WorldWideScience

Sample records for generation vhe instruments

  1. Steam 80 steam generator instrumentation

    International Nuclear Information System (INIS)

    Carson, W.H.; Harris, H.H.

    1980-01-01

    This paper describes two special instrumentation packages in an integral economizer (preheater) steam generator of one of the first System 80 plants scheduled to go into commercial operation. The purpose of the instrumentation is to obtain accurate operating information from regions of the secondary side of the steam generator inaccessible to normal plant instrumentation. In addition to verification of the System 80 steam generator design predictions, the data obtained will assist in verification of steam generator thermal/hydraulic computer codes developed for generic use in the industry

  2. Dicty_cDB: VHE138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHE138 (Link to dictyBase) - - - Contig-U15767-1 VHE138P (Link... to Original site) VHE138F 569 VHE138Z 621 VHE138P 1170 - - Show VHE138 Library VH (Link to library) Clone ID VHE138 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15767-1 Original site URL http://dict...FVDNQAGDSXSAKSGKNLPIQRDIELNWNGEAYEYSNSNYFPINGQGF NDVSYP--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICT...rsi*i**fkllpn*rtrf q*ckls--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICTIDICVHEGILDGLPQGNCSNTPVDCG ANDEDKCKTWSCDPTKGG

  3. Dicty_cDB: VHE867 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHE867 (Link to dictyBase) - G02701 DDB0204977 Contig-U14789-1... - (Link to Original site) VHE867F 383 - - - - - - Show VHE867 Library VH (Link to library) Clone ID VHE867 (Link to dict...yBase) Atlas ID - NBRP ID G02701 dictyBase ID DDB0204977 Link to Contig Contig-U14789-1 Original site URL http://dict...one) Salmo salar clone ssal-rgb2-599-16... 116 2e-25 DQ363469_1( DQ363469 |pid:none) Ict...m_ : 1.00 40.0 %: cytoplasmic 36.0 %: nuclear 12.0 %: cytoskeletal 8.0 %: mitochondrial 4.0 %: peroxisomal >> predict

  4. 4th generation light source instrumentation

    International Nuclear Information System (INIS)

    Lumpkin, A.

    1998-01-01

    This working group on 4th Generation Light Source (4GLS) Instrumentation was a follow-up to the opening-discussion on Challenges in Beam Profiling. It was in parallel with the Feedback Systems session. We filled the SSRL Conference Room with about 25 participants. The session opened with an introduction by Lumpkin. The target beam parameter values for a few-angstrom, self-amplified spontaneous emissions (SASE) experiment and for a diffraction-limited soft x-ray storage ring source were addressed. Instrument resolution would of course need to be 2-3 times better than the value measured, if possible. The nominal targeted performance parameters are emittance (1-2π mm mrad), bunch length (100 fs), peak-current (l-5 kA), beam size (10 microm), beam divergence (1 microrad), energy spread (2 x 10 -4 ), and beam energy (10's of GeV). These are mostly the SASE values, and the possible parameters for a diffraction-limited soft x-ray source would be relaxed somewhat. Beam stability and alignment specifications in the sub-micron domain for either device are anticipated

  5. New generation low power radiation survey instruments

    International Nuclear Information System (INIS)

    Waechter, D.A.; Bjarke, G.O.; Trujillo, F.; Umbarger, C.J.; Wolf, M.A.

    1984-01-01

    A number of new, ultra-low-powered radiation instruments have recently been developed at Los Alamos. Among these are two instruments which use a novel power source to eliminate costly batteries. The newly developed gamma detecting radiac, nicknamed the Firefly, and the alpha particle detecting instrument, called the Simple Cordless Alpha Monitor, both use recent advances in miniaturization and powersaving electronics to yield devices which are small, rugged, and very power-frugal. The two instruments consume so little power that the need for batteries to run them is eliminated. They are, instead, powered by a charged capacitor which will operate the instruments for an hour or more. Use of a capacitor as a power source eliminates many problems commonly associated with battery-operated instruments, such as having to open the case to change batteries, battery storage life, availability of batteries in the field, and some savings in weight. Both line power and mechanical sources are used to charge the storage capacitors which power the instruments

  6. Next Generation Polar Seismic Instrumentation Challenges

    Science.gov (United States)

    Parker, T.; Beaudoin, B. C.; Gridley, J.; Anderson, K. R.

