylogenetic relatedness among the sixty-three Geobacillus strains for which genome sequences are currently publicly available, including the type strains of eleven validly described species. The phylogenomic metrics AAI (Average Amino acid Identity), ANI (Average Nucleotide Identity) and dDDH (digital DNA-DNA hybridization) indicated that the current genus Geobacillus is comprised of sixteen distinct genomospecies, including several potentially novel species. Furthermore, a phylogeny constructed on the basis of the core genes identified from the whole genome analyses indicated that the genus clusters into two monophyletic clades that clearly differ in terms of nucleotide base composition. The G+C content ranges for clade I and II were 48.8-53.1% and 42.1-44.4%, respectively. We therefore suggest that the Geobacillus species currently residing within clade II be considered as a new genus. Copyright © 2016 Elsevier GmbH. All rights reserved.

  17. Hayata glandulifera (Orchidaceae, New Genus and Species From Northern Vietnam

    Directory of Open Access Journals (Sweden)

    Leonid V. Averyanov


    Full Text Available New orchid related to Cheirostylis, Goodyera, Rhomboda and Zeuxine discovered in lowland central part of northern Vietnam is described in rank of separate genus Hayata. Proposed genus differs from Goodyera in 2 separate lateral stigmas; in not hairy hypochile; in massive, knob-like mesochile and in large 2-lobed, dentate epichile. It differs from Cheirostylis in large flowers with completely free sepals (newer forming tube; in peculiar bunches of capitate glands on lateral walls of hypochile and in not swollen succulent rhizome forming normal adventitious roots, not modified into ridges or pillows covered by root hairs. From Rhomboda discovered genus differs in absence of any keels on the lip; in specific papillae bunches inside hypochile and in not winged column. New genus may be also close to Zeuxine, from which it differs in plant habit, large flowers, large dentate lobes of epichile and in specific shape of stelidia and rostellar arms. Described plant not fits well with any genera of subtribe Goodyerinae and certainly desires generic segregation. Besides Vietnamese plant, described genus includes H. tabiyahanensis from Taiwan and H. sherriffii from Bhutan. Standard taxonomical treatment of new genus and key for its species identification is presented in the paper.

  18. Genetic Variability and Population Structure of the Potential Bioenergy Crop Miscanthus sinensis (Poaceae in Southwest China Based on SRAP Markers

    Directory of Open Access Journals (Sweden)

    Gang Nie


    Full Text Available The genus Miscanthus has great potential as a biofuel feedstock because of its high biomass, good burning quality, environmental tolerance, and good adaptability to marginal land. In this study, the genetic diversity and the relationship of 24 different natural Miscanthus sinensis populations collected from Southwestern China were analyzed by using 33 pairs of Sequence Related Amplified Polymorphism (SRAP primers. A total of 688 bands were detected with 646 polymorphic bands, an average of 19.58 polymorphic bands per primer pair. The average percentage of polymorphic loci (P, gene diversity (H, and Shannon’s diversity index (I among the 24 populations are 70.59%, 0.2589, and 0.3836, respectively. The mean value of total gene diversity (HT was 0.3373 ± 0.0221, while the allelic diversity within populations (HS was 0.2589 ± 0.0136 and the allelic diversity among populations (DST was 0.0784. The mean genetic differentiation coefficient (Gst = 0.2326 estimated from the detected 688 loci indicated that there was 76.74% genetic differentiation within the populations, which is consistent with the results from Analysis of Molecular Variance (AMOVA analysis. Based upon population structure and phylogenetic analysis, five groups were formed and a special population with mixed ancestry was inferred indicating that human-mediated dispersal may have had a significant effect on population structure of M. sinensis. Evaluating the genetic structure and genetic diversity at morphological and molecular levels of the wild M. sinensis in Southwest China is critical to further utilize the wild M. sinensis germplasm in the breeding program. The results in this study will facilitate the biofuel feedstock breeding program and germplasm conservation.

  19. Anatomia foliar como subsídio à taxonomia de espécies do Complexo Briza L. (Poaceae: Pooideae: Poeae Leaf anatomy as a taxonomic tool for Briza Complex species (Poaceae: Pooideae: Poeae

    Directory of Open Access Journals (Sweden)

    Carla Maria Garlet de Pelegrin


    Full Text Available O objetivo deste trabalho foi verificar a importância da anatomia foliar, visando a fornecer subsídios para a taxonomia do Complexo Briza, cuja circunscrição vem sendo objeto de discussão. Porções medianas da segunda folha abaixo da inflorescência de 21 táxons do Complexo Briza e um de Erianthecium Parodi foram coletadas, fixadas e processadas de acordo com a metodologia usual em microscopia óptica. Todas as espécies estudadas apresentam padrão anatômico festucóide, característico de gramíneas C3. Os resultados mostram que os caracteres da face abaxial da epiderme relativos à presença/ausência de células suberosas e à forma dos corpos silicosos são úteis para compreender as relações taxonômicas no Complexo Briza, distinguindo as espécies eurasiáticas das americanas. Da mesma forma, alguns caracteres da secção transversal da lâmina foliar como forma da lâmina, quantidade de esclerênquima e estrutura do mesofilo. Por outro lado, com relação às espécies americanas do Complexo Briza, os três agrupamentos aqui obtidos não correspondem a nenhuma proposta anterior de categorias taxonômicas genéricas ou infragenéricas.The aim of this study was to analyze leaf anatomy of selected taxa of the Briza Complex and also of a related genus, Erianthecium Parodi, to provide data for the taxonomy of the Complex, whose circumscription is being discussed. Middle portions of the second leaf below the inflorescence of 21 taxa of the Briza Complex and of Erianthecium bulbosum were collected, fixed and processed according to conventional methodology for light microscopy. All species present anatomical patterns typical of festucoid and C3 grasses. The results suggest that the characters of the abaxial surface of the epidermis such as presence/absence of cork cells and shape of silica bodies are useful for understanding the taxonomic relationships within the Briza Complex, distinguishing Eurasiatic species from American species

  20. The genus Rhaponticum in East Asia

    Directory of Open Access Journals (Sweden)

    Gorovoy, P.


    Full Text Available The genus Rhaponticum in East Asia has always been a taxon for discussion. Rhaponticum carthamoides from East Siberia comprises three subspecies: carthamoides, chamarensis and orientale. Even though they differ in morphology, they do not have isolated areas. Rhaponticum satzyperovii was recently described and its author pointed out its affinity with Rh. uniflorum. Plant height, stem indumentum, and radical and stem leaf dissection were signaled as the diagnostic characters. Our present study on living and herbarium specimens of Rh. satzyperovii shows that the diagnostic characters are not consistent. The species area was also claimed to be an argument for considering Rh. satzyperovii a distinct species. This area covers the south of the Primorye Province in the Far East of Russia with some locations in the adjacent Jewish Autonomous Region and in China. In our study, the area of Rh. satzyperovii is found to be within the area of Rh. uniflorum and thereafter they turned out to have no disjunction. In East Asia, Rh. uniflorum is characterized by a wide range of morphological variability. We suggest that Rh. satzyperovii should be included within Rh. uniflorum without any taxonomic rank.El género Rhaponticum en el Este de Asia ha sido siempre un taxón discutido. Rhaponticum carthamoides del Este de Siberia incluye tres subespecies: carthamoides, chamarensis y orientale. Aunque difieren en su morfología, sus áreas no están aisladas. Rhaponticum satzyperovii fue descrito recientemente y su autor señaló su afinidad con Rh. uniflorum. Los caracteres diagnósticos fueron la altura de la planta, el indumento del tallo y las divisiones de las hojas basales y caulinares. Nuestro estudio de plantas vivas y muestras de herbario de Rh. satzyperovii muestra que los caracteres diagnósticos no son consistentes. El área de distribución también se argumentó para considerar Rh. satzyperovii una especie diferente. El área cubre el sur de la provincia de

  1. The chemistry and pharmacology of Cleome genus: A review. (United States)

    Singh, Harpreet; Mishra, Amrita; Mishra, Arun Kumar


    Since ancient times, species of Cleome genus are used to cure various ailments in human beings and same is stated in traditional treatises. Each part of the plant has its own significance, therefore, in background of its significance, upto date information in systematic manner is required. The present review embarks on variety of naturally occurring compounds that have been isolated from various species of Cleome genus. The present study furnishes an overview of all naturally isolated compounds diterpenes, triterpenoids, trinorterpenoids, flavonol glycoside, coumarinolignoids, dipyridodiazepinone, essential oils, sesquiterpenes, flavonoids, carboxylic acid derivatives, lactone derivatives, sterols and pharmacological activities of various species of Cleome genus. These plants of Cleome genus are often used as conventional drugs to treat several ailments therefore information on analgesic, anti-inflammatory, antifungal, antimicrobial, anti-diarrheal, anticancer, anti-arthritic, hepatoprotective, antinociceptive, wound healing and psychopharmacological activity etc were compiled. Literature regarding the compounds isolated and pharmacological studies performed by various researchers in the last 40 years who worked on different species belonging to genus Cleome was summarized in the present review. On the basis of references, this review covers the phytochemistry and pharmacology of Cleome species, describing compounds previously reported current trends and future prospects. From a wellbeing point of view, species belonging toCleome genus presents an excellent option for curing variety of ailments in human beings due to its isolated phytocompounds that reveal significant biological activities or for developing a variety of new pharmaceutical products. The observed pharmacological activities and no toxicity profile of extracts obtained from species of Cleome genus support the statement that these extracts might be used in the formation of new formulations that can be

  2. An investigation of self-incompatibility within the genus Restrepia. (United States)

    Millner, Helen J; McCrea, Alison R; Baldwin, Timothy C


    • The genus Restrepia (Orchidaceae) is indigenous to montane rain forests of Central and South America. Recently, as habitat has fragmented and wild populations dwindled, the chances for successful cross-pollination within the genus have been reduced. Since cultivated species of Restrepia have been vegetatively propagated, they remain genetically close to those in the wild, making ex situ collections of the genus useful model populations for investigating breeding systems. Restrepia are found in clade B of the Pleurothallidinae, the only clade in which self-incompatibility (SI) has not yet been confirmed. In the current study, private collections of Restrepia were used to study the operation of SI within the genus to assist future ex situ conservation of this and related genera.• A variety of self-pollination, intraspecific, and interspecific crosses were performed across the genus, and pollen tube growth was studied.• Individual species exhibited varying degrees of SI. Self-pollinations performed across 26 species in the genus produced few viable seeds, with the exception of R. aberrans. Viable "filled" seeds with embryos were shown to require an intraspecific cross. Primary hybrids between species produced >90% seeds with embryos that germinated well.• The type of SI operating within the genus was considered to be best explained by gametophytic self-incompatibility (GSI) with interspecific variation in its phenotypic expression. The implications of these findings are discussed in relation to SI in the Pleurothallidinae and conservation strategies for Restrepia and related genera. © 2015 Botanical Society of America, Inc.

  3. Taxonomy of the genus Arachis (Leguminosae

    Directory of Open Access Journals (Sweden)

    Antonio Krapovickas


    Full Text Available Almost 100 years elapsed between Linnaeus’ naming the then lone species ofArachis (A. hypogaea L. known to Europeans, and the first taxonomic treatment of the genus by Bentham in 1841. During the next 100 years five to ten additional species descriptions appeared, assigning different species to the same names, and different names to the same species. By mid-20th Century, it was impossible to examine any herbarium collection of Arachis and assign any epithet with any assurance to any specimen (which was not a type collection except to A. hypogaea, A. guaranitica, A. tuberosa and A. villosulicarpa. In our treatment, the literature of this botanical chaos in Arachis is reviewed in detail and an assessment is made of the foundations for its occurrence. It is shown that the bases for the confusion lay in the combination of the esoteric nature of the differentiating morphological features of Arachis, the fragmentary early collections, and the representation of species by seedling specimens. Also, it is related how, in 1959, we decided to re-explore the type locality of each species then known, collect therein complete plant specimens and thereby resolve the problem. Thirty-five years, two generations of plant collectors and around 2000 collections later, we present here 69 species descriptions of Arachis, species distributed in South America east of the Andes, south of the Amazon, north of La Plata and from NW Argentina to NE Brazil. We soon discovered that the most significant characters ofArachis lay in their underground structures, including their fruits, rhizomatous stems, root systems and hypocotyls. We showed that these defining characters tended to cluster the collections into groups which were associated with generally different geographic areas and ecological features. We drew a sample of 100 collections representing these clusters, areas and features, and arranged them in a hybridization diallel and showed, in crosses between

  4. Higher genus partition functions of meromorphic conformal field theories

    International Nuclear Information System (INIS)

    Gaberdiel, Matthias R.; Volpato, Roberto


    It is shown that the higher genus vacuum amplitudes of a meromorphic conformal field theory determine the affine symmetry of the theory uniquely, and we give arguments that suggest that also the representation content with respect to this affine symmetry is specified, up to automorphisms of the finite Lie algebra. We illustrate our findings with the self-dual theories at c = 16 and c = 24; in particular, we give an elementary argument that shows that the vacuum amplitudes of the E 8 x E 8 theory and the Spin(32)/Z 2 theory differ at genus g = 5. The fact that the discrepancy only arises at rather high genus is a consequence of the modular properties of higher genus amplitudes at small central charges. In fact, we show that for c ≤ 24 the genus one partition function specifies already the partition functions up to g ≤ 4 uniquely. Finally we explain how our results generalise to non-meromorphic conformal field theories.

  5. Genotyping of clinical isolates of Acanthamoeba genus in Venezuela. (United States)

    Wagner, Carolina; Reyes-Batlle, María; Ysea, María Alejandra Vethencourt; Pérez, Mónica V Galindo; de Rondón, Carmen Guzmán; Paduani, Anaibeth J Nessi; Pérez, Angelyseb Dorta; López-Arencibia, Atteneri; Sifaoui, Ines; de Galindo, María Virginia Pérez; de Suárez, Eva Pérez; Martínez-Carretero, Enrique; Valladares, Basilio; Piñero, José E; Lorenzo-Morales, Jacob


    Free-living amoebae of Acanthamoeba genus are opportunistic pathogens distributed worldwide. Strains included in this genus are causative agents of a fatal encephalitis and a sight-threating keratitis in humans and other animals. In this study, 550 clinical samples which were collected between 1984 and 2014 from different patients with suspected infections due to Acanthamoeba were initially screened for the presence of this amoebic genus at the Laboratorio de Amibiasis-Escuela de Bioanálisis at the Universidad Central de Venezuela. Samples were cultured in 2% Non-Nutrient agar plates seeded with a layer of heat killed Escherichia coli. From the 550 clinical samples included in this study, 18 of them were positive for Acanthamoeba genus after culture identification. Moreover, positive samples were confirmed after amplification of the Diagnostic Fragment 3 (DF3) of the Acanthamoeba18S rDNA genus and sequencing was carried out in order to genotype the isolated strains of Acanthamoeba. Furthermore, the pathogenic potential of the strains was checked by performing thermotolerance and osmotolerance assays. Sequencing of the DF3 region resulted in the identification of genotype T4 in all the isolated strains. Moreover, most isolates were thermotolerant or both thermotolerant and osmotolerant and thus were classified as potentially pathogenic strains. To the best of our knowledge, this is the first report on the molecular characterization at the genotype level of Acanthamoeba strains in Venezuela.

  6. Phylogenetic Analysis of the Synnema-Producing Genus Synnemapestaloides

    Directory of Open Access Journals (Sweden)

    Kyoko Watanabe


    Full Text Available Synnemapestaloides rhododendri, the type species of the genus Synnemapestaloides, is a pathogen of Rhododendron brachycarpum. This fungus produces six-celled conidia with appendages at both end cells, and are generated by annellidic conidiogenous cells on the synnema. These conidial structures are similar to those of the genus Pestalotia. The monotypic genus Synnemapestaloides is currently classified in the family Amphisphaeriaceae solely based on conidial morphology. Here we demonstrate that Synnemapestaloides represents a distinct genus in the family Sporocadaceae (Amphisphaeriales based on differences in the nucleotide sequences of the partial large subunit rDNA gene, the rDNA internal transcribed spacer, and the partial β-tubulin. The genus most closely related to Synnemapestaloides is Seimatosporium and the species most similar to Synnemapestaloides rhododendri is Seim. foliicola which produces short synnema-like conidiomata (sporodochia. These results demonstrate that Seim. foliicola should be transferred to Synnemapestaloides, and also demonstrate that Sporocadaceae can have synnematal in addition to pycnidial and acervular conidiomata.

  7. Genus delineation of Chlamydiales by analysis of the percentage of conserved proteins justifies the reunifying of the genera Chlamydia and Chlamydophila into one single genus Chlamydia

    NARCIS (Netherlands)

    Pannekoek, Yvonne; Qi-Long, Qin; Zhang, Yu-Zhong; van der Ende, Arie


    Many studies have aimed to set up boundaries for the classification and definition of prokaryotic genus and species classification; however, studies that focused on genus-level genomic differences for existing taxonomy systems are limited. Recently, a novel method was described for prokaryotic genus

  8. Transfer of eleven species of the genus Burkholderia to the genus Paraburkholderia and proposal of Caballeronia gen. nov. to accommodate twelve species of the genera Burkholderia and Paraburkholderia. (United States)

    Dobritsa, Anatoly P; Samadpour, Mansour


    It has been proposed to split the genus Burkholderia into two genera according to phylogenetic clustering: (1) a genus retaining this name and consisting mainly of animal and plant pathogens and (2) the genus Paraburkholderia including so-called environmental bacteria. The latter genus name has been validly published recently. During the period between the effective and valid publications of the genus name Paraburkholderia, 16 novel species of the genus Burkholderiawere described, but only two of them can be classified as members of this genus based on the emended genus description. Analysis of traits and phylogenetic positions of the other 11 species shows that they belong to the genus Paraburkholderia, and we propose to transfer them to this genus. The reclassified species names are proposed as Paraburkholderia dipogonis comb. nov., Paraburkholderia ginsengiterrae comb. nov., Paraburkholderia humisilvae comb. nov., Paraburkholderia insulsa comb. nov., Paraburkholderia kirstenboschensis comb. nov., Paraburkholderia metalliresistens comb. nov., Paraburkholderia monticola comb. nov., Paraburkholderia panaciterrae comb. nov., Paraburkholderia rhizosphaerae comb. nov., Paraburkholderia solisilvae comb. nov. and Paraburkholderia susongensis comb. nov. The remaining three species are transferred to the new genus Caballeronia gen. nov. proposed to accommodate twelve species of the genera Burkholderia and Paraburkholderia forming a distinctive clade in phylogenetic trees. The new genus members are Caballeronia choica comb. nov., Caballeronia cordobensis comb. nov., Caballeronia glathei comb. nov., Caballeronia grimmiae comb. nov., Caballeronia humi comb. nov., Caballeronia megalochromosomata comb. nov., Caballeronia jiangsuensis comb. nov., Caballeronia sordidicola comb. nov., Caballeronia telluris comb. nov., Caballeronia terrestris comb. nov., Caballeronia udeis comb. nov., and Caballeronia zhejiangensis comb. nov.

  9. Review of the genus Craspedolcus Enderlein sensu lato in China, with the description of a new genus and four new species (Hymenoptera, Braconidae, Braconinae)

    NARCIS (Netherlands)

    Li, Y.; Achterberg, van C.; Chen, X.-x.


    A new genus is split off the genus Craspedolcus Enderlein, 1920 (Hymenoptera, Braconidae, Braconinae): Maculibracon gen. n. with type species Maculibracon abruptus sp. n. The genus Craspedolcus Enderlein sensu stricto is redefined, a key to both genera and to their species in China, Thailand and

  10. Evidence for Ecological Flexibility in the Cosmopolitan Genus Curtobacterium. (United States)

    Chase, Alexander B; Arevalo, Philip; Polz, Martin F; Berlemont, Renaud; Martiny, Jennifer B H


    Assigning ecological roles to bacterial taxa remains imperative to understanding how microbial communities will respond to changing environmental conditions. Here we analyze the genus Curtobacterium , as it was found to be the most abundant taxon in a leaf litter community in southern California. Traditional characterization of this taxon predominantly associates it as the causal pathogen in the agricultural crops of dry beans. Therefore, we sought to investigate whether the abundance of this genus was because of its role as a plant pathogen or another ecological role. By collating >24,000 16S rRNA sequences with 120 genomes across the Microbacteriaceae family, we show that Curtobacterium has a global distribution with a predominant presence in soil ecosystems. Moreover, this genus harbors a high diversity of genomic potential for the degradation of carbohydrates, specifically with regards to structural polysaccharides. We conclude that Curtobacterium may be responsible for the degradation of organic matter within litter communities.

  11. Higher genus correlators for the complex matrix model

    International Nuclear Information System (INIS)

    Ambjorn, J.; Kristhansen, C.F.; Makeenko, Y.M.


    In this paper, the authors describe an iterative scheme which allows us to calculate any multi-loop correlator for the complex matrix model to any genus using only the first in the chain of loop equations. The method works for a completely general potential and the results contain no explicit reference to the couplings. The genus g contribution to the m-loop correlator depends on a finite number of parameters, namely at most 4g - 2 + m. The authors find the generating functional explicitly up to genus three. The authors show as well that the model is equivalent to an external field problem for the complex matrix model with a logarithmic potential

  12. Genetic variability assessment in the genus Passiflora by SSR markers

    Directory of Open Access Journals (Sweden)

    Claudia Lougon Paiva


    Full Text Available The genus Passiflora encompasses many species that are endemic to the Brazilian territory, including some with economic value. Studies on genetic diversity in this genus are fundamental because they allow understanding genetic variability and distance. The present study aimed to determine the genetic variability and distances among 10 species of the genus Passiflora by using microsatellite markers (Simple Sequence Repeat, SSR. Twenty-eight heterologous microsatellite markers were tested, but only 12 were used in the diversity analysis because they amplified in at least 80% of the species. A clear separation was observed among the subgenuses studied, as well as wide variation among the accessions of Passiflora. This knowledge enables breeders to explore diversity and transfer favorable alleles found in wild species.