    2011-12-01

    Polar region logistics are the limiting factor for deploying deep field seismic arrays. The IRIS PASSCAL Instrument Center, in collaboration with UNAVCO, designed and deployed several systems that address some of the logistical constraints of polar deployments. However, continued logistics' pressures coupled with increasingly ambitious science projects require further reducing the logistics required for deploying both summer and over winter stations. Our focus is to reduce station power requirements and bulk, thereby minimizing the time and effort required to deploy these arrays. We will reduce the weight of the battery bank by incorporating the most applicable new high energy-density battery technology. Using these batteries will require a completely new power management system along with an appropriate smart enclosure. The other aspect will be to integrate the digitizing system with the sensor. Both of these technologies should reduce the install time and shipping volume plus weight while reducing some instrument costs. We will also continue work on an effective Iridium telemetry solution for automated data return. The costs and limitations of polar deep-field science easily justifies a specialized development effort but pays off doubly in that we will continue to leverage the advancements in reduced logistics and increased performance for the benefit of low-latitude seismic research.

  7. Next Generation UV Coronagraph Instrumentation for Solar Cycle-24

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... New concepts for next generation instrumentation include imaging ultraviolet spectrocoronagraphs and large aperture ultraviolet coronagraph spectrometers. An imaging instrument would be the first to obtain absolute spectral line intensities of the extended corona over a wide field of view. Such images ...

  8. The effects of nuclear power generators upon electronic instrumentation

    Science.gov (United States)

    Miller, C. G.; Truscello, V. C.

    1970-01-01

    Radiation sensitivity of electronic instruments susceptible to neutron and gamma radiation is evaluated by means of a radioisotope thermoelectric generator /RTG/. The gamma field of the RTG affects instrument operation and requires shielding, the neutron field does not affect operation via secondary capture-gamma production.

  9. VHE and UHE gamma ray astronomy: transients and sources

    International Nuclear Information System (INIS)

    Fegan, D.J.

    1987-01-01

    The transient and sporadic nature of a number of Cosmic gamma ray sources is examined in relation to VHE (10 11 to 10 14 eV) observations of pulsars and X-ray binary systems. Transients are not all that common but when they occur they generally produce emission of sufficient intensity and duration to obtain statistically significant effects which are gradually helping to establish a source catalog. A brief review is also made of the staus of UHE (>10 14 eV) gamma ray astronomy

  10. Instrumentation and control of turbine, generator and associated systems

    International Nuclear Information System (INIS)

    Vogtland, U.

    1982-01-01

    The purpose of this presentation is to give some information on Instrumentation and Control (I and C) for turbine-generators, in this case for nuclear application. The I and C scope of supply for such a turbine-generator can be divided as follows: - Closed-loop controls - Turbine stress control systems - Supervisory instrumentation - Protection systems - Open-loop controls. The main systems used for nuclear application are presented by means of examples taken from these a.m. categories. (orig./RW)

  11. Efforts onto electricity and instrumentation technology for nuclear power generation

    International Nuclear Information System (INIS)

    Hayakawa, Toshifumi

    2000-01-01

    Nuclear power generation shares more than 1/3 of all amounts of in-land generation at present, as a supplying source of stable electric energy after 2000 either. As a recent example of efforts onto electricity and instrumentation technology for nuclear power generation, there are, on instrumentation control system a new central control board aiming at reduction of operator's load, protection of human error, and upgrading of system reliability and economics by applying high level micro-processor applied technique and high speed data transfer technique to central monitoring operation and plant control protection, on a field of reactor instrumentation a new digital control rod position indicator improved of conventional system on a base of operation experience and recent technology, on a field of radiation instrumentation a new radiation instrumentation system accumulating actual results in a wide application field on a concept of application to nuclear power plant by adopting in-situ separation processing system using local network technique, and on a field of operation maintenance and management a conservation management system for nuclear generation plant intending of further effectiveness of operation maintenance management of power plant by applying of operation experience and recent data processing and communication technology. And, in the large electric apparatus, there are some generators carried out production and verification of a model one with actual size in lengthwise dimension, to correspond to future large capacity nuclear power plant. By this verification, it was proved that even large capacity generator of 1800 MVA class could be manufactured. (G.K.)

  12. Testing for the Best Instrument to Generate Sustainable Food Consumption

    Directory of Open Access Journals (Sweden)

    Luca Panzone

    2011-12-01

    Full Text Available  The increase in the level of greenhouse gas (GHG emissions in the atmosphere in the last centuries, and the subsequent increase in temperature, has been a widely studied area in the last few decades. Climate change has become a key item on the political agenda due to concerns regarding the sustainability of current human consumption for future generations. Consumption of food and agricultural goods constitutes an important part of household based GHG emissions, and the relatively low costs associated with environmental improvements make it an interesting area of study to understand behavioural changes. Despite general agreement on the need to curb the amount of GHG emissions worldwide, little evidence exists regarding the best instruments policymakers can employ to stimulate changes toward more sustainable consumption. The present work explores which instruments are most effective in fostering change to more environmentally friendly food consumption. The instruments tested are CO2 labelling, GHG abatement subsidy and product-specific bans. We used a simulated online shopping trip in supermarkets in the Greater London area in the United Kingdom, where respondents shopped in four product categories: cola, milk, meat (chicken and beef, and butter/margarine. Consumer preferences reveal that, in the presence of these instruments, quantity instruments performed better than price incentives and labelling.

  13. Future independent power generation and implications for instruments and controls

    International Nuclear Information System (INIS)

    Williams, J.H.

    1991-01-01

    This paper reports that the independent power producers market is comprised of cogeneration, small power generation, and independent power production (IPP) segments. Shortfalls in future electric supply are expected to lead to significant growth in this market. The opportunities for instruments and controls will shift from traditional electric utility applications to the independent power market with a more diverse set of needs. Importance will be placed on system reliability, quality of power and increased demand for clean kWh

  14. A novel instrument for generating angular increments of 1 nanoradian

    Science.gov (United States)

    Alcock, Simon G.; Bugnar, Alex; Nistea, Ioana; Sawhney, Kawal; Scott, Stewart; Hillman, Michael; Grindrod, Jamie; Johnson, Iain

    2015-12-01

    Accurate generation of small angles is of vital importance for calibrating angle-based metrology instruments used in a broad spectrum of industries including mechatronics, nano-positioning, and optic fabrication. We present a novel, piezo-driven, flexure device capable of reliably generating micro- and nanoradian angles. Unlike many such instruments, Diamond Light Source's nano-angle generator (Diamond-NANGO) does not rely on two separate actuators or rotation stages to provide coarse and fine motion. Instead, a single Physik Instrumente NEXLINE "PiezoWalk" actuator provides millimetres of travel with nanometre resolution. A cartwheel flexure efficiently converts displacement from the linear actuator into rotary motion with minimal parasitic errors. Rotation of the flexure is directly measured via a Magnescale "Laserscale" angle encoder. Closed-loop operation of the PiezoWalk actuator, using high-speed feedback from the angle encoder, ensures that the Diamond-NANGO's output drifts by only ˜0.3 nrad rms over ˜30 min. We show that the Diamond-NANGO can reliably move with unprecedented 1 nrad (˜57 ndeg) angular increments over a range of >7000 μrad. An autocollimator, interferometer, and capacitive displacement sensor are used to independently confirm the Diamond-NANGO's performance by simultaneously measuring the rotation of a reflective cube.

  15. Neutron generator instrumentation at the Department 2350 Neutron Generator Test Facility

    International Nuclear Information System (INIS)

    Bryant, T.C.; Mowrer, G.R.

    1979-06-01

    The computer and waveform digitizing capability at the test facility has allowed several changes in the techniques used to test neutron generators. These changes include methods used to calibrate the instrumentation and changes in the operation of the test facility. These changes have increased the efficiency of the test facility as well as increasing both timing and amplitude accuracy of neutron generator waveforms

  16. Instrumentation for electromagnetic field generation in biological measurements

    International Nuclear Information System (INIS)

    Malaric, K.; Malaric, R.; Tkalec, M.; Lenicek, I.; Sala, A.

    2005-01-01

    Electromagnetic fields (EMFs) are part of everyday life in modern world. Extremely low-frequency EMFs (50 Hz) are produced by most electric home appliance, electric power transmission and distribution lines. For the last ten years mobile phones have been widely used all around the world. They operate on the EMF frequencies from 400 MHz to 1900 MHz. The effects of EMFs on living organisms have been the subject of debate and research for the last thirty years. The instrumentation for generation of EMFs have been designed at the Faculty of Electrical Engineering and Computing, Zagreb, and can be used for controlled exposure to different EMFs. To study the effect of extremely low-frequency EMF, duckweed (Lemna minor) - the model plant in biological measurement, test setup was made for magnetic field in Helmholtz coil and for electric field between two parallel circle electrodes. For the effect of mobile phones frequencies, test setup with exposition to the electromagnetic field was done with Gigahertz Transversal Electromagnetic Mode (GTEM) cell. The research confirmed that instrumentation used in these experiments is suitable for evaluation of biological effects of EMFs. The effect of different field strengths, exposure times and modulation can be tested with these instrumentation.(author)

  17. Looking Forward - A Next Generation of Thermal Infrared Planetary Instruments

    Science.gov (United States)

    Christensen, P. R.; Hamilton, V. E.; Edwards, C. S.; Spencer, J. R.