    Directory of Open Access Journals (Sweden)



    Full Text Available In working up the genus Coelostegia, I received on loan from the ForestResearch Institute at Kepong, Malaya abundant material of a species whichWyatt-Smith was unable to place. Dr. Kostermans pointed out to me thatmost likely the specimens belonged to a new genus, related to CoelostegiaI have taken the liberty to name the genus after Dr. A. J. G. H. Kostermanswho has been devoting time and energy teaching me taxonomy, and whoJias taken up the burden of the development of taxonomic botany in In-donesia.I am indebted to Prof. Dr. C. G. G. J. van Steenis and to Dr. R. GBakhuizen van den Brink Jr., who have kindly helped me in preparing theLatin diagnoses.

  14. Notes on the genus Paramignya: Phytochemistry and biological activity

    Directory of Open Access Journals (Sweden)

    Ninh The Son


    Full Text Available Genus Paramignya belongs to Rutaceae family, with interesting secondary metabolites, comprising main classes of compounds coumarin and coumarin glycosides, acridone alkaloids, tirucallane and tirucallane glycosides, phenols, and flavonoids, as well as several compounds limonoid, lignin glycoside and sterol. Paramignya species has been employing as folk medicines against hepatitis, diabetes, cancer, nose infections. Many bioactive reported such as cytotoxic assay, antioxidant, antiinflammatory, antiumor cancer, α-glucosidase inhibitory activities indicated either Paramignya extracts, fractions, or isolated compounds to become valuable resources for natural new drug developments. However, no evidences are reported for general view about this genus. In current paper, we exhibit overview almost of isolated components and biological evaluations from this genus. These findings are important to improve the values of these medicinal plants for the health benefit, drug discovery and guideline for future researches.

  15. The genus Cordia: botanists, ethno, chemical and pharmacological aspects

    Directory of Open Access Journals (Sweden)

    Edinardo Fagner Ferreira Matias

    Full Text Available ABSTRACTSpecies of the genus Cordia, Boraginaceae, are widely studied with regard to the various ethnobotanical and ethnopharmacological aspects. They are found principally in tropical and subtropical regions of the American, Asian and African continents, where they occur in various countries. In the genus Cordia, there are many species cultivated for ornamental plants, wood and medicinal applications, where they are extensively utilized by traditional communities. In the last decades, scientific studies of Cordia species have intensified, demonstrating the great interest in phytochemical, biological and pharmacological studies. In this review, we describe the principal botanical aspects, ethnopharmacological information and evaluation of the bioactive and pharmacological properties of Cordia, its phytochemical constituents and the most common classes of secondary metabolites identified. The information reported in this work contributes scientifically to recognizing the importance of the genus Cordia as a target in the search for new biotechnological investments.

  16. The genus Macroditassa (Apocynaceae-Asclepiadoideae in Brazil

    Directory of Open Access Journals (Sweden)

    Jorge Fontanella-Pereyra


    Full Text Available A taxonomic revision of the Brazilian species of the genus Macroditassa Malme (Apocynaceae- sclepiadoideae is presented. The genus belongs to the subfamily Asclepiadoideae R.Br. ex Burnett, tribe Asclepiadeae (R.Br. Duby, subtribe Metastelmatinae Endl. ex Meisn. and is the most closely related to the Ditassa R.Br. genus. Macroditassa has 14 taxa of which 11 are found in Brazil, where they occurr in the Atlantic forest, disturbed areas, clearings and gullies, "cerrado", "cerradão", "campo rupestre",  campos" (high-altitude savannas and sandy coast plains ("restingas". In this paper the identification key of the taxa, descriptions and illustrations, data on flowering and fruiting, as well as maps showing the geographic distribution are presented.

  17. Ethnomedicinal uses, phytochemistry and pharmacological properties of the genus Boerhavia. (United States)

    Patil, Kapil S; Bhalsing, Sanjivani R


    The genus Boerhavia is widely distributed in tropical, subtropical and temperate regions of the world including Mexico, America, Africa, Asia, Indian Ocean Islands, Pacific Islands and Australia. The genus Boerhavia is extensively used by local peoples and medicinal practitioners for treatments of hepatitis, urinary disorders, gastro intestinal diseases, inflammations, skin problems, infectious diseases and asthma. Present review focused on traditional uses, phytochemistry, pharmacology and toxicology of Boerhavia genus to support potential scope for advance ethnopharmacological study. Information on the Boerhavia species was collected from classical books on medicinal plants, pharmacopoeias and scientific databases like PubMed, Scopus, GoogleScholar, Web of Science and others. Also scientific literatures based on ethnomedicinal surveys, Ph.D. and M.Sc. dissertations, published papers from Elsevier, Taylor and Francis, Springer, ACS as well as Wiley publishers and reports by government bodies and documentations were assessed. A total of 180 compounds from Boerhavia genus were isolated of which B. diffusa alone shared around 131 compounds and for most of which it is currently an exclusive source. In the genus, phenolic glycosides and flavonoids contribute approximately 97 compounds. These includes eupalitin, rotenoids like boeravinones, coccineons, alkaloid i.e. betanin and punarnavine etc., showing vital pharmaceutical activities such as anticancer, anti-inflammatory, antioxidant and immunomodulatory. Boerhavia is an important genus with wide range of medicinal uses. However, most of the available scientific literatures have lacked relevant doses, duration and positive controls for examining bioefficacy of extracts and its active compounds. In some studies, taxonomic errors were encountered. Moreover, there is need for accurate methods in testing the safety and ethnomedicinal validity of Boerhavia species. Copyright © 2016. Published by Elsevier Ireland Ltd.

  18. Revisiting the genus Photobacterium: taxonomy, ecology and pathogenesis. (United States)

    Labella, Alejandro M; Arahal, David R; Castro, Dolores; Lemos, Manuel L; Borrego, Juan J


    The genus Photobacterium, one of the eight genera included in the family Vibrionaceae, contains 27 species with valid names and it has received attention because of the bioluminescence and pathogenesis mechanisms that some of its species exhibit. However, the taxonomy and phylogeny of this genus are not completely elucidated; for example, P. logei and P. fischeri are now considered members of the genus Aliivibrio, and previously were included in the genus Vibrio. In addition, P. damselae subsp. piscicida was formed as a new combination for former Vibrio damsela and Pasteurella piscicida. Moreover, P. damselae subsp. damselae is an earlier heterotypic synonym of P. histaminum. To avoid these incovenences draft and complete genomic sequences of members of Photobacterium are increasingly becoming available and their use is now routine for many research laboratories to address diverse goals: species delineation with overall genomic indexes, phylogenetic analyses, comparative genomics, and phenotypic inference. The habitats and isolation source of the Photobacterium species include seawater, sea sediments, saline lake waters, and a variety of marine organisms with which the photobacteria establish different relationships, from symbiosis to pathogenic interactions. Several species of this genus contain bioluminescent strains in symbiosis with marine fish and cephalopods; in addition, other species enhance its growth at pressures above 1 atmosphere, by means of several high-pressure adaptation mechanisms and for this, they may be considered as piezophilic (former barophilic) bacteria. Until now, only P. jeanii, P. rosenbergii, P. sanctipauli, and the two subspecies of P. damselae have been reported as responsible agents of several pathologies on animal hosts, such as corals, sponges, fish and homeothermic animals. In this review we have revised and updated the taxonomy, ecology and pathogenicity of several members of this genus. [Int Microbiol 20(1): 1-10 (2017

  19. Comparative Genomics Reveals High Genomic Diversity in the Genus Photobacterium. (United States)

    Machado, Henrique; Gram, Lone


    Vibrionaceae is a large marine bacterial family, which can constitute up to 50% of the prokaryotic population in marine waters. Photobacterium is the second largest genus in the family and we used comparative genomics on 35 strains representing 16 of the 28 species described so far, to understand the genomic diversity present in the Photobacterium genus. Such understanding is important for ecophysiology studies of the genus. We used whole genome sequences to evaluate phylogenetic relationships using several analyses (16S rRNA, MLSA, fur , amino-acid usage, ANI), which allowed us to identify two misidentified strains. Genome analyses also revealed occurrence of higher and lower GC content clades, correlating with phylogenetic clusters. Pan- and core-genome analysis revealed the conservation of 25% of the genome throughout the genus, with a large and open pan-genome. The major source of genomic diversity could be traced to the smaller chromosome and plasmids. Several of the physiological traits studied in the genus did not correlate with phylogenetic data. Since horizontal gene transfer (HGT) is often suggested as a source of genetic diversity and a potential driver of genomic evolution in bacterial species, we looked into evidence of such in Photobacterium genomes. Genomic islands were the source of genomic differences between strains of the same species. Also, we found transposase genes and CRISPR arrays that suggest multiple encounters with foreign DNA. Presence of genomic exchange traits was widespread and abundant in the genus, suggesting a role in genomic evolution. The high genetic variability and indications of genetic exchange make it difficult to elucidate genome evolutionary paths and raise the awareness of the roles of foreign DNA in the genomic evolution of environmental organisms.

  20. Molecular Signatures and Phylogenomic Analysis of the Genus Burkholderia: Proposal for Division of this Genus into the Emended Genus Burkholderia Containing Pathogenic Organisms and a New Genus Paraburkholderia gen. nov. Harboring Environmental Species

    Directory of Open Access Journals (Sweden)

    Aman eSawana


    Full Text Available The genus Burkholderia contains large number of diverse species which are not reliably distinguished by the available biochemical or molecular characteristics. We report here results of detailed phylogenetic and comparative genomic analyses of 45 sequenced species of the genus Burkholderia. In phylogenetic trees based upon concatenated sequences for 21 conserved proteins as well as 16S rRNA gene sequences, Burkholderia species grouped into two major clades. Within these main clades a number of smaller clades were also clearly distinguished. Our comparative analysis of protein sequences from Burkholderia spp. has identified 42 highly specific molecular markers in the form of conserved sequence indels (CSIs that are uniquely found in different clades of Burkholderia spp. Six of these CSIs are specific for a group of Burkholderia spp. (referred to as Clade I which contains all clinically relevant members of the genus as well as the phytopathogenic Burkholderia species. The second main clade (Clade II composed of the environmental Burkholderia species, is also distinguished by 2 of the identified CSIs. Additionally, our work has also identified 3 CSIs that are specific for the Burkholderia cepacia complex, 4 CSIs that are uniquely found in the Burkholderia pseudomallei group, 5 CSIs that are specific for the phytopathogenic Burkholderia spp. and 22 other CSI that distinguish two groups within Clade II. The described molecular markers provide highly specific means for the demarcation of different groups of Burkholderia spp. and for development of novel diagnostic assays for the clinically important members of the group. Based upon the results from different lines of studies, a division of the genus Burkholderia into two genera is proposed. In this new proposal, the emended genus Burkholderia will contain only the clinically relevant and phytopathogenic Burkholderia species, whereas all other Burkholderia spp. are transferred to a new genus

  1. Variação dos teores de constituintes voláteis de Cymbopogon citratus (DC Staf, Poaceae, coletados em diferentes regiões do Estado de São Paulo Variation in the amounts of volatile constituents of Cymbopogon citratus (DC Staf, Poaceae, collected in different regions of São Paulo State

    Directory of Open Access Journals (Sweden)

    Marcos R. Furlan


    Full Text Available O óleo essencial extraído de Cymbopogon citratus (DC Staf, Poaceae, é rico em citral sendo amplamente empregado na indústria química e farmacêutica. Os objetivos desse estudo foram avaliar o conteúdo de citral entre populações de C. citratus coletados em duas regiões diferentes (Ibiúna e Pindamonhangaba, Estado de São Paulo. O óleo essencial extraído de uma população cultivada em Pindamonhangaba-SP apresentou uma concentração alta de citral (aproximadamente 96,0%, enquanto que o óleo extraído da população de Ibiúna-SP apresentou, além de citral, proporções elevadas de outro monoterpeno, o geraniol. Adicionalmente, os óleos essenciais obtidos desta população de C. citratus foram extraídos e analisados ao longo de 24 h (a cada 3 h, sendo que o teor de citral foi maior no período da noite, o que mostra a importância de estudos que avaliam as diferenças químicas associadas às mudanças circadianas. Os componentes dos óleos essenciais foram identificados por RMN de 13C, CG/EM e CG através do índice de Kovats.The essential oil extracted from Cymbopogon citratus (DC Staf, Poaceae, is rich in citral and has many applications in chemical and pharmaceutical industry. The aims of this study were evaluate the amount of citral in populations of C. citratus collected in two different regions (Ibiúna and Pindamonhangaba, São Paulo State. The essential oil extracted of a cultivated population in Pidamonhangaba-SP, showed a high content of citral (approximately 96.0%, while the essential oil from Ibiuna-SP, showed citral and high amounts of another monoterpene, geraniol. Additionally, the essential oils from this population of C. citratus were extracted and analyzed during 24 h (each 3 h, being the major concentration of citral in the night period, indicating that studies which evaluated the chemical differences associated to circadian changes. The components of essential oils were identified through 13C NMR, GC/MS, GC and

  2. Landau-Ginzburg Orbifolds, Mirror Symmetry and the Elliptic Genus


    Berglund, P.; Henningson, M.


    We compute the elliptic genus for arbitrary two dimensional $N=2$ Landau-Ginzburg orbifolds. This is used to search for possible mirror pairs of such models. We show that if two Landau-Ginzburg models are conjugate to each other in a certain sense, then to every orbifold of the first theory corresponds an orbifold of the second theory with the same elliptic genus (up to a sign) and with the roles of the chiral and anti-chiral rings interchanged. These orbifolds thus constitute a possible mirr...

  3. Bioactive Natural Products of Marine Sponges from the Genus Hyrtios

    Directory of Open Access Journals (Sweden)

    Nourhan Hisham Shady


    Full Text Available Marine sponges are known as a rich source for novel bioactive compounds with valuable pharmacological potential. One of the most predominant sponge genera is Hyrtios, reported to have various species such as Hyrtios erectus, Hyrtios reticulatus, Hyrtios gumminae, Hyrtios communis, and Hyrtios tubulatus and a number of undescribed species. Members of the genus Hyrtios are a rich source of natural products with diverse and valuable biological activities, represented by different chemical classes including alkaloids, sesterterpenes and sesquiterpenes. This review covers the literature until June 2016, providing a complete survey of all compounds isolated from the genus Hyrtios with their corresponding biological activities whenever applicable.

  4. The genus cicerbita wallr. (cichorieae- asteraceae) in Pakistan and Kashmir

    International Nuclear Information System (INIS)

    Bano, R.; Qaiser, M.; Roohi, B.


    The genus Cicerbita Wallr. of the tribe Cichorieae-Asteraceae is revised for Pakistan and Kashmir. A broader generic concept of the genus is accepted and in all 11 species have been recognized including 3 new species viz. Cicerbita astorensis, Roohi Bano and Qaiser, C. alii, Roohi Bano and Qaiser and C. gilgitensis Roohi Bano and Qaiser. 5 new combinations, including 3 at species and 2 at varietal level have also been proposed. An artificial key to all the species is provided. Latin diagnosis, illustrations of newly described species, world wide and local distribution and ecological notes of all the species are also furnished. (author)

  5. The genus Boschniakia in China: An ethnopharmacological and phytochemical review. (United States)

    Zhang, Le; Zhao, Yunshan; Wang, Zhipeng A; Wei, Kunhua; Qiu, Bin; Zhang, Chunhong; Wang-Müller, QiYan; Li, Minhui


    As a group of important medicine plants, Boschniakia rossica (Cham. et Schltdl) Fedtsch. and B. himalaica Thoms, which are the only two species in the genus Boschniakia (Orobanchaceae), have long been used in traditional Chinese medicine for their multiple therapeutic uses related to enhanced renal function, erectile dysfunction, defaecate and hepatoprotective. Additionally, the two species are also used as dietary supplements in wine, cosmetics, and other healthy food. By providing comprehensive information and data of genus Boschniakia on botany, traditional medicinal uses, phytochemistry, pharmacological research and toxicology, this review aims to summary the group of natural compounds from Boschniakia discovered so far. The other aims are to reference research findings of their biological activities and functions in medicine, physiology, and cell biology to highlight the compound candidates which can be used for further drug discovery in several pharmaceutical areas including antioxidation, anticancer, anti-inflammation, anti-senile, and immunology. All of the available information on B. rossica and B. himalaica was collected from the electronic resources (such as PubMed, SciFinder Scholar, CNKI, TPL (, Google Scholar, Baidu Scholar, and Web of Science). After a comprehensive analysis of the literatures from available online sources, the results show that both species of genus Boschniakia are valuable and popular herbal medicines with potentials to cure various ailments. The phytochemical studies revealed that the chemical compositions of this genus were mainly iridoid glycosides and phenylpropanoid glycosides. To date, 112 compounds have been isolated from the genus, while their crude extracts and purified compounds have been found to possess a wide range of biological activities including anti-senile, antitumor and anticancer, anti-inflammatory, protecting liver, boost memory, anti-oxidation, anti-lipid peroxidative, and

  6. Large N elliptic genus and AdS/CFT Correspondence

    International Nuclear Information System (INIS)

    Boer, Jan de


    According to one of Maldacena's dualities, type IIB string theory on AdS 3 x S 3 x K3 is equivalent to a certain N = (4, 4) superconformal field theory. In this note we compute the elliptic genus of the boundary theory in the supergravity approximation. A finite quantity is obtained once we introduce a particular exclusion principle. In the regime where the supergravity approximation is reliable, we find exact agreement with the elliptic genus of a sigma model with target space K3 N /S N

  7. Formulae for Arithmetic on Genus 2 Hyperelliptic Curves

    DEFF Research Database (Denmark)

    Lange, Tanja


    The ideal class group of hyperelliptic curves can be used in cryptosystems based on the discrete logarithm problem. In this article we present explicit formulae to perform the group operations for genus 2 curves. The formulae are completely general but to achieve the lowest number of operations we...... treat odd and even characteristic separately. We present 3 different coordinate systems which are suitable for different environments, e.g. on a smart card we should avoid inversions while in software a limited number is acceptable. The presented formulae render genus two hyperelliptic curves very...

  8. Genus Phyllanthus for chronic hepatitis B virus infection

    DEFF Research Database (Denmark)

    Liu, J; Lin, Haili; McIntosh, H


    To evaluate the efficacy and safety of genus Phyllanthus for chronic hepatitis B virus (HBV) infection we performed a systematic review of randomized clinical trials. Randomized trials comparing genus Phyllanthus vs. placebo, no intervention, general nonspecific treatment, other herbal medicine.......85-17.21) compared with placebo or no intervention. There was no significant difference on clearance of serum HBsAg, HBeAg and HBV DNA between Phyllanthus and IFN. Phyllanthus species were better than nonspecific treatment or other herbal medicines for the clearance of serum HBsAg, HBeAg, HBV DNA, and liver enzyme...

  9. Note on twisted elliptic genus of K3 surface

    Energy Technology Data Exchange (ETDEWEB)

    Eguchi, Tohru, E-mail: [Yukawa Institute for Theoretical Physics, Kyoto University, Kyoto 606-8502 (Japan); Hikami, Kazuhiro, E-mail: [Department of Mathematics, Naruto University of Education, Tokushima 772-8502 (Japan)


    We discuss the possibility of Mathieu group M{sub 24} acting as symmetry group on the K3 elliptic genus as proposed recently by Ooguri, Tachikawa and one of the present authors. One way of testing this proposal is to derive the twisted elliptic genera for all conjugacy classes of M{sub 24} so that we can determine the unique decomposition of expansion coefficients of K3 elliptic genus into irreducible representations of M{sub 24}. In this Letter we obtain all the hitherto unknown twisted elliptic genera and find a strong evidence of Mathieu moonshine.

  10. Note on twisted elliptic genus of K3 surface

    International Nuclear Information System (INIS)

    Eguchi, Tohru; Hikami, Kazuhiro


    We discuss the possibility of Mathieu group M 24 acting as symmetry group on the K3 elliptic genus as proposed recently by Ooguri, Tachikawa and one of the present authors. One way of testing this proposal is to derive the twisted elliptic genera for all conjugacy classes of M 24 so that we can determine the unique decomposition of expansion coefficients of K3 elliptic genus into irreducible representations of M 24 . In this Letter we obtain all the hitherto unknown twisted elliptic genera and find a strong evidence of Mathieu moonshine.

  11. Revision of the genus Endochilus Weise (Coleoptera: Coccinellidae: Chilocorini) (United States)

    Łączyński, Piotr; Tomaszewska, Wioletta


    Abstract The members of the endemic African genus EndochilusWeise, 1898 (Coleoptera: Coccinellidae: Chilocorini) are redescribed, diagnosed, and illustrated. Lectotypes are designated for Endochilus compater Weise, Endochilus minor Weise, Endochilus plagiatus Sicard, Endochilus rubicundus Weise, and Endochilus styx Sicard. One new species is described: Endochilus abdominalissp. nov. Notes on the genus and nomenclatural history for each species are provided. A key for iden- tification of all species is presented. Adult characters concerning similarities of Endochilus to other genera of African Chilocorini are discussed. PMID:25373218

  12. On the identity of two new species of the genus coleoscirus (acari: cunaxidae) with annotations on the genus from pakistan

    International Nuclear Information System (INIS)

    Bashir, M.H.; Ashfaq, M.