    2017-12-01

    Thermal infrared measurements have provided important information about the physical properties of planetary surfaces beginning with the initial Mariner spacecraft in the early 1960's. These infrared measurements will continue into the future with a series of instruments that are now on their way or in development that will explore a suite of asteroids, Europa, and Mars. These instruments are being developed at Arizona State University, and are next-generation versions of the TES, Mini-TES, and THEMIS infrared spectrometers and imagers. The OTES instrument on OSIRIS-REx, which was launched in Sept. 2016, will map the surface of the asteroid Bennu down to a resolution of 40 m/pixel at seven times of day. This multiple time of day coverage will be used to produce global thermal inertia maps that will be used to determine the particle size distribution, which will in turn help select a safe and appropriate sample site. The EMIRS instrument, which is being built in partnership with the UAE's MBRSC for the Emirates Mars Mission, will measure martian surface temperatures at 200-300 km/pixel scales at over the full diurnal cycle - the first time the full diurnal temperature cycle has been observed since the Viking mission. The E-THEMIS instrument on the Europa Clipper mission will provide global mapping at 5-10 km/pixel scale at multiple times of day, and local observations down to resolutions of 50 m/pixel. These measurements will have a precision of 0.2 K for a 90 K scene, and will be used to map the thermal inertia and block abundances across Europa and to identify areas of localized endogenic heat. These observations will be used to investigate the physical processes of surface formation and evolution and to help select the landing site of a future Europa lander. Finally, the LTES instrument on the Lucy mission will measure temperatures on the day and night sides of the target Trojan asteroids, again providing insights into their surface properties and evolution

  18. Ground-based VHE γ ray astronomy with air Cherenkov imaging telescopes

    International Nuclear Information System (INIS)

    Mirzoyan, R.

    2000-01-01

    The history of astronomy has been one of the scientific discovery following immediately the introduction of new technology. In this report, we will review shortly the basic development of the atmospheric air Cherenkov light detection technique, particularly the imaging telescope technique, which in the last years led to the firm establishment of a new branch in experimental astronomy, namely ground-based very high-energy (VHE) γ ray astronomy. Milestones in the technology and in the analysis of imaging technique will be discussed. The design of the 17 m diameter MAGIC Telescope, being currently under construction, is based on the development of new technologies for all its major parts and sets new standards in the performance of the ground-based γ detectors. MAGIC is one of the next major steps in the development of the technique being the first instrument that will allow one to carry out measurements also in the not yet investigated energy gap i.e. between 10 and 300 GeV

  19. HVRM: a second generation ACE-FTS instrument concept

    Science.gov (United States)

    Lavigne, Jean-François; Larouche, Martin; Dupont, Fabien; Girard, Guillaume; Veilleux, James; Buijs, Henry; Desbiens, Raphaël.; Perron, Gaétan; Grandmont, Frédéric; Paradis, Simon; Moreau, Louis; Bourque, Hugo

    2017-11-01

    The Atmospheric Chemistry Experiment Fourier Transform Spectrometer (ACE-FTS) is the main instrument on-board the SCISAT-1 satellite, a mission mainly supported by the Canadian Space Agency [1]. It is in Low- Earth Orbit at an altitude of 650 km with an inclination of 74E. Its data has been used to track the vertical profile of more than 30 atmospheric species in the high troposphere and in the stratosphere with the main goal of providing crucial information for the comprehension of chemical and physical processes controlling the ozone life cycle. These atmospheric species are detected using high-resolution (0.02 cm-1) spectra in the 750-4400 cm-1 spectral region. This leads to more than 170 000 spectral channels being acquired in the IR every two seconds. It also measures aerosols and clouds to reduce the uncertainty in their effects on the global energy balance. It is currently the only instrument providing such in-orbit high resolution measurements of the atmospheric chemistry and is often used by international scientists as a unique data set for climate understanding. The satellite is in operation since 2003, exceeding its initially planned lifetime of 2 years by more than a factor of 5. Given its success, its usefulness and the uniqueness of the data it provides, the Canadian Space Agency has founded the development of technologies enabling the second generation of ACE-FTS instruments through the High Vertical Resolution Measurement (HVRM) project but is still waiting for the funding for a mission. This project addresses three major improvements over the ACE-FTS. The first one aims at improving the vertical instantaneous field-of-view (iFoV) from 4.0 km to 1.5 km without affecting the SNR and temporal precision. The second aims at providing precise knowledge on the tangent height of the limb observation from an external method instead of that used in SCISAT-1 where the altitude is typically inferred from the monotonic CO2 concentration seen in the spectra. The

  20. Next-generation marine instruments to join plume debate

    Science.gov (United States)

    Simons, F. J.; Nolet, G.; Babcock, J.

    2003-12-01

    Whether hot spot volcanism is the consequence of plate tectonics or has a deep origin in a mantle plume is debated. G.~Foulger (Geol.~Soc.~London Lett.~Online, accessed 9/3/2003), writes that carefully truncated cross sections, with color scales cranked up, give noisy images the illusion of strong anomalies traversing the mantle. Don Anderson, the big daddy of non-plume hypotheses (R.~Kent, Geol.~Soc.~London Lett.~Online, accessed 9/3/2003) has written that the resolution of regional tomography experiments must be improved in order to successfully determine whether (...) the deep mantle is the controlling factor in the formation of proposed hot spots (Keller et al., GRL 27 (24), 2000). In particular for Iceland, at issue is the inherently limited aperture of any land-based seismometer array on the island: (...) the resolution of such images could be increased (...) by using ocean bottom seismometers (...) (ibidem). These problems are not unique to the plume debate. Coverage, resolution and robustness of models of the wave speed distribution in the interior of the Earth obtained by seismic tomographic inversions are limited by the areal distribution of seismic stations. Two thirds of Earth's surface are virtually inaccessible to passive-source seismometry, save indeed for expensive ocean-bottom seismometers or moored hydrophones. Elsewhere at this meeting, Montelli et al. describe how an improved theoretical treatment of the generation and survival of travel-time anomalies and sophisticated parameterization techniques yield unprecedented resolution of the seismic expression of a variety of ``plumes'' coming from all depths within the mantle. On the other hand, the improved resolution required to settling the debate on the depth to the seismic origin of various hot spots will also result from the collection of previously inaccessable data. Here, we show our progress in the development of an independent hydro-acoustical recording device mounted on SOLO floats. Our

  1. Early warning for VHE gamma-ray flares with the ARGO-YBJ detector

    Energy Technology Data Exchange (ETDEWEB)

    Bartoli, B. [Dipartimento di Fisica dell' Universita di Napoli ' Federico II' , Complesso Universitario di Monte Sant' Angelo, via Cinthia, 80126 Napoli (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Napoli, Complesso Universitario di Monte Sant' Angelo, via Cinthia, 80126 Napoli (Italy); Bernardini, P. [Dipartimento di Fisica dell' Universita del Salento, via per Arnesano, 73100 Lecce (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Lecce, via per Arnesano, 73100 Lecce (Italy); Bi, X.J. [Key Laboratory of Particle Astrophysics, Institute of High Energy Physics, Chinese Academy of Sciences, P.O. Box 918, 100049 Beijing (China); Bleve, C. [Dipartimento di Fisica dell' Universita del Salento, via per Arnesano, 73100 Lecce (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Lecce, via per Arnesano, 73100 Lecce (Italy); Bolognino, I. [Dipartimento di Fisica Nucleare e Teorica dell' Universita di Pavia, via Bassi 6, 27100 Pavia (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Pavia, via Bassi 6, 27100 Pavia (Italy); Branchini, P.; Budano, A. [Istituto Nazionale di Fisica Nucleare, Sezione di Roma Tre, via della Vasca Navale 84, 00146 Roma (Italy); Calabrese Melcarne, A.K. [Istituto Nazionale di Fisica Nucleare - CNAF, Viale Berti-Pichat 6/2, 40127 Bologna (Italy); Camarri, P. [Dipartimento di Fisica dell' Universita di Roma ' Tor Vergata' , via della Ricerca Scientifica 1, 00133 Roma (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Roma Tor Vergata, via della Ricerca Scientifica 1, 00133 Roma (Italy); Cao, Z. [Key Laboratory of Particle Astrophysics, Institute of High Energy Physics, Chinese Academy of Sciences, P.O. Box 918, 100049 Beijing (China); and others

    2011-12-11

    Detecting and monitoring emissions from flaring gamma-ray sources in the very-high-energy (VHE, > 100 GeV) band is a very important topic in gamma-ray astronomy. The ARGO-YBJ detector is characterized by a high duty cycle and a wide field of view. Therefore, it is particularly capable of detecting flares from extragalactic objects. Based on fast reconstruction and analysis, real-time monitoring of 33 selected VHE extragalactic sources is implemented. Flares exceeding a specific threshold are reported timely, hence enabling the follow-up observation of these objects using more sensitive detectors, such as Cherenkov telescopes.