    Adult females of two new Cunaxid mites, Coleoscirus raviensis n.sp. and Coleoscirus tobaensis n.sp. were collected during the taxonomic exploration of the mite fauna of the family Cunaxidae from Punjab- Pakistan. The new species were compared with 9 already describes species of the same genus from Pakistan. A Comprehensive key of all the known species of this genus from Pakistan has been prepared to incorporate the new species. A ceremonial description and illustration of main body characteristics, geographical distribution, host range and distinguishing remarks are also given. (author)

  13. Vitilevumyia, an enigmatic new genus of Stratiomyidae from Fiji (Diptera) (United States)

    A new genus of Stratiomyidae, Vitilevumyia gen. nov. (type species, V. bobwoodleyi, sp. nov.) is described from the island of Viti Levu, Fiji. It exhibits an unusual combination of character states, but is tentatively placed in the tribe Prosopochrysini of the subfamily Stratiomyinae. ...

  14. Aerobic Anoxygenic Photosynthesis Is Commonly Present within the Genus Limnohabitans. (United States)

    Kasalický, Vojtěch; Zeng, Yonghui; Piwosz, Kasia; Šimek, Karel; Kratochvilová, Hana; Koblížek, Michal


    The genus Limnohabitans ( Comamonadaceae , Betaproteobacteria ) is a common and a highly active component of freshwater bacterioplanktonic communities. To date, the genus has been considered to contain only heterotrophic species. In this study, we detected the photosynthesis genes pufLM and bchY in 28 of 46 strains from three Limnohabitans lineages. The pufM sequences obtained are very closely related to environmental pufM sequences detected in various freshwater habitats, indicating the ubiquity and potential importance of photoheterotrophic Limnohabitans in nature. Additionally, we sequenced and analyzed the genomes of 5 potentially photoheterotrophic Limnohabitans strains, to gain further insights into their phototrophic capacity. The structure of the photosynthesis gene cluster turned out to be highly conserved within the genus Limnohabitans and also among all potentially photosynthetic Betaproteobacteria strains. The expression of photosynthetic complexes was detected in a culture of Limnohabitans planktonicus II-D5 T using spectroscopic and pigment analyses. This was further verified by a novel combination of infrared microscopy and fluorescent in situ hybridization. IMPORTANCE The data presented document that the capacity to perform anoxygenic photosynthesis is common among the members of the genus Limnohabitans , indicating that they may have a novel role in freshwater habitats. Copyright © 2017 American Society for Microbiology.

  15. The Lesser Antillean scorpions of the genus Centruroides

    NARCIS (Netherlands)

    Armas, de Luis F.


    The buthid scorpions of the genus Centruroides are widely distributed in the Antillean area. They are also the most common scorpions in the majority of these islands. Nevertheless they remained almost forgotten until recently (STAHNKE 1970; ARMAS 1976, 1977, 1980, 1981, 1982; FRANCKE & SISSOM 1980).

  16. Systematics and evolution in the West Indian iguanid genus Cyclura

    NARCIS (Netherlands)

    Schwartz, Albert; Carey, Michael


    Throughout the Greater Antilles, the Virgin Islands, the Cayman Islands, the Bahama Islands, and the Turks and Caicos islands occurs a group of moderate to very large lizards of the iguanid genus Cyclura. These ground iguanas form a conspicuous element of the herpetofaunas of their respective

  17. Cross-genus amplification and characterisation of microsatellite loci ...

    African Journals Online (AJOL)


    School of Life Sciences, New Biology Building, University of KwaZulu-Natal, University Road, Westville, KwaZulu-Natal. 3630, South ... Afro-tropical members of the Old World genus Otomops, ..... Population genetic software for teaching and research – an update. ... guide to using and evaluating microsatellite markers. Ecol.

  18. Phylogeny and taxonomy of the genus Tubakia s. lat.

    NARCIS (Netherlands)

    Braun, Uwe; Nakashima, C.; Crous, P.W.; Groenewald, Ewald; Moreno-Rico, Onésimo; Rooney-Latham, S.; Blomquist, C.L.; Haas, J; Marmolejo, J


    The genus Tubakia is revised on the basis of morphological and phylogenetic data. The phylogenetic affinity of Tubakia to the family Melanconiellaceae (Diaporthales) was recently postulated, but new analyses based on sequences retrieved from material of the type species of Tubakia, T. dryina,

  19. Revision of the Genus Hybosorus Macleay (Coleoptera: Scarabaeidae, Hybosorinae)

    NARCIS (Netherlands)

    Kuijten, P.J.


    A taxonomic revision of the scarabaeoid genus Hybosorus is given, including descriptions, nomenclatorial notes, figures of genital apparatus and other relevant parts, a key, and notes on distribution and bionomics. Lectotypes are designated for Hybosorus carolinus LeConte, H. crassus Klug, H.

  20. A review of the palm genus Acrocomia: Neotropical green gold (United States)

    The genus Acrocomia, popularly known as macaw palm or macaúba, occurs in savanna areas and open forests of tropical America, with distribution from Central to southern South America. They are important oleaginous palm trees, due to their role in ecosystems, local economies, and their potential for b...

  1. The Australian endemic woodwasp genus Austrocyrta Riek (Hymenoptera: Xiphydriidae) (United States)

    J.T. Jennings; A.D. Austin; N.M. Schiff


    The Australian xiphydriid woodwasp genus, previously known only from a single species, A. australiensis Riek, is revised. A second distinctive species from Carnarvon National Park in southcentral Queensland, A. fasciculata Jennings & Austin, sp. nov., is described, and a key to separate the males of the two species is provided.

  2. Ruwenzoria, a new genus of the Xylariaceae from Central Africa

    DEFF Research Database (Denmark)

    Stadler, M.; Læssøe, Thomas; Fournier, J.


    Abstract During a foray to the mountain rainforests of the Democratic Republic of the Congo, a peculiar species of Xylariaceae was found, which could not be accommodated in any of the existing genera. It is recognised as representative of a new genus, named Ruwenzoria, owing to the presence of a ...

  3. Korean species of the genus Perlomyia Banks, 1906 (Plecoptera: Leuctridae). (United States)

    Murányi, Dávid; Jeon, Mi Jeong; Hwang, Jeong Mi; Seo, Hong Yul


    Eight species of the genus Perlomyia (Plecoptera: Leuctridae) are reported from Korea, six are new records for the Korean Peninsula. Two species, known only as unassociated females are described under informal unnamed designations. Previous Korean records are discussed, taxonomic characters of the Korean specimens and Korean distribution are presented for these species. Zoogeographic notes on the Asian Perlomyia are also given.

  4. Evolution of the leukotoxin promoter in genus Mannheimia

    DEFF Research Database (Denmark)

    Larsen, Jesper; Pedersen, Anders Gorm; Davies, Robert L


    of the leukotoxin promoter among representatives of the five species within genus Mannheimia. We also consider how the evolution of the leukotoxin operon fits with the evolution and maintenance of virulence. Results: The alignment of the intergenic regions upstream of the leukotoxin genes showed significant...

  5. Substrates specialization in lipid compounds and hydrocarbons of Marinobacter genus

    NARCIS (Netherlands)

    Bonin, P.; Vieira, C.; Grimaud, R.; Militon, C.; Cuny, P.; Lima, O.; Guasco, S.; Brussaard, C.P.D.; Michotey, V.


    The impact of petroleum contamination and of burrowing macrofauna on abundances of Marinobacter and denitrifiers was tested in marine sediment mesocoms after 3 months incubation. Quantification of this genus by qPCR with a new primer set showed that the main factor favoring Marinobacter abundance

  6. Nomenclatural realignment of Neotyphodium species with genus Epicholë. (United States)

    Leuchtmann, Adrian; Bacon, Charles W; Schardl, Christopher L; White, James F; Tadych, Mariusz


    Nomenclatural rule changes in the International Code of Nomenclature for algae, fungi and plants, adopted at the 18th International Botanical Congress in Melbourne, Australia, in 2011, provide for a single name to be used for each fungal species. The anamorphs of Epichloë species have been classified in genus Neotyphodium, the form genus that also includes most asexual Epichloë descendants. A nomenclatural realignment of this monophyletic group into one genus would enhance a broader understanding of the relationships and common features of these grass endophytes. Based on the principle of priority of publication we propose to classify all members of this clade in the genus Epichloë. We have reexamined classification of several described Epichloë and Neotyphodium species and varieties and propose new combinations and states. In this treatment we have accepted 43 unique taxa in Epichloë, including distinct species, subspecies, and varieties. We exclude from Epichloë the two taxa Neotyphodium starrii, as nomen dubium, and Neotyphodium chilense, as an unrelated taxon.

  7. A molecular phylogeny of selected species of genus Prunus L ...

    African Journals Online (AJOL)



    Aug 2, 2010 ... 52 - 56°C with the primers ITS-9 and ITS-6 or Trn-L and Trn-F. Polymerase chain .... The sub-genus Prunus has also relatively good support (81%) including .... Stevens, Michael J, Donoghue (1999). Plant Systematics. A.

  8. Comparative genomic analysis reveals ecological differentiation in the genus Carnobacterium

    DEFF Research Database (Denmark)

    Iskandar, Christelle F.; Borges, Frédéric; Taminiau, Bernard


    was used as a model genus to elucidate the genetic basis of these colonization differences. Analyses of 16S rRNA gene meta-barcoding data showed that C. maltaromaticum followed by C. divergens are the most prevalent species in foods derived from animals (meat, fish, dairy products), and in the gut...

  9. South American freshwater needlefishes (Belonidae) of the genus Pseudotylosurus

    NARCIS (Netherlands)

    Collete, B.B.


    Pseudotylosurus Fernández Yépez is considered a valid genus of Belonidae based on the following combination of characters: depressed caudal peduncle; long narrow side branches to lateral line; pleural ribs attached to fourth vertebra; nasal papilla spatulate; lower pharyngeal plate and upper

  10. Distribution, diversity and conservation of the genus Aloe in Kenya ...

    African Journals Online (AJOL)

    The diversity patterns indicate a high concentration of taxa in three areas that are identified as Aloe hot spots and thus of high priority for conservation of the genus: The Kulal–Nyiro–Ndotos–Marsabit area in the north, the Taita-Shimba Hills zone to the southeast and the Naivasha–Baringo area in the Rift Valley. Most of the ...

  11. Polystomatidae (Monogenea) parasitic in the anuran genus Kassina ...

    African Journals Online (AJOL)

    An investigation into the parasite loads of several anuran species in the central and eastern parts of the Orange Free State led to the discovery of another new South African species of Polystoma, harboured in running frogs of the genus Kassina which has not previously been known as a host of adult polystomes. Detailed ...

  12. The Genus Theba (Mollusca: Gastropoda: Helicidae), Systematics and Distribution

    NARCIS (Netherlands)

    Gittenberger, E.; Ripken, Th. E.J.


    Our knowledge concerning taxonomy and zoogeography of the fossil and recent species of the helicid genus Theba is summarized and enlarged. The fossil T. arinagae spec. nov. is described from Gran Canaria. The recent T. andalusica spec. nov. and T. sacchii spec. nov. are described from the

  13. Studies on Colombian Cryptogams. VIII. The genus Jensenia Lindb. (Hepaticae)

    NARCIS (Netherlands)

    Gronde, van der Keympe


    A study of recent material of the dendroid thallose liverwort genus Jensenia (Metzgeriales) from the Colombian Andes revealed the existence of three taxa in the area: J. erythropus (Gott.) Grolle var. erythropus, J. erythropus var. nobandae van der Gronde var. nov. and J. florschuetzii van der

  14. Sesquiterpene lactones. XXXIV. Guaianolides in the genus Leuzea DC.

    Directory of Open Access Journals (Sweden)

    Gerard Nowak


    Full Text Available Guaianolides were found in three species of the genus Leuzea DC. Chlorojanerin, cynaropicrin and janerin were isolated from L. rhapontica subg. helenifolia (Gren, Gordon Holub and L. rhaponticoides Graells. From L. carthamoides (Willd. DC., chlorojanerin, cynaropicrin, janerin, cebellin E and repdiolide were obtained.

  15. Checklist of the fish parasitic genus Cichlidogyrus (Monogenea ...

    African Journals Online (AJOL)

    Current knowledge of the 85 species in the genus Cichlidogyrus, collected worldwide, including their hosts, localities and authors, is summarised in a table. Although these parasites occur mainly in Africa, representatives have been recorded on cichlids in Mexico. Their distribution and host specificity are commented on.

  16. Karyotype analyses of the species of the genus Jurinea Cass ...

    African Journals Online (AJOL)

    In this study, karyotype analyses of 13 species belonging to the genus Jurinea Cass. (Compositae) and grown naturally in Turkey were conducted. These taxa include Jurinea alpigena C. Koch, Jurinea ancyrensis Bornm., Jurinea aucherana DC., Jurinea cadmea Boiss., Jurinea cataonica Boiss. and Hausskn., Jurinea ...

  17. Biological advances in Bergenia genus plant | Zhang | African ...

    African Journals Online (AJOL)

    Bergenia, a genus belonging to Saxifragaceae family, is one of the most important medicinal plants, has high application values for human. Currently, wild Bergenia is becoming lacking, due to destruction of ecological environment and excessive excavation; furthermore, the study on it is not deep enough, many related ...

  18. The taxonomic status of giant sengis ( genus Rhynchocyon ) in ...

    African Journals Online (AJOL)

    The sengis (elephant-shrews) of Mozambique are poorly known, especially the taxonomic status of the giant sengis, genus Rhynchocyon. Currently, Rhynchocyon from Mozambique are thought to be chequered sengis, R. cirnei with specimens from the central coastal areas being placed in the subspecies R. c. cirnei, while ...

  19. A new genus of Odontopygid Millipeds from Tanzania (Diplopoda ...

    African Journals Online (AJOL)

    The new generic taxon Calyptomastix is proposed to accommodate the type species Odontopyge kakandae Kraus, 1958, and, tentatively, Odontopyge dorsalis Carl, 1909, Haplothysanus leviceps Attems, 1909, and Spirostreptus pardalis Gerstäcker, 1873, all from Tanzania. This genus is defined by the broad basal ...

  20. Phytochemical and Pharmacological Studies of the Genus Tacca : A ...

    African Journals Online (AJOL)

    Tacca is an important genus comprising of approximately 15 species of the medicinal plants (Taccaceae). The plants are used in traditional medicine to relieve pains of the body and stomach, as an antidote for food poisoning as well as for their analgesic, antipyretic and anti-inflammatory activities. Chemical studies have ...

  1. Bean Pod Mottle Virus (BPMV) (Genus Comovirus ): A Limiting ...

    African Journals Online (AJOL)

    The reactions of twenty soybean varieties to infection with Bean Pod Mottle Virus (BPMV) (Genus Comovirus) disease were studied for 2 consecutive years in the Department of Crop Science University of Nigeria, Nsukka Farm (Latitude 060 25N; Longitude 070 24N; attitude 447.26 m above sea level). Factorial arrangement ...

  2. Hurleyella, a new genus of Nearctic Dolichopodidae (Diptera) (United States)

    Justin Runyon; Harold Robinson


    The new micro-dolichopodid genus Hurleyella and two new species, H. cumberlandensis and H. brooksi are described from the Nearctic. Hurleyella resembles the subfamily Medeterinae in having the legs bare of major setae, a depressed posterior mesonotum, and concave dorsal postcranium, but the complex male genitalia is unlike the relatively simple structure of...

  3. Studies on the genus Atriplex L. (Amaranthaceae) in Italy. IV ...

    African Journals Online (AJOL)

    Studies on the genus Atriplex L. (Amaranthaceae) in Italy. IV. Atriplex bocconei Guss. – Atriplex bocconei Guss. is here typified on one herbarium specimen kept in NAP. The identity of the species is also clarified on the basis of literature analysis and examination of type material and other specimens that allowed to include it ...

  4. Phylogenetic relationships in genus Gloriosa L. | Maroyi | African ...

    African Journals Online (AJOL)

    In an attempt to test the monophyly of the genus Gloriosa L., the chloroplast region trnL-trnF sequences were employed using Baeometra uniflora, Hexacyrtis dickiana, Neodregea glassii, Onixotis punctata, Onixotis stricta, Ornithoglossum parviflorum, Ornithoglossum undulatum, Ornithoglossum viride, Ornithoglossum ...

  5. The genus Calvatia ('Gasteromycetes', Lycoperdaceae): A review of ...

    African Journals Online (AJOL)

    Several members of the fungal puffball genus Calvatia Fr. have found widespread use amongst various cultures world-wide, especially as sources of food and/or traditional medicine. Hitherto the biotechnological potential of only a handful of Calvatia species, namely C. cyathiformis, C. craniiformis, C. excipuliformis, C.

  6. Chemosyndromes in the lichen genus Teloschistes (Teloschistaceae, Lecanorales)

    DEFF Research Database (Denmark)

    Søchting, Ulrik; Frödén, P.


    , and isofulgidin occurred together with some compounds of unknown identity in varying proportions in T. flavicans, T. peruensis, T. stellatus, and one unnamed taxon. Nine chemosyndromes were found in the genus. Most species had only one chemosyndrome, but T. flavicans s. lat. had six syndromes. The geographical...

  7. Relative symplectic caps, 4-genus and fibered knots

    Indian Academy of Sciences (India)

    We prove relative versions of the symplectic capping theorem and sufficiency of Giroux's criterion for Stein fillability and use these to study the 4-genus of knots. More precisely, suppose we have a symplectic 4-manifold with convex boundary and a symplectic surface in such that is a transverse knot in .

  8. On the African species of the genus Psychopsis Newm. (Osmylidae)

    NARCIS (Netherlands)

    Weele, van der H.W.


    This remarkable genus, only recorded from Australia and the Old World, was represented by one species in central Africa, Psychopsis zebra Brauer, Ann. Hofmuseum Wien, IV, p. 102 (1889). I had not seen this species before this year, when I purchased, from the London naturalist W. F. H. Rosenberg, a

  9. Pollen Ultrastructure of Genus Dendrobium Orchids as a Learning Resource

    Directory of Open Access Journals (Sweden)

    Lika Dwi Apriani


    Full Text Available Anggrek genus Dendrobium merupakan salah satu genus dari divisi spermatophyta yang merupakan kelompok tumbuhan yang berkembang dengan menggunakan biji. Tumbuhan berbiji tentu memiliki bunga sebagai alat perkembangan generatifnya. Perkembangan generatif pada bunga artinya pertemuan antara sel gamet jantan dan sel gamet betina. Sel gamet betina pada tumbuhan dihasilkan oleh putik, sedangkan sel gamet jantan disebut serbuk sari atau pollen. Genus Dendrobium merupakan salah satu kekayaan alam Indonesia, jumlahnya diperkirakan mencapai 275 spesies. Penelitian ini bertujuan untuk mengetahui bagaimana ultrastruktur pollen anggrek genus Dendrobium dari sepuluh spesies yang diamati menggunakan SEM. Jenis penelitian ini adalah deskriptif kualitatif. Hasil penelitian menunjukkan unit pollen untuk semua spesies yaitu kategori pollinia, sedangkan untuk polaritas pollen adalah apolar. Jenis aperture kesepuluh spesies yang diamati mempunyai aperture dengan pola yang tidak beraturan dan lebih dari enam yang disebut colpate. Bentuk pollen dari semua spesies yang diteliti bentuknya adalah subprolate hingga prolate dan ukuran pollen termasuk dalam kategori minuta hingga media. Ornamentasi pollen atau skluptur pollen tidak teridentifikasi dikarenakan ukuran pollen yang terlalu kecil, permukaan pollen terlihat kurang jelas. Sumber belajar yang digunakan adalah atlas.

  10. Quantitative variation for apomictic reproduction in the genus Boechera (Brassicaceae)

    NARCIS (Netherlands)

    Aliyu, O.M.; Schranz, M.E.; Sharbel, T.F.


    • Premise of the study: The evolution of asexual seed production (apomixis) from sexual relatives is a great enigma of plant biology. The genus Boechera is ideal for studying apomixis because of its close relation to Arabidopsis and the occurrence of sexual and apomictic species at low ploidy levels

  11. Revision of the genus Diaphorocera Heyden, 1863 (Coleoptera, Meloidae, Cerocomini)

    NARCIS (Netherlands)

    Turco, F.; Bologna, M.A.


    Diaphorocera, a Saharo-Sindian genus belonging to the tribe Cerocomini, is revised and a new synonymy is proposed. A cladistic classification is proposed as well, on a set of adult morphological characters. The available bionomical records, both original and from literature, concerning phenology,

  12. Multilocus sequence analysis of phytopathogenic species of the genus Streptomyces (United States)

    The identification and classification of species within the genus Streptomyces is difficult because there are presently 576 validly described species and this number increases every year. The value of the application of multilocus sequence analysis scheme to the systematics of Streptomyces species h...

  13. Relative symplectic caps, 4-genus and fibered knots

    Indian Academy of Sciences (India)

    convex boundary embeds in a closed symplectic 4-manifold. ... We shall apply Theorem 1.2 in particular to study the 4-genus of a link in S3 by proving ...... [13] Honda Ko, Factoring nonrotative T 2×I layers, Erratum: On the classification of tight.

  14. Stemodia L. (Scrophulariaceae, a Newly Naturalized Genus in Taiwan

    Directory of Open Access Journals (Sweden)

    Yi-Shou Liang


    Full Text Available Stemodia verticillata (Mill. Hassl. (Scrophulariaceae was found in the lowlands of northern Taiwan. This represents a new naturalization not only for this species but also for the genus on this island. A taxonomic account of S. verticillata is treated in this study. A line-drawing, distribution map and photographs of this species are also provided to aid in identification.

  15. New chromosome numbers in the genus Trigonella L. (Fabaceae ...

    African Journals Online (AJOL)


    10 Jan 2011 ... b: Subgenus Trifoliastrum: Calyx campanulate and pod inflated. c: Subgenus Foenum-graecum: Calyx tubular and pod not inflated. Several investigators have attempted to employ the taxonomy of the genus Trigonella; Sirjaev (1935) has given in Latin an elaborate and systematic account of its taxonomy.

  16. On five new species of the genus Ichthyurus, Westw

    NARCIS (Netherlands)

    Ritsema Cz., C.


    Of the above mentioned genus of Malacoderm Coleoptera, founded in 1848 by Westwood in his Cabinet of Oriental Entomology, twelve species have hitherto been described, all Natives of the Old World and distributed as follow: Sierra Leone (West Africa): one ¹); Moulmein (East-Indies): two ²); Ceylon:

  17. The genus Rhododendron L. in Indochina and Siam

    NARCIS (Netherlands)

    Sleumer, H.


    In the course of my recent revision of the genus Rhododendron in Malaysia it has become evident, that the subsect. Irrorata, regarded as purely South Eastern Asiatic up to now, is also represented in the Malay Peninsula and Sumatra, whilst the subsect. Euvireya, outside of its large Malaysian area,

  18. Counting Semisimple Orbits of Finite Lie Algebras by Genus


    Fulman, Jason


    The adjoint action of a finite group of Lie type on its Lie algebra is studied. A simple formula is conjectured for the number of split semisimple orbits of a given genus. This conjecture is proved for type A, and partial results are obtained for other types. For type A a probabilistic interpretation is given in terms of card shuffling.

  19. A molecular phylogeny of selected species of Genus Prunus L ...

    African Journals Online (AJOL)



    May 30, 2011 ... The genus Prunus L. is an important plant for fruit production and it includes plums, apricots, cherries, almonds ... classification and placement of different genera under different sub-families. ... cultivated primarily or their beautiful flowers, such as ..... described the character evolution in the 37 Prunus and 8.

  20. Pyrrolizidine alkaloids from Bulgarian species of the genus Senecio

    Directory of Open Access Journals (Sweden)



    Full Text Available Nine Bulgarian species from the genus Senecio were studied phytochemically and/or by GC-MS analysis. Senecivernine-N-oxide was isolated and identified by spectral data for the first time. Different types of pyrrolizidine alkaloids were tested for cytotoxicity on murine lymphocytes. At a concentration of 100 µg/ml, the alkaloid retroisosenine showed immunosuppressive effect.

  1. Ethnobotany, chemistry, and biological activities of the genus Tithonia (Asteraceae). (United States)

    Chagas-Paula, Daniela A; Oliveira, Rejane B; Rocha, Bruno A; Da Costa, Fernando B


    The genus Tithonia is an important source of diverse natural products, particularly sesquiterpene lactones, diterpenes, and flavonoids. The collected information in this review attempts to summarize the recent developments in the ethnobotany, biological activities, and secondary metabolite chemistry of this genus. More than 100 structures of natural products from Tithonia are reported in this review. The species that has been most investigated in this genus is T. diversifolia, from which ca. 150 compounds were isolated. Biological studies are described to evaluate the anti-inflammatory, analgesic, antimalarial, antiviral, antidiabetic, antidiarrhoeal, antimicrobial, antispasmodic, vasorelaxant, cancer-chemopreventive, cytotoxic, toxicological, bioinsecticide, and repellent activities. A few of these studies have been carried out with isolated compounds from Tithonia species, but the majority has been conducted with different extracts. The relationship between the biological activity and the toxicity of compounds isolated from the plants of this genus as well as T. diversifolia extracts still remains unclear, and mechanisms of action remain to be determined. Copyright © 2012 Verlag Helvetica Chimica Acta AG, Zürich.

  2. New species of the stingless bee genus Schwarziana (Hymenoptera, Apidae

    Directory of Open Access Journals (Sweden)

    Gabriel A.R. Melo


    Full Text Available ABSTRACT Two new species of the stingless bee genus Schwarziana from Brazil are described and illustrated. Schwarziana bocainensis sp. nov. is described from Serra da Bocaina, in São Paulo, and S. chapadensis sp. nov. is described from Chapada dos Veadeiros, in Goiás. An identification key to workers of the known species of Schwarziana is provided.

  3. Phylogenetic analysis of the genus Hordeum using repetitive DNA sequences

    DEFF Research Database (Denmark)

    Svitashev, S.; Bryngelsson, T.; Vershinin, A.


    A set of six cloned barley (Hordeum vulgare) repetitive DNA sequences was used for the analysis of phylogenetic relationships among 31 species (46 taxa) of the genus Hordeum, using molecular hybridization techniques. In situ hybridization experiments showed dispersed organization of the sequences...

  4. Resistance to Phytophthora cinnamomi in the Genus Abies (United States)

    John Frampton; Fikret Isik; Mike Benson; Jaroslav Kobliha; Jan Stjskal


    A major limiting factor for the culture of true firs as Christmas trees is their susceptibility to Oomycete species belonging to the genus Phytophthora. In North Carolina alone, the Fraser fir (Abies fraseri [Pursh] Poir.) Christmas tree industry loses 6 to 7 million dollars annually to root rot primarily caused by ...

  5. Studies in the family Thelypteridaceae X. The genus Coryphopteris

    NARCIS (Netherlands)

    Holttum, R.E.


    All known species of this genus are described, with synonymy for each and a key for identification. Seventeen new species are described: C. andersonii, C. andreae, C. arthrotricha, C. atjehensis, C. athyrioides, C. borealis, C. brevipilosa, C. hubrechtensis, C. iwatsukii, C. kolombangarae, C.

  6. Padrão de resposta de Mimosa pudica e Senna obtusifolia à atividade potencialmente alelopática de espécies de Poaceae Response pattern of Mimosa pudica e Senna obtusifolia to potentially allelopathic activity of Poaceae species

    Directory of Open Access Journals (Sweden)

    A.P.S. Souza Filho


    Full Text Available A alelopatia é um importante mediador de interferências que alteram a dinâmica de espécies de plantas em sistemas agrícolas. Neste trabalho, procurou-se determinar a existência de padrão de respostas das plantas daninhas Mimosa pudica e Senna obtusifolia a espécies da família Poaceae, via interação entre espécies e frações e ordenamento dos efeitos. Bioensaios de germinação de sementes e alongamento da radícula e do hipocótilo foram desenvolvidos, em condições controladas. Os testes foram realizados utilizando-se extratos hidroalcoólicos na concentração de 1,0% das frações folha, raiz e sementes de quatro espécies de Poaceae. Diferenças na intensidade dos efeitos para os fatores espécie e fração foram verificadas. O padrão de atividade observado foi de Paspalum maritimum apresentar as inibições mais intensas. Entre as espécies de Brachiaria, as inibições mais intensas foram produzidas por B. brizantha. Houve resposta efetiva para a especificidade entre espécies e fração para a germinação e alongamento da radícula, especialmente na espécie Mimosa pudica. Apenas para os extratos de P. maritimum foram observadas especificidade e efetividade em relação à germinação de sementes e alongamento da radícula da espécie Senna obtusifolia. A fração folha foi mais efetiva nas inibições, sobretudo na espécie P. maritimum. Comparativamente, a espécie Mimosa pudica foi mais sensível aos efeitos dos extratos, especialmente em relação ao desenvolvimento da radícula e do hipocótilo. A intensidade dos efeitos alelopáticos variou na seguinte ordem: alongamento da radícula > germinação de sementes > alongamento do hipocótilo. A ordenação dos resultados, para os indicadores de inibição, indicou discriminação no padrão para as espécies receptoras, o que sugere especificidade dos extratos.Allelopathy is an important device to measure interferences affecting the dynamics of plant species in

  7. Molecular signatures and phylogenomic analysis of the genus Burkholderia: proposal for division of this genus into the emended genus Burkholderia containing pathogenic organisms and a new genus Paraburkholderia gen. nov. harboring environmental species. (United States)

    Sawana, Amandeep; Adeolu, Mobolaji; Gupta, Radhey S


    The genus Burkholderia contains large number of diverse species which include many clinically important organisms, phytopathogens, as well as environmental species. However, currently, there is a paucity of biochemical or molecular characteristics which can reliably distinguish different groups of Burkholderia species. We report here the results of detailed phylogenetic and comparative genomic analyses of 45 sequenced species of the genus Burkholderia. In phylogenetic trees based upon concatenated sequences for 21 conserved proteins as well as 16S rRNA gene sequence based trees, members of the genus Burkholderia grouped into two major clades. Within these main clades a number of smaller clades including those corresponding to the clinically important Burkholderia cepacia complex (BCC) and the Burkholderia pseudomallei groups were also clearly distinguished. Our comparative analysis of protein sequences from Burkholderia spp. has identified 42 highly specific molecular markers in the form of conserved sequence indels (CSIs) that are uniquely found in a number of well-defined groups of Burkholderia spp. Six of these CSIs are specific for a group of Burkholderia spp. (referred to as Clade I in this work) which contains all clinically relevant members of the genus (viz. the BCC and the B. pseudomallei group) as well as the phytopathogenic Burkholderia spp. The second main clade (Clade II), which is composed of environmental Burkholderia species, is also distinguished by 2 identified CSIs that are specific for this group. Additionally, our work has also identified multiple CSIs that serve to clearly demarcate a number of smaller groups of Burkholderia spp. including 3 CSIs that are specific for the B. cepacia complex, 4 CSIs that are uniquely found in the B. pseudomallei group, 5 CSIs that are specific for the phytopathogenic Burkholderia spp. and 22 other CSI that distinguish two groups within Clade II. The described molecular markers provide highly specific means for

  8. Molecular signatures and phylogenomic analysis of the genus Burkholderia: proposal for division of this genus into the emended genus Burkholderia containing pathogenic organisms and a new genus Paraburkholderia gen. nov. harboring environmental species (United States)

    Sawana, Amandeep; Adeolu, Mobolaji; Gupta, Radhey S.


    The genus Burkholderia contains large number of diverse species which include many clinically important organisms, phytopathogens, as well as environmental species. However, currently, there is a paucity of biochemical or molecular characteristics which can reliably distinguish different groups of Burkholderia species. We report here the results of detailed phylogenetic and comparative genomic analyses of 45 sequenced species of the genus Burkholderia. In phylogenetic trees based upon concatenated sequences for 21 conserved proteins as well as 16S rRNA gene sequence based trees, members of the genus Burkholderia grouped into two major clades. Within these main clades a number of smaller clades including those corresponding to the clinically important Burkholderia cepacia complex (BCC) and the Burkholderia pseudomallei groups were also clearly distinguished. Our comparative analysis of protein sequences from Burkholderia spp. has identified 42 highly specific molecular markers in the form of conserved sequence indels (CSIs) that are uniquely found in a number of well-defined groups of Burkholderia spp. Six of these CSIs are specific for a group of Burkholderia spp. (referred to as Clade I in this work) which contains all clinically relevant members of the genus (viz. the BCC and the B. pseudomallei group) as well as the phytopathogenic Burkholderia spp. The second main clade (Clade II), which is composed of environmental Burkholderia species, is also distinguished by 2 identified CSIs that are specific for this group. Additionally, our work has also identified multiple CSIs that serve to clearly demarcate a number of smaller groups of Burkholderia spp. including 3 CSIs that are specific for the B. cepacia complex, 4 CSIs that are uniquely found in the B. pseudomallei group, 5 CSIs that are specific for the phytopathogenic Burkholderia spp. and 22 other CSI that distinguish two groups within Clade II. The described molecular markers provide highly specific means for

  9. The genus Psiadia: Review of traditional uses, phytochemistry and pharmacology. (United States)

    Mahadeo, Keshika; Grondin, Isabelle; Kodja, Hippolyte; Soulange Govinden, Joyce; Jhaumeer Laulloo, Sabina; Frederich, Michel; Gauvin-Bialecki, Anne


    The genus Psiadia Jacq. ex. Willd. belongs to the Asteraceae family and includes more than 60 species. This genus grows in tropical and subtropical regions, being especially well represented in Madagascar and the Mascarene Islands (La Réunion, Mauritius and Rodrigues). Several Psiadia species have been used traditionally for their medicinal properties in Africa and the Mascarene Islands. Based on traditional knowledge, various phytochemical and pharmacological studies have been conducted. However there are no recent papers that provide an overview of the medicinal potential of Psiadia species. Therefore, the aim of this review is to provide a comprehensive summary of the botany, phytochemistry and pharmacology of Psiadia and to highlight the gaps in our knowledge for future research opportunities. The available information on traditional uses, phytochemistry and biological activities of the genus Psiadia was collected from scientific databases through a search using the keyword 'Psiadia' in 'Google Scholar', 'Pubmed', 'Sciencedirect', 'SpringerLink', 'Web of Science', 'Wiley' and 'Scifinder'. Additionally, published books and unpublished Ph.D. and MSc. dissertations were consulted for botanical information and chemical composition. Historically, species of the genus Psiadia have been used to treat a wide range of ailments including abdominal pains, colds, fevers, bronchitis, asthma, rheumatoid arthritis, skin infections and liver disorders among others. Phytochemical works led to the isolation of flavonoids, phenylpropanoids, coumarins and terpenoids. Furthermore, phytochemical compositions of the essential oils of some species have been evaluated. Crude extracts, essential oils and isolated molecules showed in vitro pharmacological activities, such as antimicrobial, anti-viral, anti-inflammatory, antiplasmodial and antileishmanial activities. Crude extracts of Psiadia dentata and Psiadia arguta have specifically been found to be potentially useful for inhibition

  10. Revision of the genus 'Microbrotula' (Teleostei: Bythitidae), with description of two new species and a related new genus

    DEFF Research Database (Denmark)

    Schwarzhans, Werner; Nielsen, Jørgen


    Following recent systematic revisions of Anderson (2005, 2007), seven species of the viviparous genus Microbrotula (Teleostei: Bythitidae) have been described, all from the Indo-west Pacific Ocean. Six of these species are here recognised as valid: M. bentleyi, M. greenfieldi, M. punicea, M. quee...

  11. Two new species of genus Hydrosmittia Ferrington & Sæther (Diptera: Chironomidae) from China. (United States)

    Zhang, Ruilei; Liu, Wenbin; Ferrington, Leonard C Jr; Wang, Xinhua


    The genus Hydrosmittia from China is reviewed. Two new species H. continalinea sp. n. and H. sipinata sp. n. are described and illustrated based on male imagines. Key to known male imagines of genus Hydrosmittia worldwide is provided.

  12. Description of a new species of the genus Litus Haliday (Hymenoptera: Chalcidoidea: Mymaridae from India

    Directory of Open Access Journals (Sweden)

    Tabassum Rehmat


    Full Text Available A new species of the genus Litus Haliday (Chalcidoidea: Mymaridae, Litus assamensis sp. nov., is described from Assam, India.  A key to the Indian species of the genus is also given. 

  13. Neocampanella, a new corticioid fungal genus, and a note on Dendrothele bispora (United States)

    Karen K. Nakasone; David S. Hibbett; Greta Goranova


    The new genus Neocampanella (Agaricales, Agaricomycetes, Basidiomycota) is established for Dentocorticium btastanos Boidin & Gilles, a crustose species, and the new combination, Neocampanella blastanos, is proposed. Morphological and molecular studies support the recognition of the new genus and its close...

  14. Baltileuctra gen. nov., a new genus of Leuctridae (Insecta: Plecoptera) in Baltic amber. (United States)

    Chen, Zhi-Teng


    A new genus and species of the stonefly family Leuctridae, Baltileuctra foraminis gen. et sp. nov., is described and illustrated based on a well-preserved male specimen from the Eocene Baltic amber. The new genus possesses typical characters of Leuctridae but has diagnostic characters of the thoracic sclerites and terminalia. The relationship between the new genus and other leuctrids is briefly discussed.

  15. The species of the Neotropical genus Fractipons Townes, 1970 (Hymenoptera, Ichneumonidae, Cryptinae). (United States)

    Bordera, Santiago; González-Moreno, Alejandra


    In this paper, two new species of the Neotropical genus Fractipons Townes, 1970 (Hymenoptera, Ichneumonidae) are described. A new diagnosis for the genus, a re-description of Fractipons cincticornis Townes, 1970 and a key to known species are provided. New distribution records for the genus now include Argentina, Costa Rica, Panama and Peru.

  16. A new species of the genus Linoderus Sharp, 1885 (Coleoptera, Staphylinidae, Philonthina) from the Colombian Andes. (United States)

    López-García, Margarita M; Méndez-Rojas, Diana M


    The monotypic genus Linoderus Sharp, 1885 was described based on a species from Panama and since the original description nearly nothing has been added to its taxonomical knowledge. The aim of the present paper is to describe a new species of the genus from Colombia and to report the genus for the first time from South America, adding some biological notes of the species.

  17. Taxonomic revision of the afrotropical genus Megatrigon Johnson, 1898 (Diptera: Syrphidae)

    DEFF Research Database (Denmark)

    Doczkal, Dieter; Radenković, Snežana; Lyneborg, Leif


    The genus-group taxon Megatrigon Johnson, 1898, stat. nov., is revised and treated as a valid genus within the Merodontini (= Eumerini). Extensive diagnoses are given for the genus and for its three constituent species groups: argenteus group [11 spp.], nivalis group [monotypic], sexfasciatus group...

  18. Computational identification of strain-, species- and genus-specific proteins

    Directory of Open Access Journals (Sweden)

    Thiagarajan Rathi


    Full Text Available Abstract Background The identification of unique proteins at different taxonomic levels has both scientific and practical value. Strain-, species- and genus-specific proteins can provide insight into the criteria that define an organism and its relationship with close relatives. Such proteins can also serve as taxon-specific diagnostic targets. Description A pipeline using a combination of computational and manual analyses of BLAST results was developed to identify strain-, species-, and genus-specific proteins and to catalog the closest sequenced relative for each protein in a proteome. Proteins encoded by a given strain are preliminarily considered to be unique if BLAST, using a comprehensive protein database, fails to retrieve (with an e-value better than 0.001 any protein not encoded by the query strain, species or genus (for strain-, species- and genus-specific proteins respectively, or if BLAST, using the best hit as the query (reverse BLAST, does not retrieve the initial query protein. Results are manually inspected for homology if the initial query is retrieved in the reverse BLAST but is not the best hit. Sequences unlikely to retrieve homologs using the default BLOSUM62 matrix (usually short sequences are re-tested using the PAM30 matrix, thereby increasing the number of retrieved homologs and increasing the stringency of the search for unique proteins. The above protocol was used to examine several food- and water-borne pathogens. We find that the reverse BLAST step filters out about 22% of proteins with homologs that would otherwise be considered unique at the genus and species levels. Analysis of the annotations of unique proteins reveals that many are remnants of prophage proteins, or may be involved in virulence. The data generated from this study can be accessed and further evaluated from the CUPID (Core and Unique Protein Identification system web site (updated semi-annually at Conclusion CUPID

  19. Medicinal uses, phytochemistry and pharmacology of the genus Uncaria. (United States)

    Zhang, Qian; Zhao, Jiao Jiao; Xu, Jian; Feng, Feng; Qu, Wei


    The genus Uncaria belongs to the family Rubiaceae, which mainly distributed in tropical regions, such as Southeast Asia, Africa and Southeast America. Their leaves and hooks have long been thought to have healing powers and are already being tested as a treatment for asthma, cancer, cirrhosis, diabetes, hypertension, stroke and rheumatism. The present review aims to provide systematically reorganized information on the ethnopharmacology, phytochemistry and pharmacology of the genus Uncaria to support for further therapeutic potential of this genus. To better understanding this genus, information on the stereo-chemistry and structure-activity relationships in indole alkaloids is also represented. The literature study of this review is based on various databases search (SCIFinder, Science Direct, CNKI, Wiley online library, Spring Link, Web of Science, PubMed, Wanfang Data, Medalink, Google scholar, ACS, Tropicos, Council of Heads of Australasian Herbaria, The New York Botanical Garden, African Plants Database at Genera Botanical Garden, The Plant List and SEINet) and library search for Biological Abstract and some local books on ethnopharmacology. 19 species of the genus Uncaria are found to be important folk medicines in China, Malaysia, Phillippines, Africa and Southeast America, etc, and have been served for the treatment of asthma, rheumatism, hyperpyrexia, hypertension and headaches, etc. More than 200 compounds have been isolated from Uncaria, including indole alkaloids, triterpenes, flavonoids, phenols, phenylpropanoids, etc. As characteristic constituents, indole alkaloids have been considered as main efficacy component for hypertension, epilepsy, depressant, Parkinson's disease and Alzheimer's disease. In addition, pharmacokinetic and metabolism investigation reveal that the indole alkaloids are likely to be absorbed, metabolized and excreted at early time points. Moreover, the specific inhibition of CYP isozymes can regulate their hydroxylation metabolites

  20. A Review of Recent Research Progress on the Astragalus Genus

    Directory of Open Access Journals (Sweden)

    Xiaoxia Li


    Full Text Available Astragalus L., is one of the largest genuses of flowering plants in the Leguminosae family. Roots of A. membranaceus Bge. var. mongholicus (Bge. Hsiao, A. membranaceus (Fisch. Bge. and its processed products are listed in the China Pharmacopeia for “qi deficiency” syndrome treatment. However, more and more researches on other species of Astragalus have been conducted recently. We summarize the recent researches of Astragalus species in phytochemistry and pharmacology. More than 200 constituents, including saponins and flavonoids, obtained from 46 species of Astragalus genus were collected for this article. In pharmacological studies, crude extracts of Astragalus, as well as isolated constituents showed anti-inflammatory, immunostimulant, antioxidative, anti-cancer, antidiabetic, cardioprotective, hepatoprotective, and antiviral activities. The goal of this article is to provide an overview of chemical and pharmacological studies on the Astragalus species over the last 10 years, which could be of value to new drug or food supplement research and development.