  2. New-generation low-power radiation survey instruments

    International Nuclear Information System (INIS)

    Waechter, D.A.; Bjarke, G.O.; Wolf, M.A.; Trujillo, F.; Umbarger, C.J.

    1983-01-01

    A number of new, ultra-low-powered radiation instruments have recently been developed at Los Alamos. Among these are two instruments which use a novel power source to eliminate costly batteries. The newly developed gamma detecting radiac, nicknamed the Firefly, and the alpha particle detecting instrument, called the Simple Cordless Alpha Monitor, both use recent advances in miniaturization and power-saving electronics to yield devices which are small, rugged, and very power-frugal. The two instruments consume so little power that the need for batteries to run them is eliminated. They are, instead, powered by a charged capacitor which will operate the instruments for an hour or more. Both line power and mechanical sources are used to charge the storage capacitors which power the instruments

  3. New generation in process-control colorimetric instrumentation

    Science.gov (United States)

    Ladson, Jack A.

    1992-08-01

    Colorimetric performance parameters (repeatability and reproducibility) of a new spectrophotometer/colorimeter manufactured by BYK-Gardner, Inc. are reported. The color- viewTM spectrophotometer (CVS) uses forty-five degree illumination and zero degree viewing geometry relative to the plane of the test specimen. The CVS is designed for the measurement of diffuse reflectance factor. It is designed to conform to national and international recommendations for Spectrophotometry and Colorimetry. Colorimetric performance was evaluated by measuring colored tiles manufactured by the British Ceramic Research Association (BCRA). Instrument repeatability was recorded after an hour, eight hours, and thirty days. Routine performance of the CVS shows that color difference repeatability over short and medium time periods is within 0.15 CIELAB color difference unit. The long term repeatability is within 0.4 unit. Reproducibility was evaluated by making color measurements on BCRA tiles with 54 instruments. Measurements made on CVS instruments indicate that its reproducibility is better than the reproducibility of product standards. Reproducibility is well within the requirement for industrial applications. Actually, the repeatability and reproducibility is comparable to that of reference instruments in national standardizing laboratories.

  4. Search for VHE γ-ray emission from the direction of the two millisecond pulsars PSR J0437-4715 and PSR J1824-2452 and the composite supernova remnant Kes 75 with H.E.S.S

    International Nuclear Information System (INIS)

    Fuessling, Matthias

    2012-01-01

    This work reports on the search for pulsed and steady very-high energy (VHE) gamma-ray emission in the energy range extending from 100 GeV up to 100 TeV from the direction of three pulsars with the High Energy Stereoscopic System (H.E.S.S.). Pulsed gamma-ray radiation from pulsars with energies beyond 100 GeV was found thus far only for the young and energetic Crab pulsar. A special class of pulsar wind nebulae (PWNe) is associated with composite supernova remnants (SNRs) where the PWN is centered in an expanding SNR shell. In the first part of this thesis, the results on the search for pulsed and steady VHE gamma-ray emission from the two millisecond pulsars, PSR J0437-4715 and PSR J1824-2452, are presented. Parts of the observations were conducted in a special trigger setup (the topological trigger with convergent pointing) to reduce the energy threshold of the instrument. No signal of pulsed or steady emission is found and upper limits on the pulsed and steady gamma-ray flux are derived. The upper limits on the pulsed gamma-ray flux are compared to existing model predictions and, in the case of PSR J1824-2452, allow the range of possible viewing geometries in some models to be constrained. In the second part of this work, results on the search for pulsed and steady VHE gamma-ray emission from the direction of the composite SNR Kes 75 are presented. The PWN in the center of Kes 75 is powered by a very young and powerful pulsar, PSR J1846-0258, that has an exceptionally high magnetic field. While no hint for pulsed emission is found, steady VHE gamma-ray emission is detected with a statistical significance of 10 sigma from a point-like source. The VHE gamma-ray emission is spatially coincident with the PWN and the SNR shell. Both are discussed as a possible origin for the observed emission. The pulsar of Kes 75 would be the youngest pulsar known to date to power a VHE PWN.