  1. Use of the genus Artemia in ecotoxicity testing

    International Nuclear Information System (INIS)

    Nunes, Bruno S.; Carvalho, Felix D.; Guilhermino, Lucia M.; Van Stappen, Gilbert


    Information related to varied uses of several species of the genus Artemia (commonly known as brine shrimp), is dispersed among literature from several scientific areas, such as Ecology, Physiology, Ecotoxicology, Aquaculture and Genetics. The present paper reviews information related to Artemia that may be considered relevant for ecotoxicity testing. Integration of different areas of scientific knowledge concerning biology, life cycle and environmental needs of Artemia is of crucial importance when considering the interpretation of results drawn from tests involving this genus. Furthermore, this paper provides suggestions to overcome problems related to toxicity assessment with the use of Artemia as test organism in bioassays, under the scope of estuarine, marine and hypersaline environments. Aspects related to variability in results, adoptable toxicity end-points, culture conditions, characteristics of species and strains, influence of geographical origins over physiological features and responses to exposure to chemical agents are considered. - The physiology, reproductive processes and general use of Artemia in modern ecotoxicological testing are reviewed

  2. The genus Chlamydotheca Saussure (Crustacea: Ostracoda in northeastern Argentina

    Directory of Open Access Journals (Sweden)

    Analía R. Díaz

    Full Text Available The genus Chlamydotheca Saussure, 1858 is a typical representative of the Neotropical ostracod fauna that occupies lotic and lentic environments including temporary and permanent ponds. Up to the present, four species have been recorded in Argentina: C. iheringi (Sars, C. incisa (Claus and C. leuckarti (Claus, and C. symmetrica (Vávra. Temporary and permanent ponds of this region were sampled for ostracods, using a fine mesh net. Three species belonging to the genus Chlamydotheca were collected of which C. arcuata (Sars is recorded for first time for the Chacoan region. Limb morphology was studied under light microscope and line drawings were made using camera lucida. Valves were photographed under scanning electron microscope and redescriptions of C. arcuata and C. iheringi are provided and distributional aspects of the species sampled are discussed.

  3. Ortholog prediction of the Aspergillus genus applicable for synthetic biology

    DEFF Research Database (Denmark)

    Rasmussen, Jane Lind Nybo; Vesth, Tammi Camilla; Theobald, Sebastian

    of genotype-to-phenotype. To achieve this, we have developed orthologous protein prediction software that utilizes genus-wide genetic diversity. The approach is optimized for large data sets, based on BLASTp considering protein identity and alignment coverage, and clustering using single linkage of bi......The Aspergillus genus contains leading industrial microorganisms, excelling in producing bioactive compounds and enzymes. Using synthetic biology and bioinformatics, we aim to re-engineer these organisms for applications within human health, pharmaceuticals, environmental engineering, and food......-directional hits. The result is orthologous protein families describing the genomic and functional features of individual species, clades and the core/pan genome of Aspergillus; and applicable to genotype-to-phenotype analyses in other microbial genera....

  4. Brachylophora, a new brachypterous genus of Rhopalophorini (Coleoptera, Cerambycidae

    Directory of Open Access Journals (Sweden)

    Robin O. S. Clarke


    Full Text Available Brachylophora, a new brachypterous genus of Rhopalophorini (Coleoptera, Cerambycidae. Brachylophora auricollis (Bruch, 1918 comb. nov. = Pasiphyle auricollis Bruch, 1918, originally described from Argentina (Salta, is redescribed and illustrated. Although with reduced elytra, the genus is transferred from Rhinotragini to Rhopalophorini based on the following characters: eyes well separated in both sexes, frons between eyes depressed and lacking frontal suture; pro-, meso-, and metasternum planar; mesothorax parallel-sided, not at all declivous before mesosternal process; metasternum large, together with mesosternum twice length of prosternum, metepisternum very wide, entire suture separating it from metasternum clearly visible when viewed from below; female ovipositor shortened with short cylindrical styles; and, more generally, structural features of hind legs, and surface ornamentation. Habitus similar to Coremia group. Bolivian specimens were netted as they visited flowers of Croton sp. (Euphorbiaceae.

  5. Taxonomic Studies on the Genus Arnebia Forssk. (Boraginaceae in India

    Directory of Open Access Journals (Sweden)

    Kumar Ambrish


    Full Text Available The genus Arnebia Forssk. in India is taxonomically studied based on field surveys, collection of live plants, consultation of herbarium and literature. The genus is represented in India by 10 taxa including 8 species and 2 varieties viz., Arnebia bhattacharyyae K. Ambrish & S.K. Srivast., A. benthamii (Wall. ex G. Don I.M. Johnst., A. euchroma ( Royle I.M. Johnst., A. guttata Bunge, A. hispidissima (Sieber ex Lehm. A.DC., A. linearifolia A.DC., A. griffithii Boiss., A. nandadeviensis K. Chandra Sek. & R.S. Rawal , A. euchroma var. grandis (Bornm. Kazmi and A. guttata var. thomsonii (C.B. Clarke Kazmi, distributed in Jammu & Kashmir, Himachal Pradesh and Uttarakhand in North-West Himalaya to Uttar Pradesh, Punjab and Rajasthan in India. Dichotomous keys to all the species in India along with taxonomic description, distribution, illustrations and images of most of the species including type and their economic importance are provided.

  6. Revision of the genus Intybia (Coleoptera, Malachiidae from Japan

    Directory of Open Access Journals (Sweden)

    Hiroshi Ikeda


    Full Text Available Japanese species of the genus Intybia are revised taxonomically, with the examination of the endophallic structure. Eight species, including one new species Intybia donan sp. nov. from Yonaguni-jima, are recognized. All species are described or redescribed with a key and figures. The endophallic structure contains one primary sclerite (gonoporal piece, three secondary sclerites (ligula, semi-gonoporal piece, and spinous plate in some species, and a membranous basal area densely covered with many spines (spinous area. Based on the structures of the endophallus, the Japanese members of the genus are divided into two species groups (the histrio and pelegrini groups. The pelegrini species group is furthermore subdivided into three subgroups (subgroups 1–3. New distributional records are as follows: I. histrio from Hachijô-jima and Tanega-shima; I. niponica from Sakhalin and I. takaraensis from Tokuno-shima and Amami-Ôshima.

  7. Genus Sisymbrium L. (Rockets In The Flora Of Latvia

    Directory of Open Access Journals (Sweden)

    Rūrāne Ieva


    Full Text Available One of the largest genera in the Cruciferae family in Latvia is Sisymbrium L. The genus includes not only native, but also some alien species. The distributions of the Sisymbrium species were reviewed for the first time in the last 50th years in Latvia. The distribution data were compiled from herbarium material, literature and field surveys. An identification key for the Sisymbrium species in Latvia and detailed scientific nomenclature are presented in the current study. In total, seven species of Sisymbrium were found in Latvia — S. supinum L., S. loeselii L., S. polymorphum (Murray Roth, S. volgense M. Bieb. ex E. Fourn., S. altissimum L., S. orientale L. and S. officinale (L. Scop. The mainly were recorded in railway verges, roadsides, waste dumps and wasteland. Five species of the genus are alien to the flora of Latvia — S. loeselii, S. altissimum, S. polymorphum, S. orientale, and S. volgense; two are native — S. supinum and S. officinale.

  8. Phylogeny, identification and nomenclature of the genus Aspergillus

    DEFF Research Database (Denmark)

    Samson, R.A.; Visagie, C.M.; Houbraken, J.


    , meaning that a decision had to be made whether to keep Aspergillus as one big genus or to split it into several smaller genera. The International Commission of Penicillium and Aspergillus decided to keep Aspergillus instead of using smaller genera. In this paper, we present the arguments for this decision...... data suggest that together with genera such as Polypaecilum, Phialosimplex, Dichotomomyces and Cristaspora, Aspergillus forms a monophyletic clade closely related to Penicillium. Changes in the International Code of Nomenclature for algae, fungi and plants resulted in the move to one name per species....... We introduce new combinations for accepted species presently lacking an Aspergillus name and provide an updated accepted species list for the genus, now containing 339 species. To add to the scientific value of the list, we include information about living ex-type culture collection numbers and Gen...

  9. Genus two partition functions of extremal conformal field theories

    International Nuclear Information System (INIS)

    Gaiotto, Davide; Yin Xi


    Recently Witten conjectured the existence of a family of 'extremal' conformal field theories (ECFTs) of central charge c = 24k, which are supposed to be dual to three-dimensional pure quantum gravity in AdS 3 . Assuming their existence, we determine explicitly the genus two partition functions of k = 2 and k = 3 ECFTs, using modular invariance and the behavior of the partition function in degenerating limits of the Riemann surface. The result passes highly nontrivial tests and in particular provides a piece of evidence for the existence of the k = 3 ECFT. We also argue that the genus two partition function of ECFTs with k ≤ 10 are uniquely fixed (if they exist)

  10. Systematics and biology of the African genus Ferraria (Iridaceae: Irideae

    Directory of Open Access Journals (Sweden)

    P. Goldblatt


    Full Text Available Following field and herbarium investigation of the subequatorial African and mainly western southern African Ferraria Burm. ex Mill. (Iridaceae: Iridoideae, a genus of cormous geophytes, we recognize 18 species, eight more than were included in the 1979 account of the genus by M.P. de Vos. One of these, F. ovata, based on Moraea ovata Thunb. (1800, was only discovered to be a species of Ferraria in 2001, and three more are the result of our different view of De Vos’s taxonomy. In tropical Africa, F. glutinosa is recircumscribed to include only mid- to late summer-flowering plants, usually with a single basal leaf and with purple to brown flowers often marked with yellow. A second summer-flowering species, F. candelabrum, includes taller plants with several basal leaves. Spring and early summer-flowering plants lacking foliage leaves and with yellow flowers from central Africa are referred to F. spithamea or F. welwitschii respectively.

  11. Chemical constituents and biological activities of the genus Linaria (Scrophulariaceae). (United States)

    Cheriet, Thamere; Mancini, Ines; Seghiri, Ramdane; Benayache, Fadila; Benayache, Samir


    This is a review on 95 references dealing with the genus Linaria (Scrophularioideae-Antirrhineae tribe), a known genus of the Scrophulariaceae family, which comprises about 200 species mainly distributed in Europe, Asia and North Africa. The use of some Linaria species in folk medicine has attracted the attention for chemical and biological studies. This report is aimed to be a comprehensive overview on the isolated or identified known and often new metabolites from the 41 Linaria species so far cited. It is organised presenting first the phytochemical classes of alkaloids, polyphenols including flavonoids, the latter being quite diffused and mostly present as flavones, flavonols and their glycosides, and terpenoids including iridoids and steroids. Second, the results from biological investigation on plant extracts, pure natural products isolated from Linaria species and some synthetic derivatives are reported, with antitumour, anti-acetylcholinesterase, anti-inflammatory and analgesic, antioxidant and antibacterial activities.

  12. A new genus of Rhytirrhinini from Colombia (Coleoptera: Curculionidae

    Directory of Open Access Journals (Sweden)

    Morrone Juan J.


    Full Text Available Rupanius, new genus, comprises the single species R. carinatus, new species, endemic to the Paramo biogeographic province of Colombia. It is diagnosed based on the elytra subquadrate and with a conspicuous declivital carina, and is considered similar to Puranlus Germain and Acrorius Kirsch. The genus and species are described, illustrated, and compared with the other Colombian Rhytirrhinini.Rupanius, gen. n., comprende la única especie R. carinatus, sp. n., endémica de la provincia biogeográfica del Páramo de Colombia. Este género se reconoce por los élitros subcuadrados y con una conspicua carena declivital y es considerado similar a Puranius Germain y Acrorius Kirsch. El género y especie son descritos, ilustrados y comparados con los otros Rhytirrhinini de Colombia.


    Directory of Open Access Journals (Sweden)



    Full Text Available A full taxonomic study of the genus Cyathea has recently been publish-ed in Flora Malesiana (Ser. II, vol. 1, part 2, Dec. 1963. In that work thegenus is construed in a broad sense, to include Alsophila and Hemitelia(also Gymnosphaera and Schizocaena of Copeland's Genera Filicum, theotal number of species being 191, and a new subdivision of this compre-hensive genus is proposed. The keys in Flora Malesiana, dealing with sucha large number of species, are complex, and not very easy to use for localpurposes. I have therefore made a simpler key to cover the species ofava only, and hope this will be of service to botaniists in Java.

  14. Use of the genus Artemia in ecotoxicity testing

    Energy Technology Data Exchange (ETDEWEB)

    Nunes, Bruno S. [Instituto de Ciencias Biomedicas de Abel Salazar, Departamento de Estudos de Populacoes, Laboratorio de Ecotoxicologia, Universidade do Porto, Largo Prof. Abel Salazar 2, 4099-003 Porto (Portugal) and Centro Interdisciplinar de Investigacao Marinha e Ambiental, Rua dos Bragas 289, 4150-123 Porto (Portugal)]. E-mail:; Carvalho, Felix D. [REQUIMTE, Departamento de Toxicologia da Faculdade de Farmacia da Universidade do Porto, Rua Anibal Cunha, 164, 4050-047 Porto (Portugal); Guilhermino, Lucia M. [Instituto de Ciencias Biomedicas de Abel Salazar, Departamento de Estudos de Populacoes, Laboratorio de Ecotoxicologia, Universidade do Porto, Largo Prof. Abel Salazar 2, 4099-003 Porto (Portugal); Centro Interdisciplinar de Investigacao Marinha e Ambiental, Rua dos Bragas 289, 4150-123 Porto (Portugal); Van Stappen, Gilbert [Laboratory of Aquaculture and Artemia Reference Centre, Ghent University, Rozier 44, B-9000 Ghent (Belgium)


    Information related to varied uses of several species of the genus Artemia (commonly known as brine shrimp), is dispersed among literature from several scientific areas, such as Ecology, Physiology, Ecotoxicology, Aquaculture and Genetics. The present paper reviews information related to Artemia that may be considered relevant for ecotoxicity testing. Integration of different areas of scientific knowledge concerning biology, life cycle and environmental needs of Artemia is of crucial importance when considering the interpretation of results drawn from tests involving this genus. Furthermore, this paper provides suggestions to overcome problems related to toxicity assessment with the use of Artemia as test organism in bioassays, under the scope of estuarine, marine and hypersaline environments. Aspects related to variability in results, adoptable toxicity end-points, culture conditions, characteristics of species and strains, influence of geographical origins over physiological features and responses to exposure to chemical agents are considered. - The physiology, reproductive processes and general use of Artemia in modern ecotoxicological testing are reviewed.

  15. Current Status of Genus Bryum Hedw. in Eastern Himalaya, India

    Directory of Open Access Journals (Sweden)

    Pooja Bansal


    Full Text Available A critical study on the genus Bryum Hedw., an acrocarpous moss of family Bryaceae, revealed the occurrence of 21 species from seven state of eastern Himalaya: Arunachal Pradesh, Assam, Manipur, Meghalaya, Nagaland, Sikkim and West Bengal. Among these twenty one species, B. argenteum var. griffithii (Muell. Hal. Gangulee, B. billardieri Schwaegr., B. pallescens Schleich. ex Schwaegr., B. pseudotriquetrum (Hedw. P. Gaertn., B. Meyer & Scherb., B. pseudotriquetrum var. subrotundum (Brid. Gangulee and B. reflexifolium (Ochi Ochi are new additions to Meghalaya; B. billardieri Schwaegr. to Manipur while B. apiculatum Schwaegr., B. caespiticium Hedw. and B. pseudotriquetrum var. subrotundum (Brid. Gangulee are new for West Bengal. Identification key to all the known species of the genus occurring in eastern Himalaya, alongwith the notes on their ecology and distribution have been provided.

  16. Phylogeny of the genus Stephomyia Tavares, 1916 (Diptera: Cecidomyiidae

    Directory of Open Access Journals (Sweden)

    V. C. Maia


    Full Text Available Abstract Stephomyia Tavares, 1916 comprises seven species, all Neotropical: S. clavata (Tavares, 1920; S. epeugeniae Gagné, 1994; S. espiralis Maia, 1993; S. mina Maia, 1993; S. rotundifoliorum Maia, 1993; S. tetralobae Maia, 1993; and S. eugeniae (Felt, 1913. In the present study, a cladistic analysis based upon adult, pupa, larva and gall morphological characters as well as host plant data is carried out in order to discuss the monophyly of the genus and the relationships among the known species. The Stephomyia monophyly was supported by eight synapomorphies: five homoplastic characters and three non-homoplastic characters. Analyzes showed S. clavata with great instability within the genus, probably due to lack of larva, pupa and female data, so S. clavata was deactivated in analyze. The topology found was (S. mina ((S. eugeniae + S. epeugeniae (S. tetralobae (S. rotundifoliorum + S. espiralis.


    Directory of Open Access Journals (Sweden)



    Full Text Available The Neotropical myrmicine ant genus Allomerus Mayr is revised. The genus isapparently monophyletic based on the antennal club confi guration. I recognize 8 species(4 described as new: Allomerus brevipilosus n. sp. (Brazil, A. decemarticulatusMayr (Brazil, French Guiana, A. dentatus n. sp. (Venezuela, A. maietae n. sp.(Brazil, A. octoarticulatus Mayr (=A. tuberculatus Forel n. syn. = A. octoarticulatusvar. demerarae W. M. Wheeler n. syn. = A. novemarticulatus Wheeler & Mann n.syn. [Brazil, Bolivia, Colombia, French Guiana, Peru], A. septemarticulatus Mayrstatus rev. (Brazil, A. undecemarticulatus n. sp. (Venezuela and A. vogeli Kempf(Venezuela, Brazil. Better knowledge of the taxonomy of Allomerus is needed tounderstand the apparently sporadic differences in antennal fl agellomere number andspeciation processes that are probably linked to plant cavity colonization.

  18. Genus-Wide Assessment of Lignocellulose Utilization in the Extremely Thermophilic Genus Caldicellulosiruptor by Genomic, Pangenomic, and Metagenomic Analyses. (United States)

    Lee, Laura L; Blumer-Schuette, Sara E; Izquierdo, Javier A; Zurawski, Jeffrey V; Loder, Andrew J; Conway, Jonathan M; Elkins, James G; Podar, Mircea; Clum, Alicia; Jones, Piet C; Piatek, Marek J; Weighill, Deborah A; Jacobson, Daniel A; Adams, Michael W W; Kelly, Robert M


    Metagenomic data from Obsidian Pool (Yellowstone National Park, USA) and 13 genome sequences were used to reassess genus-wide biodiversity for the extremely thermophilic Caldicellulosiruptor The updated core genome contains 1,401 ortholog groups (average genome size for 13 species = 2,516 genes). The pangenome, which remains open with a revised total of 3,493 ortholog groups, encodes a variety of multidomain glycoside hydrolases (GHs). These include three cellulases with GH48 domains that are colocated in the glucan degradation locus (GDL) and are specific determinants for microcrystalline cellulose utilization. Three recently sequenced species, Caldicellulosiruptor sp. strain Rt8.B8 (renamed here Caldicellulosiruptor morganii ), Thermoanaerobacter cellulolyticus strain NA10 (renamed here Caldicellulosiruptor naganoensis ), and Caldicellulosiruptor sp. strain Wai35.B1 (renamed here Caldicellulosiruptor danielii ), degraded Avicel and lignocellulose (switchgrass). C. morganii was more efficient than Caldicellulosiruptor bescii in this regard and differed from the other 12 species examined, both based on genome content and organization and in the specific domain features of conserved GHs. Metagenomic analysis of lignocellulose-enriched samples from Obsidian Pool revealed limited new information on genus biodiversity. Enrichments yielded genomic signatures closely related to that of Caldicellulosiruptor obsidiansis , but there was also evidence for other thermophilic fermentative anaerobes ( Caldanaerobacter , Fervidobacterium , Caloramator , and Clostridium ). One enrichment, containing 89.8% Caldicellulosiruptor and 9.7% Caloramator , had a capacity for switchgrass solubilization comparable to that of C. bescii These results refine the known biodiversity of Caldicellulosiruptor and indicate that microcrystalline cellulose degradation at temperatures above 70°C, based on current information, is limited to certain members of this genus that produce GH48 domain

  19. The genus Anterhynchium in the Philippine Islands (Hymenoptera: Vespidae, Eumeninae

    Directory of Open Access Journals (Sweden)

    Marco Selis


    Full Text Available A taxonomic study on the genus Anterhynchium de Saussure, 1863 from the Philippine Islands is presented. Two species are recorded: A. astrophilum Giordani Soika, 1996 and A. townesi van der Vecht, 1963. Anterhynchium astrophilum is recorded for the first time since its description, A. flavomarginatum townesi is raised to species rank (A. townesi stat. nov. and its unknown male is described. A key to the species and new distributional records are provided.