  5. Biomass power generation in competitive markets - The impact of instruments and regulations

    International Nuclear Information System (INIS)

    Ackermann, Thomas; Soeder, Lennart

    1999-01-01

    This paper presents and briefly evaluates the most important existing market instruments and market schemes which support the development of renewable energy generation as well as the impact of market regulations on the development of biomass power generation. The evaluation of the existing instruments focuses on the incentives provided by the various instruments to reduce production costs. The instruments and schemes are: Feed-in Tariffs, Net Metering, Bidding Process, Fixed Quotas, Green Certificate Trading, Green Power Exchange, Green Pricing. Feed-in tariffs and net metering are important instruments to get the different technologies 'off the ground', however, they can only be considered an interim solution as they do not necessarily lead to cost reduction. A bidding process is one way to achieve these cost reductions, but high transaction costs will support the development of large renewable energy projects, which is not always the desired effect. Fixed quotas combined with green certificate trading or a power exchange in combination with Green Pricing seem to lead to similar costs reduction, however, so far there is only limited experience with such instruments. The analysis of the impact of market regulations focuses on international electricity markets with a power exchange. Such markets exist, for example, in Scandinavia, England and Wales, Australia, New Zealand and California. The analysis showed that new distributed generation, for example based on biomass, faces significant market barriers. Furthermore, distributed generation is not treated equally within the market regulations compared to large-scale power generation

  6. Statistical pulses generator. Application to nuclear instrumentation (1962); Generateur d'impulsions aleatoires. Application a l'instrumentation nucleaire (1962)

    Energy Technology Data Exchange (ETDEWEB)

    Beranger, R [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1962-07-01

    This report describes a random pulses generator adapted to nuclear instrumentation. After a short survey on the statistical nature of electronic signals, the different ways for generating pulses with a Poisson's time-distribution are studied. The final generator built from a gaseous thyratron in a magnetic field is then described. Several tests are indicated : counting-rate stability, Pearson's criterion, distribution of time-intervals. Applications of the generator in 'whole testing' of nuclear instrumentation are then indicated for sealers, dead time measurements, time analyzers. In this application, pulse-height spectrums have been made by Poissonian sampling of a recurrent or random low-frequency signal. (author) [French] Cette etude decrit un generateur d'impulsions aleatoires et ses applications a l'instrumentation nucleaire. Apres un bref rappel sur la nature statistique des signaux en electronique nucleaire, sont passes en revue les principaux moyens d'obtenir des impulsions distribuees en temps suivant une loi de Poisson. Le generateur utilisant un thyratron a gaz dans un champ magnetique est ensuite decrit; diverses methodes de test sont appliquees (stabilite du taux de comptage, criterium de Pearson, spectre des intervalles ds temps). Les applications du generateur a l'electronique nucleaire dans le domaine des 'essais globaux' sont indiques: test des echelles de comptage et mesure des temps morts, test des analyseurs en temps apres division du taux de comptage par une puissance de deux, test des analyseurs multicanaux en amplitude. Pour cette derniere application, on a realise des spectres d'amplitudes suivant une loi connue, par echantillonnage poissonien d'un signal basse frequence recurrent ou aleatoire. (auteur)

  7. Instrumentation

    International Nuclear Information System (INIS)

    Prieur, G.; Nadi, M.; Hedjiedj, A.; Weber, S.

    1995-01-01

    This second chapter on instrumentation gives little general consideration on history and classification of instrumentation, and two specific states of the art. The first one concerns NMR (block diagram of instrumentation chain with details on the magnets, gradients, probes, reception unit). The first one concerns precision instrumentation (optical fiber gyro-meter and scanning electron microscope), and its data processing tools (programmability, VXI standard and its history). The chapter ends with future trends on smart sensors and Field Emission Displays. (D.L.). Refs., figs

  8. MHTGR steam generator on-line heat balance, instrumentation and function

    International Nuclear Information System (INIS)

    Klapka, R.E.; Howard, W.W.; Etzel, K.T.; Basol, M.; Karim, N.U.

    1991-09-01

    Instrumentation is used to measure the Modular High Temperature Gas-Cooled Reactor (MHTGR) steam generator dissimilar metal weld temperature during start-up testing. Additional instrumentation is used to determine an on-line heat balance which is maintained during the 40 year module life. In the process of calibrating the on-line heat balance, the helium flow is adjusted to yield the optimum boiling level in the steam generator relative to the dissimilar metal weld. After calibration is complete the weld temperature measurement is non longer required. The reduced boiling level range results in less restrictive steam generator design constraints

  9. Discovery of the hard spectrum VHE γ-ray source HESS J1641-463

    International Nuclear Information System (INIS)

    Abramowski, A.; Ait Benkhali, F.