  20. Infinite-genus surfaces and the universal Grassmannian


    Davis, Simon


    Correlation functions can be calculated on Riemann surfaces using the operator formalism. The state in the Hilbert space of the free field theory on the punctured disc, corresponding to the Riemann surface, is constructed at infinite genus, verifying the inclusion of these surfaces in the Grassmannian. In particular, a subset of the class of $O_{HD}$ surfaces can be identified with a subset of the Grassmannian. The concept of flux through the ideal boundary is used to study the connection bet...

  1. Phylogenetic species delimitation for crayfishes of the genus Pacifastacus. (United States)

    Larson, Eric R; Castelin, Magalie; Williams, Bronwyn W; Olden, Julian D; Abbott, Cathryn L


    Molecular genetic approaches are playing an increasing role in conservation science by identifying biodiversity that may not be evident by morphology-based taxonomy and systematics. So-called cryptic species are particularly prevalent in freshwater environments, where isolation of dispersal-limited species, such as crayfishes, within dendritic river networks often gives rise to high intra- and inter-specific genetic divergence. We apply here a multi-gene molecular approach to investigate relationships among extant species of the crayfish genus Pacifastacus, representing the first comprehensive phylogenetic study of this taxonomic group. Importantly, Pacifastacus includes both the widely invasive signal crayfish Pacifastacus leniusculus, as well as several species of conservation concern like the Shasta crayfish Pacifastacus fortis. Our analysis used 83 individuals sampled across the four extant Pacifastacus species (omitting the extinct Pacifastacus nigrescens), representing the known taxonomic diversity and geographic distributions within this genus as comprehensively as possible. We reconstructed phylogenetic trees from mitochondrial (16S, COI) and nuclear genes (GAPDH), both separately and using a combined or concatenated dataset, and performed several species delimitation analyses (PTP, ABGD, GMYC) on the COI phylogeny to propose Primary Species Hypotheses (PSHs) within the genus. All phylogenies recovered the genus Pacifastacus as monophyletic, within which we identified a range of six to 21 PSHs; more abundant PSHs delimitations from GMYC and ABGD were always nested within PSHs delimited by the more conservative PTP method. Pacifastacus leniusculus included the majority of PSHs and was not monophyletic relative to the other Pacifastacus species considered. Several of these highly distinct P. leniusculus PSHs likely require urgent conservation attention. Our results identify research needs and conservation priorities for Pacifastacus crayfishes in western

  2. Femeniasia, novus genus Carduearum

    Directory of Open Access Journals (Sweden)

    Susanna de la Serna, Alfonso


    Full Text Available The systematic position of Centaurea balearica Rodríguez Femenias (Asteraceae-Cardueae is studied. A detailed analysis or its anatomy, with special reference to the carpology, forces the author lo reject its inclusion in the genus Centaurea or in any other genus or the tribe. A new genus, Femeniasia Susanna. is hence described, and the new nomenclatural combinari en Femeniasia balearica (Rodríguez Femenías Susanna is proposed. The relationship or Femeniasia and the other genera of the tribe is discussed; the author concludes that Femeniasia is a quite isolated genus in the Cardueae-Carduinae .

    [ca] Estudi de la posició sistemàtica de Centaurea balearica Rodríguez Femenías (Asteraceae-Cardueae . De l'anàlisi minuciosa de la seva anatomia, especialment de les seves cípseles, resulta que l'esmentada espècie no és cap Centaurea; tampoc pot ésser inclosa en cap del altres gèneres de la tribu. En conseqüència, hom descriu un nou gènere, Femeniasia Susanna, i proposa la combinació Femeniasia balearica (Rodríguez Femenías Susanna. Son analitzades les possibles relacions de parentiu amb d'altres gèneres del grup i l'autor arriba a la conclusió que Femeniasia és un gènere clarament isolat entre les Cardueae-Carduinae.

  3. Phylogenetic position and emended description of the genus Methylovorus. (United States)

    Doronina, Nina V; Ivanova, Ekaterina G; Trotsenko, Yuri A


    The genus Methylovorus, currently represented by the restricted facultative methylotroph Methylovorus glucosotrophus Govorukhina and Trotsenko 1991 and the obligate methylotroph Methylovorus mays Doronina et al. 2001, is here established by direct sequencing of amplified 16S rRNA genes and DNA-DNA hybridization to be clearly separated from the extant ribulose monophosphate (RuMP) pathway methylobacteria and to form a distinct branch within the beta-Proteobacteria.

  4. The genus Rhodosporidium: a potential source of beta-carotene. (United States)

    de Miguel, T; Calo, P; Díaz, A; Villa, T G


    Four wild-type species of the genus Rhodosporidium have been studied as as possible sources for the industrial production of beta-carotene. HPLC-based studies showed that their carotenoid composition consisted of almost pure beta-carotene at concentrations ranging from 226 to 685 micrograms/g of dried yeast biomass. These results are consistent with those obtained by spectrophotometry at 480 nm.

  5. Dew Point Temperature Affects Ascospore Release of Allergenic Genus Leptosphaeria


    Sadyś, M.; Kaczmarek, J.; Grinn-Gofron, A.; Rodinkova, V.; Prikhodko, A.; Bilous, E.; Strzelczak, A.; Herbert, Rob; Jedryczka, M.


    The genus Leptosphaeria contains numerous fungi that cause the symptoms of asthma and also parasitize wild and crop plants. In search of a robust and universal forecast model, the ascospore concentration in air was measured and weather data recorded from 1 March to 31 October between 2006 and 2012. The experiment was conducted in three European countries of the temperate climate, i.e., Ukraine, Poland, and the UK. Out of over 150 forecast models produced using artificial neural networks (ANNs...

  6. Chemical diversity and antiviral potential in the pantropical Diospyros genus


    Peyrat , Laure-Anne; Eparvier , Véronique; Eydoux , Cécilia; Guillemot , Jean-Claude; Stien , Didier; Litaudon , Marc


    International audience; A screening using a dengue replicon virus-cell-based assay was performed on 3563 ethyl acetate (EtOAc) extracts from different parts of 1500 plants. The screening led to the selection of species from the genus Diospyros (Ebenaceae), among which 25 species distributed in tropical areas showed significant inhibitory activity on dengue virus replication.A metabolic analysis was conducted from the UPLC-HRMS profiles of 33 biologically active and inactive plant extracts, an...

  7. Dryopsis (Dryopteridaceae, A Fern Genus New to Vietnam

    Directory of Open Access Journals (Sweden)

    Hui-Hui Ding


    Full Text Available Dryopsis clarkei (Baker Holttum & P.J. Edwards, representing the whole genus, is reported new to Vietnam. A detailed description, including the variation of gross morphology, spore morphology, and chromosome counts, is provided by means of words as well as photographs or drawings. Dryopsis clarkei is for the first time demonstrated to be a sexual diploid (2n = 82, with rather stable morphology except for the length of stipe.

  8. Quantum field theory on higher-genus Riemann surfaces, 2

    International Nuclear Information System (INIS)

    Kubo, Reijiro; Ojima, Shuichi.


    Quantum field theory for closed bosonic string systems is formulated on arbitrary higher-genus Riemann surfaces in global operator formalism. Canonical commutation relations between bosonic string field X μ and their conjugate momenta P ν are derived in the framework of conventional quantum field theory. Problems arising in quantizing bosonic systems are considered in detail. Applying the method exploited in the preceding paper we calculate Ward-Takahashi identities. (author)

  9. On the c-theorem in higher genus

    International Nuclear Information System (INIS)

    Espriu, D.; Mavromatos, N.E.


    We study the extension of the c-therorem to arbitrary genus Riemann surfaces. We analyze the breakdown of conformal invariance caused by the need of cutting off regions of moduli space to regulate divergences and argue how these can be absorbed in the bare couplings on the sphere. An extension of the c-theorem then follows. We also discuss the relationship between the c-theorem and the effective action when corrections from higher genera are accounted for. (orig.)

  10. Revision of the genus Diaphorocera Heyden, 1863 (Coleoptera, Meloidae, Cerocomini)


    Turco, F.; Bologna, M.A.


    Diaphorocera, a Saharo-Sindian genus belonging to the tribe Cerocomini, is revised and a new synonymy is proposed. A cladistic classification is proposed as well, on a set of adult morphological characters. The available bionomical records, both original and from literature, concerning phenology, elevation, habitat preference, and host plants, are summarised. Adult morphology of all species is described and figured, the catalogue of localities with maps of distribution is reported, and a biog...

  11. Taxonomic notes on the genus Bellenden Chandler (Coleoptera, Staphylinidae, Pselaphinae). (United States)

    Yin, Zi-Wei; Jiang, Ri-Xin


    The monotypic genus Buobellenden Yin & Nomura, 2009 is placed as a junior synonym of Bellenden Chandler, 2001. This act results in Bellenden jingyuanensis (Yin & Nomura), comb. n. (from Buobellenden ). A new species, Bellenden siguniang Yin & Jang, sp. n. , collected from the alpine area in Sichuan, SW China, is described, illustrated, and distinguished from all congeners. A new illustration of the aedeagus of Buobellenden jingyuanensis is given.


    Directory of Open Access Journals (Sweden)

    A. A. Kruglaya


    Full Text Available The majority of medicinal plants and medicinal plant raw materials are understudied pharmacgostically. These plants include species from Inula genus, which range in Russia amounts to up to 40 species. Rhizomes and roots of the Inula helenium L. are broadly applied in scientific and traditional medicine. They have expectorate, styptic, and anti-inflammatory properties.The purpose of the study was to determine the amino-acid composition of some species from Inula genus (Inula germanica, Inula ensifolia, Inula aspera, Inula orientalis, which grow in different regions if the North Caucasus.Methods. The studies were carried out using AAA 400 amino acid analyzer, highly specialized automatized liquid chromatographer with computer management. Aboveground parts of the plants, gathered in mass blossom phase from wild-growing plants and then dried out were the objects of the study.Results. For the first time the amino acid composition and raw protein of some species from Inula genus was determined (Inula germanica, Inula ensifolia, Inula aspera, Inula orientalis, 16 amino acids were discovered, 7 of which were essential, and raw proteins which substantival composition amounted to 16.19% in Inula germanica, 10.78% in Inula ensifolia, Inula aspera (11.15%, Inula orientalis (13.94%.Conclusion. The results of the studies conducted broaden the data about amino acids and protein composition and quantitative content in the species from Inula genus and can be used to develop methods of analysis of the drugs, obtained from these plants.

  13. Ecology of genus Porphyromonas in canine periodontal disease. (United States)

    Isogai, H; Kosako, Y; Benno, Y; Isogai, E


    Asaccharolytic pigmented Porphyromonas species, including P. endodontalis, P. gingivalis, P. circumdentaria and unclassified species, were isolated from the plaque of adult dogs, but not from any oral sites of puppies and adolescent dogs. With age-dependency, the proportion of Porphyromonas species in the flora of plaque increased. Isolation of the genus Porphyromonas was clearly associated with the progress of periodontol disease. We suggested that Porphyromonas is the exogenous organism and obligate pathogen for canine periodontal diseases.

  14. Phylogenetic placement and taxonomy of the genus Hederorkis (Orchidaceae.

    Directory of Open Access Journals (Sweden)

    Joanna Mytnik-Ejsmont

    Full Text Available Three plastid regions, matK, rpl32-trnL and rpl16 intron and the ITS1-5.8S-ITS2 nuclear ribosomal DNA were used to demonstrate a phylogenetic placement of the genus Hederorkis (Orchidaceae for the first time. The taxonomic position of this genus has been unclear thus far. The phylogenetic and morphological relations of Hederorkis to the most closely related genera Sirhookera, Adrorhizon, Bromheadia and Polystachya are also discussed. A hypothesis concerning an origin and evolution of Hederorkis is proposed. Hederorkis is an epiphytic two-leaved orchid genus with lateral inflorescence, non-resupinate flowers, elongate gynostemium and rudimentary column foot. It is native to the Indian Ocean Islands. Two species of Hederorkis are recognized worldwide, H. scandens endemic to Mauritius and Réunion and H. seychellensis endemic to Seychelles. For each of the species treated a full synonymy, detailed description and illustration are included. The distribution map and dichotomous keys to the species have also been provided.

  15. Moringa Genus: A Review of Phytochemistry and Pharmacology (United States)

    Abd Rani, Nur Zahirah; Husain, Khairana; Kumolosasi, Endang


    Moringa is a genus of medicinal plants that has been used traditionally to cure wounds and various diseases such as colds and diabetes. In addition, the genus is also consumed as a source of nutrients and widely used for purifying water. The genus consists of 13 species that have been widely cultivated throughout Asia and Africa for their multiple uses. The purpose of this review is to provide updated and categorized information on the traditional uses, phytochemistry, biological activities, and toxicological research of Moringa species in order to explore their therapeutic potential and evaluate future research opportunities. The literature reviewed for this paper was obtained from PubMed, ScienceDirect, and Google Scholar journal papers published from 1983 to March 2017. Moringa species are well-known for their antioxidant, anti-inflammatory, anticancer, and antihyperglycemic activities. Most of their biological activity is caused by their high content of flavonoids, glucosides, and glucosinolates. By documenting the traditional uses and biological activities of Moringa species, we hope to support new research on these plants, especially on those species whose biological properties have not been studied to date. PMID:29503616

  16. Evidence for ecological flexibility in the cosmopolitan genus Curtobacterium

    Directory of Open Access Journals (Sweden)

    Alexander Bennett Chase


    Full Text Available Assigning ecological roles to bacterial taxa remains imperative to understanding how microbial communities will respond to changing environmental conditions. Here we analyze the genus Curtobacterium as it was found to be the most abundant taxon in a leaf litter community in southern California. Traditional characterization of this taxon predominantly associates it as the causal pathogen in the agricultural crops of dry beans. Therefore, we seek to conduct a broad investigation into this genus to ask whether its high abundance in our soil system is in accordance with its role as a plant pathogen or if alternative ecological roles are needed. By collating >24,000 16S rRNA sequences with 120 genomes across the Microbacteriaceae family, we show that Curtobacterium has a global distribution with a predominant presence in soil ecosystems globally. Moreover, this genus harbors a high diversity of genomic potential for the degradation of carbohydrates, specifically with regards to structural polysaccharides. We conclude that Curtobacterium may be responsible for the degradation of organic matter within litter communities.

  17. Prion protein degradation by lichens of the genus Cladonia (United States)

    Bennett, James P.; Rodriguez, Cynthia M.; Johnson, Christopher J.


    It has recently been discovered that lichens contain a serine protease capable of degrading the pathogenic prion protein, the etiological agent of prion diseases such as sheep scrapie and cervid chronic wasting disease. Limited methods are available to degrade or inactivate prion disease agents, especially in the environment, and lichens or their serine protease could prove important for management of these diseases. Scant information is available regarding the presence or absence of the protease responsible for degrading prion protein (PrP) in lichen species and, in this study, we tested the hypothesis that PrP degradation activity in lichens is phylogenetically-based by testing 44 species of Cladonia lichens, a genus for which a significant portion of the phylogeny is well established. We categorized PrP degradation activity among the 44 species (high, moderate, low or none) and found that activity in Cladonia species did not correspond with phylogenetic position of the species. Degradation of PrP did correspond, however, with three classical taxonomic characters within the genus: species with brown apothecia, no usnic acid, and the presence of a cortex. Of the 44 species studied, 18 (41%) had either high or moderate PrP degradation activity, suggesting the protease may be frequent in this genus of lichens.


    Directory of Open Access Journals (Sweden)

    Ovidiu Popescul


    Full Text Available Scardinius is a genus of ray-finned fish in the Cyprinidae family commonly called rudds. The common rudd(Scardinius erithrophthalmus is a bentho-pelagic freshwater fish that occurs mainly in nutrient-rich, well vegetatedlowland rivers, backwaters, oxbows, ponds and lakes and it is widespread in Europe and middle Asia. It has a mediumlength of 20-30 cm, but it can reach 50 cm. The classification of cyprinids has always been controversial the morphologicaltraits have an unclear homology this led to the idea that the recognized monophyletic groups are surely misinterpreted. Thispaper aims to assess the current level of molecular data regarding Scardinius genera. Some of the molecular data obtainedfor Scardinius genus is from DNA barcoding studies on fresh water fishes, but studies regarding this genus and Cyprinidaefamily used mitochondrial genes like cytochrome b (cyt b and cytochrome oxidase (CO, but nuclear genes or nuclearmicrosatellites were also used. We found that molecular data exists for both nuclear and mitochondrial genes, but this genuswasn’t studied separately and as many of the researchers suggest more taxonomic studies are required in order to solve theuncertainties within it.

  19. The genus Eremophila (Scrophulariaceae): an ethnobotanical, biological and phytochemical review. (United States)

    Singab, Abdel Nasser; Youssef, Fadia S; Ashour, Mohamed L; Wink, Michael


    Eremophila (Scrophulariaceae) is an endemic Australian genus with 214 species, which is commonly known as Fuchsia bush, Emu bush or Poverty bush. Plants of this genus played an important role for the Australian Aborigines who used them widely for medicinal and ceremonial purposes. Many studies have been carried out on many species of this genus and have generated immense data about the chemical composition and corresponding biological activity of extracts and isolated secondary metabolites. Thorough phytochemical investigations of different Eremophila species have resulted in the isolation of more than 200 secondary metabolites of different classes with diterpenes as major constituents. Biological studies and traditional clinical practice demonstrated that Eremophila and its bioactive compounds possess various pharmacological properties. Plants were employed especially as a cardiotonic drug and also as potent anti-inflammatory, antimicrobial and antiviral agents. Further investigations are required to explore other Eremophila species, to evaluate the different biological activities of either their extracts or the isolated compounds and the possible underlying modes of action. © 2013 Royal Pharmaceutical Society.

  20. Ecological Distribution Of The Genus Crotalaria In Nigeria

    Directory of Open Access Journals (Sweden)



    Full Text Available Abstract Geographical distribution and morphological features of the genus Crotalaria were studied. Methods follow conventional practice as reported by previous studies. Thirty six species of the genus Crotalaria were shown to be distributed in Nigeria. The genera were allopathic in nature. The species such as C. bongensis C. atrorubens C. cleomifolia C. anthyllopsis C. cuspidata C. bamendul C. calycina C. hyssopifolia C. incana C. graminicola and C. macrocalyx were prominent in savannah zones while C. acervata C. cylindrical C. cephalotes C. comosa C. retusa C.doniana C. glauca C. falcata C. goreensis among others were common in cultivated areas in forest zone of Nigeria. Qualitative leaf morphological features of selected crotalaria species in Nigeria were also revealed. It shows that the leaf margin leaf surface and leaf base are similar in features except in leaf shape that vary from lanceolate C. comosa and C. bongensis oblanceolate C. retusa C. goreensis C. ononoidea and C. lachnosema to obovate C. mucronata and C. naragutensis. This implies that most of the genus Crotalaria displays similar characteristic and the features among them shows overlap.

  1. Criteria of assessing introduced varieties of the genus Heuchera L.

    Directory of Open Access Journals (Sweden)

    Н. А. Андрух


    Full Text Available Purpose. To identify and describe the basic criteria for studying and assessing decorative and economic-and-biological characters of the genus Heuchera L. varieties in the context of introduction. Methods. Introduction procedure, analytical approach, morphological analysis and biometric data evaluation. Results. Aided by the comparative morphological analysis of introduced varieties of the genus Heuchera, significant differences in their characters were revealed, including plant height, height and width of the basal rosette of leaves, generative shoot height. There was a significant variation of such parameters as the number of generative shoots within one plant, the number of flowers on a single generative shoot, flowering abundance. Based on investigation findings, 17 groups of varieties were identified for the dominant color of adaxial surface of the leaf blade and 7 groups – for inflorescence color. According to phenological observations, Heuchera varieties groups were determined and the dates of commencement and duration of plants flowering were registered in the context of introduction. The results of these investigations are the necessary basis for the study and evaluation of this culture assortment, they are important in breeding and landscaping. Conclusions. Based on the results of investigations of morphological features of introduced species of the genus Heuchera, traits and parameters for varieties grouping were defined as well as decorative and economic-and-biological traits that should be evaluated.

  2. Phylogenomics and the Dynamic Genome Evolution of the Genus Streptococcus (United States)

    Richards, Vincent P.; Palmer, Sara R.; Pavinski Bitar, Paulina D.; Qin, Xiang; Weinstock, George M.; Highlander, Sarah K.; Town, Christopher D.; Burne, Robert A.; Stanhope, Michael J.


    The genus Streptococcus comprises important pathogens that have a severe impact on human health and are responsible for substantial economic losses to agriculture. Here, we utilize 46 Streptococcus genome sequences (44 species), including eight species sequenced here, to provide the first genomic level insight into the evolutionary history and genetic basis underlying the functional diversity of all major groups of this genus. Gene gain/loss analysis revealed a dynamic pattern of genome evolution characterized by an initial period of gene gain followed by a period of loss, as the major groups within the genus diversified. This was followed by a period of genome expansion associated with the origins of the present extant species. The pattern is concordant with an emerging view that genomes evolve through a dynamic process of expansion and streamlining. A large proportion of the pan-genome has experienced lateral gene transfer (LGT) with causative factors, such as relatedness and shared environment, operating over different evolutionary scales. Multiple gene ontology terms were significantly enriched for each group, and mapping terms onto the phylogeny showed that those corresponding to genes born on branches leading to the major groups represented approximately one-fifth of those enriched. Furthermore, despite the extensive LGT, several biochemical characteristics have been retained since group formation, suggesting genomic cohesiveness through time, and that these characteristics may be fundamental to each group. For example, proteolysis: mitis group; urea metabolism: salivarius group; carbohydrate metabolism: pyogenic group; and transcription regulation: bovis group. PMID:24625962

  3. Germalna, a new genus for the New Caledonian cicada previously assigned to the genus Melampsalta Kolenati, plus a complement to the description of the genus Rouxalna Boulard, with the description of two new species (Insecta: Hemiptera, Cicadoidea, Cicadidae). (United States)

    Delorme, Quentin


    Species previously assigned to Melampsalta Kolenati, in New Caledonia are reviewed. Morphological studies indicate that New Caledonian cicadas currently placed in this genus have been wrongly assigned and should be placed in a new genus. The genus Germalna gen. nov., is therefore erected to accommodate Germalna germaini comb. nov. The genus Germalna gen. nov. was first documented by Michel Boulard, but remained a nomen nudum until now. A redescription of the genus Rouxalna Boulard is provided and the following new species are described: Rouxalna villosa sp. nov., and Rouxalna scabens sp. nov. Male calling songs of Rouxalna rouxi Boulard and Rouxalna scabens sp. nov. are analysed and described from field recordings. A key to the species of Rouxalna is also provided.

  4. Bildskapande i relation till genus i förskolans verksamhet : Att skapa sig själv och genus


    Brännlund, Angelika


    Studiens syfte är att bidra till ökad medvetenhet för verksamma inom förskolans område kring frågor som rör pedagogers förhållningssätt kring relationen mellan bildskapande och genus, men även hur dessa förhållningssätt kan påverka barnens möjligheter i deras bildskapande. En viktig fråga som burits med från starten av arbetet och som lyser igenom i resultatdelen har varit: Vilka möjligheter att förhålla sig till bildskapande och genus kan uppstå om ett kritiskt sätt att tänka kring könsstere...

  5. A revision of the genus Antepione Packard with description of the new genus Pionenta Ferris (Lepidoptera, Geometridae, Ennominae). (United States)

    Ferris, Clifford D


    Based on genitalic studies, the new genus Pionenta is established for two taxa formerly placed under Antepione. The taxa hewesata and ochreata (and previously associated synonyms) are now synonomized as Pionenta ochreata. Three species of Antepione are now recognized: Antepione thisoaria, Antepione imitata, Antepione tiselaaria with the taxa comstocki, constans, and indiscretata synonomized under Antepione imitata. No new species are described. Adults and genitalia are illustrated, including type specimens.

  6. Genus delineation of Chlamydiales by analysis of the percentage of conserved proteins justifies the reunifying of the genera Chlamydia and Chlamydophila into one single genus Chlamydia. (United States)

    Pannekoek, Yvonne; Qi-Long, Qin; Zhang, Yu-Zhong; van der Ende, Arie


    Many studies have aimed to set up boundaries for the classification and definition of prokaryotic genus and species classification; however, studies that focused on genus-level genomic differences for existing taxonomy systems are limited. Recently, a novel method was described for prokaryotic genus delineation using the percentage of conserved proteins (POCP) between two strains to estimate their evolutionary and phenotypic distance (Qin et al. A proposed genus boundary for the prokaryotes based on genomic insights. J Bacteriol 2014; 196: :2210-5). Here, we extended the POCP analysis of the order Chlamydiales and pairwise compared all currently recognized species and candidate species of the family Chlamydiaceae as well as some species from other families. Using the taxonomy advised by the International Committee on Systematics of Prokaryotes, subcommittee on the taxonomy of the Chlamydiae, POCP analysis revealed that all pairwise comparisons of species from different families resulted in values lower than 50%, the proposed threshold for genus boundary. In contrast, all interspecies pairwise comparisons of species from the single genus within the family Chlamydiaceae resulted in POCP values higher than 70%. We conclude that the recommended genus classification of the family Chlamydiaceae is rational and that POCP analyses can provide a robust genomic index for the taxonomy of members of the order Chlamydiales in terms of genus demarcation. © FEMS 2016. All rights reserved. For permissions, please e-mail:

  7. Giselia arizonica, a new genus and species of mite (Acaria: Tarsonemidae) associated with bark beetles of the genus Pseudopityophthorus (Coleoptera: Scolytidae) in North America (United States)

    Wojciech L. Magowski; Evert E. Lindquist; John C. Moser


    A new genus and species of the mite family Tarsonemidae, subfamily Tarsoneminae, is described and illustrated. Its systematic position among genera of Tarsoneminae and its host association with bark beetles of the genus Pseudopityophthorus Swaine, 1918 in North America are briefly discussed.

  8. The genus Alterosa Blahnik, 2005 (Trichoptera, Philopotamidae, Philopotaminae) in northeastern Brazil, including the description of three new species and an identification key for the genus (United States)

    Dumas, Leandro Lourenço; Calor, Adolfo Ricardo; Nessimian, Jorge Luiz


    Abstract Alterosa Blahnik, 2005 contains 35 described species distributed in southern and southeastern Brazil. Three new species of Alterosa from northeastern Brazil are described and illustrated, Alterosa amadoi sp. n., Alterosa castroalvesi sp. n. and Alterosa caymmii sp. n., the first records of the genus from northeastern Brazil. An identification key for all known species of the genus is also presented. PMID:23950667

  9. Two new species and a new phyllobothriid cestode genus from sharks of the genus Negaprion Whitley (Carcharhiniformes). (United States)

    Ruhnke, T R; Workman, R E


    Alexandercestus n. g. (Cestoda: Tetraphyllidea) is erected for two cestode species found parasitising the two known species of lemon sharks (Carcharhiniformes: Negaprion spp.). This new genus differs from all other phyllobothriid genera except for Hemipristicola Cutmore, Theiss, Bennett & Cribb, 2011, Marsupiobothrium Yamaguti, 1952, Nandocestus Reyda, 2008, Orectolobicestus Ruhnke, Caira & Carpenter 2006, Orygmatobothrium Diesing, 1863, Paraorygmatobothrium Ruhnke, 1994 and Phyllobothrium van Beneden, 1849 in possessing uniloculate bothridia with an apical sucker and neck scutes. Alexandercestus differs from Orectolobicestus and Nandocestus in lacking marginal loculi on the bothridia, from Paraorygmatobothrium in possessing uninterrupted vitelline follicles at the level of the ovary and from Phyllobothrium in being euapolytic as opposed to anapolytic and in lacking posteriorly bifid bothridia. The new genus lacks the central accessory bothridial organ seen in specimens of Orygmatobothrium, and lacks the central bothridial accessory sucker of specimens of Marsupiobothrium. Alexandercestus spp. compare most favourably with specimens of Hemipristicola, especially with respect to aspects of proglottid morphology, but differ in possessing aristate gladiate spinitriches rather than serrate gladiate spinitriches on the proximal bothridial surface. In addition, the bothridia of Alexandercestus spp. are comparatively more fleshy and foliose than those in specimens of Hemipristicola. Two new species of Alexandercestus n. g. are described, Alexandercestus gibsoni n. sp. from Negaprion acutidens, collected from off northern Australia and the Marshall Islands, and Alexandercestus manteri n. sp. from N. brevirostris, collected off the islands of Bimini and the Florida Keys. The two new species differ in total length and vitelline follicle distribution. Bayesian inference and parsimony analysis of the D1-D3 region of the large nuclear ribosomal DNA of 17 published and seven

  10. Transfer of 13 species of the genus Burkholderia to the genus Caballeronia and reclassification of Burkholderia jirisanensis as Paraburkholderia jirisanensis comb. nov. (United States)

    Dobritsa, Anatoly P; Linardopoulou, Elena V; Samadpour, Mansour


    A recent study of a group of Burkholderia glathei-like bacteria resulted in the description of 13 novel species of the genus Burkholderia. However, our analysis of phylogenetic positions of these species and their molecular signatures (conserved protein sequence indels) showed that they belong to the genus Caballeronia, and we propose to transfer them to this genus. The reclassified species names are proposed as Caballeroniaarationis comb. nov., Caballeroniaarvi comb. nov., Caballeroniacalidae comb. nov., Caballeroniacatudaia comb. nov., Caballeroniaconcitans comb. nov., Caballeroniafortuita comb. nov., Caballeroniaglebae comb. nov., Caballeroniahypogeia comb. nov., Caballeroniapedi comb. nov., Caballeroniaperedens comb. nov., Caballeroniaptereochthonis comb. nov., Caballeroniatemeraria comb. nov. and Caballeronia turbans comb. nov. It is also proposed to reclassify Burkholderia jirisanensis as Paraburkholderiajirisanensis comb. nov. Based on the results of the polyphasic study, B. jirisanensis had been described as a member of the A-group of the genus Burkholderiaand the most closely related to Burkholderia rhizosphaerae, Burkholderia humisilvae and Burkholderia solisilvae currently classified as belonging to the genus Paraburkholderia.

  11. A proposed genus boundary for the prokaryotes based on genomic insights. (United States)

    Qin, Qi-Long; Xie, Bin-Bin; Zhang, Xi-Ying; Chen, Xiu-Lan; Zhou, Bai-Cheng; Zhou, Jizhong; Oren, Aharon; Zhang, Yu-Zhong


    Genomic information has already been applied to prokaryotic species definition and classification. However, the contribution of the genome sequence to prokaryotic genus delimitation has been less studied. To gain insights into genus definition for the prokaryotes, we attempted to reveal the genus-level genomic differences in the current prokaryotic classification system and to delineate the boundary of a genus on the basis of genomic information. The average nucleotide sequence identity between two genomes can be used for prokaryotic species delineation, but it is not suitable for genus demarcation. We used the percentage of conserved proteins (POCP) between two strains to estimate their evolutionary and phenotypic distance. A comprehensive genomic survey indicated that the POCP can serve as a robust genomic index for establishing the genus boundary for prokaryotic groups. Basically, two species belonging to the same genus would share at least half of their proteins. In a specific lineage, the genus and family/order ranks showed slight or no overlap in terms of POCP values. A prokaryotic genus can be defined as a group of species with all pairwise POCP values higher than 50%. Integration of whole-genome data into the current taxonomy system can provide comprehensive information for prokaryotic genus definition and delimitation. Copyright © 2014, American Society for Microbiology. All Rights Reserved.

  12. Phytochemistry and pharmacology of the genus Drypetes: A review. (United States)

    Wansi, Jean Duplex; Wandji, Jean; Sewald, Norbert; Nahar, Lutfun; Martin, Claire; Sarker, Satyajit Dey


    Traditional medicinal use of species of the genus Drypetes is widespread in the tropical regions. The aim of this review is to systematically appraise the literature available to date on phytochemistry, ethnopharmacology, toxicology and bioactivity (in vitro and in vivo) of crude extracts and purified compounds. Plants of the genus Drypetes (Putranjivaceae) are used in the Subsaharan African and Asian traditional medicines to treat a multitude of disorders, like dysentery, gonorrhoea, malaria, rheumatism, sinusitis, tumours, as well as for the treatment of wounds, headache, urethral problems, fever in young children, typhoid and several other ailments. Some Drypetes species are used to protect food against pests, as an aphrodisiac, a stimulant/depressant, a rodenticide and a fish poison, against insect bites, to induce conception and for general healing. This review deals with updated information on the ethnobotany, phytochemistry, and biological activities of ethnomedicinally important Drypetes species, in order to provide an input for the future research opportunities. An extensive review of the literature available in various recognized databases e.g., Google Scholar, PubMed, Science Direct, SciFinder, Web of Science, and, as well as the Herbier National du Cameroun (Yaoundé) and Botanic Gardens of Limbe databases on the uses and bioactivity of various species of the Drypetes was undertaken. The literature provided information on ethnopharmacological uses of the Subsaharan African and Asian species of the genus Drypetes, e.g., Drypetes aubrévillii, D. capillipes, D. chevalieri, D. gerrardii, D. gossweileri, D. ivorensis, D. klainei, D. natalensis, D. pellegrini (all endemic to Africa) and D. roxburghii (Asian species), for the treatment of multiple disorders. From a total of 19 species, more than 140 compounds including diterpenes, sesquiterpenes, triterpenes (friedelane, oleanane, lupane and hopane-type), flavonoids, lignans

  13. Lateral Gene Transfer Dynamics in the Ancient Bacterial Genus Streptomyces. (United States)

    McDonald, Bradon R; Currie, Cameron R


    Lateral gene transfer (LGT) profoundly shapes the evolution of bacterial lineages. LGT across disparate phylogenetic groups and genome content diversity between related organisms suggest a model of bacterial evolution that views LGT as rampant and promiscuous. It has even driven the argument that species concepts and tree-based phylogenetics cannot be applied to bacteria. Here, we show that acquisition and retention of genes through LGT are surprisingly rare in the ubiquitous and biomedically important bacterial genus Streptomyces Using a molecular clock, we estimate that the Streptomyces bacteria are ~380 million years old, indicating that this bacterial genus is as ancient as land vertebrates. Calibrating LGT rate to this geologic time span, we find that on average only 10 genes per million years were acquired and subsequently maintained. Over that same time span, Streptomyces accumulated thousands of point mutations. By explicitly incorporating evolutionary timescale into our analyses, we provide a dramatically different view on the dynamics of LGT and its impact on bacterial evolution. IMPORTANCE Tree-based phylogenetics and the use of species as units of diversity lie at the foundation of modern biology. In bacteria, these pillars of evolutionary theory have been called into question due to the observation of thousands of lateral gene transfer (LGT) events within and between lineages. Here, we show that acquisition and retention of genes through LGT are exceedingly rare in the bacterial genus Streptomyces , with merely one gene acquired in Streptomyces lineages every 100,000 years. These findings stand in contrast to the current assumption of rampant genetic exchange, which has become the dominant hypothesis used to explain bacterial diversity. Our results support a more nuanced understanding of genetic exchange, with LGT impacting evolution over short timescales but playing a significant role over long timescales. Deeper understanding of LGT provides new

  14. Evolutionary Roots and Diversification of the Genus Aeromonas. (United States)

    Sanglas, Ariadna; Albarral, Vicenta; Farfán, Maribel; Lorén, J G; Fusté, M C


    Despite the importance of diversification rates in the study of prokaryote evolution, they have not been quantitatively assessed for the majority of microorganism taxa. The investigation of evolutionary patterns in prokaryotes constitutes a challenge due to a very scarce fossil record, limited morphological differentiation and frequently complex taxonomic relationships, which make even species recognition difficult. Although the speciation models and speciation rates in eukaryotes have traditionally been established by analyzing the fossil record data, this is frequently incomplete, and not always available. More recently, several methods based on molecular sequence data have been developed to estimate speciation and extinction rates from phylogenies reconstructed from contemporary taxa. In this work, we determined the divergence time and temporal diversification of the genus Aeromonas by applying these methods widely used with eukaryotic taxa. Our analysis involved 150 Aeromonas strains using the concatenated sequences of two housekeeping genes (approximately 2,000 bp). Dating and diversification model analyses were performed using two different approaches: obtaining the consensus sequence from the concatenated sequences corresponding to all the strains belonging to the same species, or generating the species tree from multiple alignments of each gene. We used BEAST to perform a Bayesian analysis to estimate both the phylogeny and the divergence times. A global molecular clock cannot be assumed for any gene. From the chronograms obtained, we carried out a diversification analysis using several approaches. The results suggest that the genus Aeromonas began to diverge approximately 250 millions of years (Ma) ago. All methods used to determine Aeromonas diversification gave similar results, suggesting that the speciation process in this bacterial genus followed a rate-constant (Yule) diversification model, although there is a small probability that a slight

  15. Genus 4 trigonal reduction of the Benney equations

    International Nuclear Information System (INIS)

    Baldwin, Sadie; Gibbons, John


    It was shown by Gibbons and Tsarev (1996 Phys. Lett. A 211 19, 1999 Phys. Lett. A 258 263) that N-parameter reductions of the Benney equations correspond to particular N-parameter families of conformal maps. In recent papers (Baldwin and Gibbons 2003 J. Phys. A: Math. Gen. 36 8393-417, Baldwin and Gibbons 2004 J. Phys. A: Math. Gen. 37 5341-54), the present authors have constructed examples of such reductions where the mappings take the upper half p-plane to a polygonal slit domain in the λ-plane. In those cases, the mapping function was expressed in terms of the derivatives of Kleinian σ functions of hyperelliptic curves, restricted to the one-dimensional stratum Θ 1 of the Θ-divisor. This was done using an extension of the method given in Enolskii et al (2003 J. Nonlinear Sci. 13 157) extended to a genus 3 curve (Enolski V Z and Gibbons J Addition theorems on the strata of the theta divisor of genus three hyperelliptic curves, in preparation). Here, we use similar ideas, but now applied to a trigonal curve of genus 4. Fundamental to this approach is a family of differential relations which σ satisfies on the divisor. Again, it is shown that the mapping function is expressible in terms of quotients of derivatives of σ on the divisor Θ 1 . One significant by-product is an expansion of the leading terms of the Taylor series of σ for the given family of (3, 5) curves; to the best of the authors' knowledge, this is new

  16. The Genus Phyllanthus: An Ethnopharmacological, Phytochemical, and Pharmacological Review

    Directory of Open Access Journals (Sweden)

    Xin Mao


    Full Text Available The plants of the genus Phyllanthus (Euphorbiaceae have been used as traditional medicinal materials for a long time in China, India, Brazil, and the Southeast Asian countries. They can be used for the treatment of digestive disease, jaundice, and renal calculus. This review discusses the ethnopharmacological, phytochemical, and pharmacological studies of Phyllanthus over the past few decades. More than 510 compounds have been isolated, the majority of which are lignins, triterpenoids, flavonoids, and tannins. The researches of their remarkable antiviral, antioxidant, antidiabetic, and anticancer activities have become hot topics. More pharmacological screenings and phytochemical investigations are required to support the traditional uses and develop leading compounds.

  17. The genus Stactobia McLachlan (Trichoptera, Hydroptilidae) in Japan. (United States)

    Ito, Tomiko


    The caddisfly genus Stactobia McLachlan (Hydroptilidae) is revised for Japan. Males are redescribed for 6 known species, Stactobia japonica Iwata, S. makartschenkoi Botosaneanu & Levanidova, S. inexpectata Botosaneanu & Nozaki, S. hattorii Botosaneanu & Nozaki, S. nishimotoi Botosaneanu & Nozaki, and S. distinguenda Botosaneanu & Nozaki. Six new species are described, also based on males: S. kanagawa, S. gunma, S. chichibu, S. yona, S. urauchi, and S. campire. A Taiwanese species, S. semele Malicky & Chantaramongkol, is recorded from Japan for the first time. Final instar larvae and their cases of 8 species and early instar larvae of 2 species are also described.

  18. Review of genus Pseudorthocladius Goetghebuer, 1943 (Diptera, Chironomidae from China

    Directory of Open Access Journals (Sweden)

    Jing Ren


    Full Text Available The genus Pseudorthocladius Goetghebuer, 1943 from China, including 12 species, is reviewed. Five new species, P. (P. binarius sp. n., P. (P. cylindratus sp. n., P. (P. digitus sp. n., P. (P. ovatus sp. n. and P. (P. paucus sp. n. are described and illustrated as adult males. P. (P. cristagus Stur & Sæther, 2004, P. (P. jintutridecima (Sasa, 1996, P. (P. macrovirgatus Sæther & Sublette, 1983, P. (P. morsei Sæther & Sublette, 1983, P. (P. uniserratus Sæther & Sublette, 1983, P. (L. wingoi Sæther & Sublette, 1983 are newly recorded in Oriental Region. A key to the males of Pseudorthocladius in China is presented.

  19. The genus Alphocoris in the Indomalaya (Hemiptera: Heteroptera: Scutelleridae). (United States)

    RÉdei, DÁvid; Tsai, Jing-Fu; Jindra, ZdenĚk


    The Indomalayan species of the genus Alphocoris Germar, 1839 (Hemiptera: Heteroptera: Scutelleridae: Odontotarsinae: Odontotarsini) are revised. Three species, A. caudatus Rédei, Tsai Jindra, sp. nov. (India: Maharashtra), A. naso Rédei Tsai, sp. nov. (India: Goa), and A. asper Rédei, Tsai Jindra, sp. nov. (India: Goa and Maharashtra), are recognized. The type material of A. lixoides Germar, 1839 (type locality: Senegal) is documented; previous records of this species from India and Pakistan are considered as based on misidentifications, the species is restricted to the Afrotropical Region.

  20. A Revision of the genus Ceratogyrus Pocock (Araneae: Theraphosidae

    Directory of Open Access Journals (Sweden)

    J.I. De Wet


    Full Text Available The African genus Ceratogyrus of the family Theraphosidae is revised, with notes of its natural history. Seven species are recognised and distinguished in a key. Six species, namely C. bechuanicus Pocock, C. brachycephalus Hewitt, C. darlingii Pocock, C. dolichocephalus Hewitt, C. marshalli Pocock and C. sanderi Strand are redescribed and figured, C. cornuatus is newly described and figured and C. schultzei Pocock is synonymized with C. bechuanicus. Lectotypes are designated for four species namely, C. brachycephalus, C. darlingii, C. dolichocephalus and C. marshalli. Distributional data is given for all seven species.

  1. Novelties in the genus Persicaria (Polygonaceae) in Brazil

    DEFF Research Database (Denmark)

    Funez, Luís A.; Hassemer, Gustavo


    This work presents novelties in the genus Persicaria in Brazil. More specifically, we describe P. sylvestris, a new species from the Atlantic rainforest in subtropical Brazil, propose the new combination P. diospyrifolium and designate a lectotype for its basionym, Polygonum diospyrifolium. The new...... species has until now been identified as P. acuminata, from which it differs by morphological characters as well as ecological aspects. We also provide photographs of the new species and of similar species along with a distribution map and a key to the species of Persicaria in Brazil....

  2. Review of the Indo-Pacific labrid fish genus Hemigymnus


    Randall, John E.


    The labrid fish genus Hemigymnus Günther consists of three relatively large coral-reef species: the wide-ranging Indo-Pacific H. fasciatus (Bloch) and H. melapterus (Bloch), and H. sexfasciatus (Rüppell) of the Red Sea and Gulf of Aden, usually regarded as a synonym of H. fasciatus. It is treated here as a species, distinguished by color pattern, longer pelvic fins of the terminal male, and fewer gill rakers. These three fishes are generally found as solitary individuals over sand or sand-and...

  3. Elliptic genus derivation of 4d holomorphic blocks (United States)

    Poggi, Matteo


    We study elliptic vortices on ℂ × T 2 by considering the 2d quiver gauge theory describing their moduli spaces. The elliptic genus of these moduli spaces is the elliptic version of vortex partition function of the 4d theory. We focus on two examples: the first is a N = 1, U( N ) gauge theory with fundamental and anti-fundamental matter; the second is a N = 2, U( N ) gauge theory with matter in the fundamental representation. The results are instances of 4d "holomorphic blocks" into which partition functions on more complicated surfaces factorize. They can also be interpreted as free-field representations of elliptic Virasoro algebrae.

  4. Chemistry of the Calceolaria Genus. Structural and Biological Aspects

    Directory of Open Access Journals (Sweden)

    Juan A. Garbarino


    Full Text Available Autochthonous species of the Calceolaria (Scrophulariaceae genus are studied. From their apolar extracts 55 new diterpenes of six skeleton types, naphtoquinones and flavonoids have been isolated. Among the different diterpenes malonic substitutions and bis-diterpenes in which both units are joined by a malonic acid unit stand out. Pimaranes present C-9 epimerisation and, consequently, H-9 has the same orientation as Me-20. From C.sessilis naphthoquinones with antichagasic activity have been isolated; and the biotransformation of 2α,19-dihydroxy-9-epi-entpimara-7,15-diene with Giberella fujikuroi produced 7 new diterpenes.

  5. The state of proteome profiling in the fungal genus Aspergillus. (United States)

    Kim, Yonghyun; Nandakumar, M P; Marten, Mark R


    Aspergilli are an important genus of filamentous fungi that contribute to a multibillion dollar industry. Since many fungal genome sequencing were recently completed, it would be advantageous to profile their proteome to better understand the fungal cell factory. Here, we review proteomic data generated for the Aspergilli in recent years. Thus far, a combined total of 28 cell surface, 102 secreted and 139 intracellular proteins have been identified based on 10 different studies on Aspergillus proteomics. A summary proteome map highlighting identified proteins in major metabolic pathway is presented.

  6. Taxonomic revision of Asian genus Glyptopetalum Thwaites (Celastraceae R. Br.

    Directory of Open Access Journals (Sweden)

    Ivan A. Savinov


    Full Text Available Taxonomic survey of Asian genus Glyptopetalum Thwaites (Celastraceae R. Br. is presented. Thirty five species taxa of Glyptopetalum are accepted, including one new species, G.  vidalii I. Savinov (Laos, Thailand, a new record for China, G. tonkinense Pitard (SE Yunnan and a new record for Cambodia,               G. quadrangulare Prain ex King, a new record for Indonesia – G. euonymoides Merr. and a new record for Philippines, Mindanao island – G. loheri Merr. 

  7. A MONOGRAPH OF THE GENUS NEESIA * Blume (Bombacaceae

    Directory of Open Access Journals (Sweden)



    Full Text Available 1     Eight species are described:  N. altissima, synandra, glabra, koster-mansiana, malayana, parpurascens, piluliflora and strigosa.2     N. kostermansiana is a species new to science.3     N. glabra and synandra, formerly included in N. altissima are reinstated  as distinct species.4     The area of distribution of the genus covers Lower Siam, the Malay Peninsula, Sumatra, Java and Borneo, with Borneo as centre.

  8. Genus zero Gromov-Witten axioms via Kuranishi atlases


    Castellano, Robert


    A Kuranishi atlas is a structure used to build a virtual fundamental class on moduli spaces of $J$-holomorphic curves. They were introduced by McDuff and Wehrheim to resolve some of the challenges in this field. This paper completes the construction of genus zero Gromov-Witten invariants using Kuranishi atlases and proves the Gromov-Witten axioms of Kontsevich and Manin. To do so, we introduce the notion of a transverse subatlas, a useful tool for working with Kuranishi atlases.

  9. Phylogenetic relationship among East Asian species of the Stegana genus group (Diptera, Drosophilidae). (United States)

    Li, Tong; Gao, Jian-jun; Lu, Jin-ming; Ji, Xing-lai; Chen, Hong-wei


    The phylogenetic relationship among 27 East Asian species of the Stegana genus group was reconstructed using DNA sequences of mitochondrial (COI and ND2) and nuclear (28S) genes. The results lent support to the current generic/subgeneric taxonomic classification in the genus group with the exceptions of the paraphyly of the genus Parastegana and the subgenus Oxyphortica in the genus Stegana. The ancestral areas and divergence times in the genus group were reconstructed/estimated, and accordingly, the biogeographical history of this important clade was discussed. It was proposed that, the evolution of the plant family Fagaceae, especially Quercus, may have played a certain role in facilitating the diversification of the Stegana genus group. Copyright © 2012 Elsevier Inc. All rights reserved.

  10. Chemical composition and cardiovascular effects induced by the essential oil of Cymbopogon citratus DC. Stapf, Poaceae, in rats Composição química e efeitos cardiovasculares do óleo essencial de Cymbopogon citratus DC. Stapf, Poaceae, em ratos

    Directory of Open Access Journals (Sweden)

    Flávia V. Moreira


    Full Text Available Cymbopogon citratus DC. Stapf, Poaceae, is used in the folk medicine for hypertension treatment. This work investigated the chemical composition and cardiovascular effects in rats of C. citratus essential oil (EOCC. A phytochemical screening demonstrated the presence of eight constituents, being geranial the major compound (43.08%. In rats, EOCC (1, 5, 10, and 20 mg/kg, i.v. induced transient hypotension and bradycardia that were attenuated by atropine and sodium thiopental, but not by L-NAME or indomethacin. In rings of rat superior mesenteric artery pre-contracted with phenylephrine, EOCC (1 to 3000 µg/mL induced relaxation that was not affected after removal of the endothelium, after TEA or in rings pre-contracted with KCl (80 mM. Furthermore, EOCC (1000 µg/mL was not able to induce additional effect on maximal relaxation of nifedipine (10 µM. In conclusions, EOCC induces hypotension, possibly by reduction in vascular resistance caused by inhibition of the Ca2+ influx, and bradycardia probably due to an activation of cardiac muscarinic receptors.C. citratus é utilizada na medicina popular para tratar hipertensão. Este trabalho investigou a composição química e os efeitos cardiovasculares do óleo essencial do C. citratus (OECC. Foram identificados oito constituintes no OECC, sendo geranial o majoritário (43,08%. Em ratos, o OECC (1, 5, 10 e 20 mg/kg, i.v. induziu hipotensão e bradicardia que foram atenuadas pela atropina e tiopental sódico, mas não por L-NAME ou indometacina. Em anéis de artéria mesentérica de ratos pré-contraídos com fenilefrina, o OECC (1 a 3000 µg/mL induziu relaxamento que não foi afetado após remoção do endotélio, após TEA ou em anéis pré-contraídos com KCl (80 mM. Além disso, o OECC (1000 µg/mL não induziu efeito adicional sobre o relaxamento máximo da nifedipina (10 µM. Em conclusão, o OECC induz hipotensão possivelmente devido à redução da resistência vascular que pode ser causada

  11. Progenitor-derivative relationships of Hordeum polyploids (Poaceae, Triticeae inferred from sequences of TOPO6, a nuclear low-copy gene region.

    Directory of Open Access Journals (Sweden)

    Jonathan Brassac

    Full Text Available Polyploidization is a major mechanism of speciation in plants. Within the barley genus Hordeum, approximately half of the taxa are polyploids. While for diploid species a good hypothesis of phylogenetic relationships exists, there is little information available for the polyploids (4×, 6× of Hordeum. Relationships among all 33 diploid and polyploid Hordeum species were analyzed with the low-copy nuclear marker region TOPO6 for 341 Hordeum individuals and eight outgroup species. PCR products were either directly sequenced or cloned and on average 12 clones per individual were included in phylogenetic analyses. In most diploid Hordeum species TOPO6 is probably a single-copy locus. Most sequences found in polyploid individuals phylogenetically cluster together with sequences derived from diploid species and thus allow the identification of parental taxa of polyploids. Four groups of sequences occurring only in polyploid taxa are interpreted as footprints of extinct diploid taxa, which contributed to allopolyploid evolution. Our analysis identifies three key species involved in the evolution of the American polyploids of the genus. (i All but one of the American tetraploids have a TOPO6 copy originating from the Central Asian diploid H. roshevitzii, the second copy clustering with different American diploid species. (ii All hexaploid species from the New World have a copy of an extinct close relative of H. californicum and (iii possess the TOPO6 sequence pattern of tetraploid H. jubatum, each with an additional copy derived from different American diploids. Tetraploid H. bulbosum is an autopolyploid, while the assumed autopolyploid H. brevisubulatum (4×, 6× was identified as allopolyploid throughout most of its distribution area. The use of a proof-reading DNA polymerase in PCR reduced the proportion of chimerical sequences in polyploids in comparison to Taq polymerase.

  12. The section Atlanticae of the genus Luzula (Juncaceae

    Directory of Open Access Journals (Sweden)

    Boratyński, A.


    Full Text Available The section Atlanticae of the genus Luzula (Juncaceae.- Luzula atlantica Braun-Blanq. and Luzula tibestica (Quézel Zarhan ex Romo & Boratyński are the only representatives of the section Atlanticae Kirschner of the genus Luzula. Luzula atlantica is an endemic plant from the High Atlas Mountains and Luzula tibestica is endemic to the Tibesti massif. Both taxa are studied from a nomenclatural, morphological, chorological and biogeographical point of view. These taxa, owing to their low dispersion capacity, have probably diversified in situ.La sección Atlanticae del género Luzula (Juncaceae.- Luzula atlantica Braun-Blanq. y Luzula tibestica (Quézel Zarhan ex Romo & Boratynski son los únicos representantes de la sección Atlanticae Kirschner del género Luzula. Luzula atlantica es un endemismo del Alto Atlas y Luzula tibestica es una planta endémica del macizo de Tibesti. Ambos taxones son estudiados desde el punto de vista morfológico, nomenclatural, corológico y biogeográfico. Estos taxones, por su baja tasa de dispersión, se han diversificado probablemente in situ.

  13. Lessons on black holes from the elliptic genus

    Energy Technology Data Exchange (ETDEWEB)

    Giveon, Amit [Racah Institute of Physics, The Hebrew University,Jerusalem, 91904 (Israel); Itzhaki, Nissan [Physics Department, Tel-Aviv University,Ramat-Aviv, 69978 (Israel); Troost, Jan [Laboratoire de Physique Théorique, Unité Mixte du CNRS et de l’École Normale Supérieure associée à l’Université Pierre et Marie Curie 6, École Normale Supérieure, Rue Lhomond Paris (France)


    We further study the elliptic genus of the cigar SL(2,ℝ){sub k}/U(1) coset superconformal field theory. We find that, even in the small curvature, infinite level limit, there are holomorphic and non-holomorphic parts that are due to the discrete states and a mismatch in the spectral densities of the continuum, respectively. The mismatch in the continuum is universal, in the sense that it is fully determined by the asymptotic cylindrical topology of the cigar’s throat. Since modularity of the elliptic genus requires both the holomorphic and non-holomorphic parts, the holomorphic term is universal as well. The contribution of the discrete states is thus present even for perturbative strings propagating in the background of large Schwarzschild black holes. We argue that the discrete states live at a stringy distance from the tip of the cigar both from the conformal field theory wave-function analysis and from a holonomy space perspective. Thus, the way string theory takes care of its self-consistency seems to have important consequences for the physics near horizons, even for parametrically large black holes.

  14. Translational selection on codon usage in the genus Aspergillus. (United States)

    Iriarte, Andrés; Sanguinetti, Manuel; Fernández-Calero, Tamara; Naya, Hugo; Ramón, Ana; Musto, Héctor


    Aspergillus is a genus of mold fungi that includes more than 200 described species. Many members of the group are relevant pathogens and other species are economically important. Only one species has been analyzed for codon usage, and this was performed with a small number of genes. In this paper, we report the codon usage patterns of eight completely sequenced genomes which belong to this genus. The results suggest that selection for translational efficiency and accuracy are the major factors shaping codon usage in all of the species studied so far, and therefore they were active in the last common ancestor of the group. Composition and molecular distances analyses show that highly expressed genes evolve slower at synonymous sites. We identified a conserved core of translationally optimal codons and study the tRNA gene pool in each genome. We found that the great majority of preferred triplets match the respective cognate tRNA with more copies in the respective genome. We discuss the possible scenarios that can explain the observed differences among the species analyzed. Finally we highlight the biotechnological application of this research regarding heterologous protein expression. Copyright © 2012 Elsevier B.V. All rights reserved.

  15. Phytochemicals and biological studies of plants from the genus Balanophora

    Directory of Open Access Journals (Sweden)

    Wang Xiaohong


    Full Text Available Abstract This review focus on the phytochemical progress and biological studies of plants from the genus Balanophora (Balanophoraceae over the past few decades, in which most plants growth in tropical and subtropical regions of Asia and Oceania, and nearly 20 species ranged in southwest China. These dioeciously parasitic plants are normally growing on the roots of the evergreen broadleaf trees, especially in the family of Leguminosae, Ericaceae, Urticaceae, and Fagaceae. The plants are mainly used for clearing away heat and toxic, neutralizing the effect of alcoholic drinks, and as a tonic for the treatment of hemorrhoids, stomachache and hemoptysis. And it has been used widely throughtout local area by Chinese people. Cinnamic acid derivative tannins, possessing a phenylacrylic acid derivative (e. g. caffeoyl, coumaroyl, feruloyl or cinnamoyl, which connected to the C(1 position of a glucosyl unit by O-glycosidic bond, are the characteristic components in genus Balanophora. In addition, several galloyl, caffeoyl and hexahydroxydiphenoyl esters of dihydrochalcone glucosides are found in B. tobiracola, B. harlandii, and B. papuana. Other compounds like phenylpropanoids, flavonoids, terpenoids and sterols are also existed. And their biological activities, such as radical scavenging activities, HIV inhibiting effects, and hypoglycemic effects are highlighted in the review.

  16. Lateral Gene Transfer Dynamics in the Ancient Bacterial Genus Streptomyces

    Directory of Open Access Journals (Sweden)

    Bradon R. McDonald


    Full Text Available Lateral gene transfer (LGT profoundly shapes the evolution of bacterial lineages. LGT across disparate phylogenetic groups and genome content diversity between related organisms suggest a model of bacterial evolution that views LGT as rampant and promiscuous. It has even driven the argument that species concepts and tree-based phylogenetics cannot be applied to bacteria. Here, we show that acquisition and retention of genes through LGT are surprisingly rare in the ubiquitous and biomedically important bacterial genus Streptomyces. Using a molecular clock, we estimate that the Streptomyces bacteria are ~380 million years old, indicating that this bacterial genus is as ancient as land vertebrates. Calibrating LGT rate to this geologic time span, we find that on average only 10 genes per million years were acquired and subsequently maintained. Over that same time span, Streptomyces accumulated thousands of point mutations. By explicitly incorporating evolutionary timescale into our analyses, we provide a dramatically different view on the dynamics of LGT and its impact on bacterial evolution.

  17. Essential oil biosynthesis and regulation in the genus Cymbopogon. (United States)

    Ganjewala, Deepak; Luthra, Rajesh


    Essential oils distilled from Cymbopogon species are of immense commercial value as flavors and fragrances in the perfumery, cosmetics, soaps, and detergents and in pharmaceutical industries. Two major constituents of the essential oil, geraniol and citral, due to their specific rose and lemon like aromas are widely used as flavors, fragrances and cosmetics. Citral is also used for the synthesis of vitamin A and ionones (for example, beta-ionone, methyl ionone). Moreover, Cymbopogon essential oils and constituents possess many useful biological activities including cytotoxic, anti-inflammatory and antioxidant. Despite the immense commercial and biological significance of the Cymbopogon essential oils, little is known about their biosynthesis and regulatory mechanisms. So far it is known that essential oils are biosynthesized via the classical acetate-MVA route and existence of a newly discovered MEP pathway in Cymbopogon remains as a topic for investigation. The aim of the present review is to discuss the biosynthesis and regulation of essential oils in the genus Cymbopogon with given emphasis to two elite members, lemongrass (C. flexuosus Nees ex Steud) and palmarosa (C. martinii Roxb.). This article highlights the work done so far towards understanding of essential oil biosynthesis and regulation in the genus Cymbopogon. Also, based on our experiences with Cymbopogon species, we would like to propose C. flexuosus as a model system for the study of essential oil metabolism beyond the much studied plant family Lamiaceae.

  18. The genus Attalea (Arecaceae of Bolivia: regional ecologic system affinities

    Directory of Open Access Journals (Sweden)

    Mónica Moraes R.


    Full Text Available The documentation of the Neotropical species of the Arecaceae family, based on the recent contributions to its taxonomy and its relationship with natural landscapes, updates the spatial patterns to which they adapt in their range of distribution. In this case 121 records of specimens of the 11 species of the genus Attalea of Bolivia and their relationship with 30 ecological systems that approximate their scope of distribution at regional level are released. To this end, the geographical coordinates were systematized, verified and corrected. Localities of all the specimens collected from the genus Attalea in order to compare them with ecological systems, using the ArgGis tools. We then elaborate a dendrogram (species vs. ecological systems using the minimum distance method in the R program. The analysis of the relation of the species with the ecological systems highlights a species that does not compose to the southwest amazon: A. eichleri and that is native to ecological systems of the Cerrado. Among the SW Amazonian Attalea species, A. blepharopus (endemic to Bolivia is isolated from the others and the rest subgroup species according to their presence in forests and savannas, in addition to the subandean and alluvial, as it is for A. princeps, which is found in 17 systems (57%. Eight species of Attalea are common with Peru and 10 with Brazil. It is important to relate the hierarchical grouping of the Attalea species with ecological systems in function of landscape dynamics to document their space patterns and also for their conservation.

  19. Medicinal chemistry and pharmacology of genus Tripterygium (Celastraceae). (United States)

    Brinker, Anita M; Ma, Jun; Lipsky, Peter E; Raskin, Ilya


    Plants in the genus Tripterygium, such as Tripterygium wilfordii Hook.f., have a long history of use in traditional Chinese medicine. In recent years there has been considerable interest in the use of Tripterygium extracts and of the main bioactive constituent, the diterpene triepoxide triptolide (1), to treat a variety of autoimmune and inflammation-related conditions. The main mode of action of the Tripterygium extracts and triptolide (1) is the inhibition of expression of proinflammatory genes such as those for interleukin-2 (IL-2), inducible nitric oxide synthase (iNOS), tumor necrosis factor-alpha (TNF-alpha), cyclooxygenase-2 (COX-2) and interferon-gamma (IFN-gamma). The efficacy and safety of certain types of Tripterygium extracts were confirmed in human clinical trials in the US and abroad. Over 300 compounds have been identified in the genus Tripterygium, and many of these have been evaluated for biological activity. The overall activity of the extract is based on the interaction between its components. Therefore, the safety and efficacy of the extract cannot be fully mimicked by any individual constituent. This review discusses the biochemical composition and biological and pharmacological activities of Tripterygium extracts, and their main bioactive components.

  20. The genus Ehretia (Boraginaceae: Ehretioideae in southern Africa

    Directory of Open Access Journals (Sweden)

    E. Retief


    Full Text Available The genus Ehretia P.Browne in southern Africa is revised. Six species and five subspecies of Ehretia are currently rec­ognized in southern Africa, of which E. alba Retief & A.E.van Wyk, E. namibiensis Retief & A.E.van Wyk subsp. namibi­ensis,  E. namibiensis subsp.  kaokoensis Retief & A.E.van Wyk,  E. rigida subsp.  silvatica  Retief & A.E.van Wyk and E. rigida subsp. nervifolia Retief & A.E.van Wyk are newly described. The genus is widely distributed in the region and occurs in a variety of habitats, ranging from the forests of the Eastern Cape to the hot, arid, semidesert parts of Namibia. Members of Ehretia in southern Africa are predominantly multistemmed shrubs or small trees. Characters of the leaf, the trichome com­plement, inflorescence and corolla are used to distinguish between the different species. A key to the species, distribution maps and illustrations of various micro- and macromorphological as well as palynological features are provided.