    2014-10-01

    This letter reports the discovery of a remarkably hard spectrum source, HESS J1641.463, by the High Energy Stereoscopic System (H.E.S.S.) in the very high energy (VHE) domain. HESS J1641.463 remained unnoticed by the usual analysis techniques due to confusion with the bright nearby source HESS J1640.465. It emerged at a significance level of 8.5 standard deviations after restricting the analysis to events with energies above 4 TeV. It shows a moderate flux level of φ (E>1 TeV)=(3.64 ± 0.44 stat ± 0.73 sys ) x 10 -13 cm -2 s -1 , corresponding to 1.8% of the Crab Nebula flux above the same energy, and a hard spectrum with a photon index of Γ=2.07±0.11 stat ±0.20 sys . It is a point-like source, although an extension up to a Gaussian width of σ=3 arcmin cannot be discounted due to uncertainties in the H.E.S.S. point-spread function. The VHE γ-ray flux of HESS J1641.463 is found to be constant over the observed period when checking time binnings from the year-by-year to the 28 minute exposure timescales. HESS J1641.463 is positionally coincident with the radio supernova remnant SNR G338.5+0.1. No X-ray candidate stands out as a clear association; however, Chandra and XMM-Newton data reveal some potential weak counterparts. Various VHE γ-ray production scenarios are discussed. If the emission from HESS J1641.463 is produced by cosmic ray protons colliding with the ambient gas, then their spectrum must extend close to 1 PeV. This object may represent a source population contributing significantly to the galactic cosmic ray flux around the knee.

  10. Magnetic absorption of VHE photons in the magnetosphere of the Crab pulsar

    Science.gov (United States)

    Bogovalov, S. V.; Contopoulos, I.; Prosekin, A.; Tronin, I.; Aharonian, F. A.

    2018-05-01

    The detection of the pulsed ˜1 TeV gamma-ray emission from the Crab pulsar reported by MAGIC and VERITAS collaborations demands a substantial revision of existing models of particle acceleration in the pulsar magnetosphere. In this regard model independent restrictions on the possible production site of the very high energy (VHE) photons become an important issue. In this paper, we consider limitations imposed by the process of conversion of VHE gamma-rays into e± pairs in the magnetic field of the pulsar magnetosphere. Photons with energies exceeding 1 TeV are effectively absorbed even at large distances from the surface of the neutron star. Our calculations of magnetic absorption in the force-free magnetosphere show that the twisting of the magnetic field due to the pulsar rotation makes the magnetosphere more transparent compared to the dipole magnetosphere. The gamma-ray absorption appears stronger for photons emitted in the direction of rotation than in the opposite direction. There is a small angular cone inside which the magnetosphere is relatively transparent and photons with energy 1.5 TeV can escape from distances beyond 0.1 light cylinder radius (Rlc). The emission surface from where photons can be emitted in the observer's direction further restricts the sites of VHE gamma-ray production. For the observation angle 57° relative to the Crab pulsar axis of rotation and the orthogonal rotation, the emission surface in the open field line region is located as close as 0.4 Rlc from the stellar surface for a dipole magnetic field, and 0.1 Rlc for a force-free magnetic field.

  11. Instrumentation

    International Nuclear Information System (INIS)

    Decreton, M.

    2000-01-01

    SCK-CEN's research and development programme on instrumentation aims at evaluating the potentials of new instrumentation technologies under the severe constraints of a nuclear application. It focuses on the tolerance of sensors to high radiation doses, including optical fibre sensors, and on the related intelligent data processing needed to cope with the nuclear constraints. Main achievements in these domains in 1999 are summarised

  12. Instrumentation

    Energy Technology Data Exchange (ETDEWEB)

    Decreton, M

    2001-04-01

    SCK-CEN's research and development programme on instrumentation involves the assessment and the development of sensitive measurement systems used within a radiation environment. Particular emphasis is on the assessment of optical fibre components and their adaptability to radiation environments. The evaluation of ageing processes of instrumentation in fission plants, the development of specific data evaluation strategies to compensate for ageing induced degradation of sensors and cable performance form part of these activities. In 2000, particular emphasis was on in-core reactor instrumentation applied to fusion, accelerator driven and water-cooled fission reactors. This involved the development of high performance instrumentation for irradiation experiments in the BR2 reactor in support of new instrumentation needs for MYRRHA, and for diagnostic systems for the ITER reactor.

  13. Instrumentation

    International Nuclear Information System (INIS)

    Decreton, M.

    2001-01-01

    SCK-CEN's research and development programme on instrumentation involves the assessment and the development of sensitive measurement systems used within a radiation environment. Particular emphasis is on the assessment of optical fibre components and their adaptability to radiation environments. The evaluation of ageing processes of instrumentation in fission plants, the development of specific data evaluation strategies to compensate for ageing induced degradation of sensors and cable performance form part of these activities. In 2000, particular emphasis was on in-core reactor instrumentation applied to fusion, accelerator driven and water-cooled fission reactors. This involved the development of high performance instrumentation for irradiation experiments in the BR2 reactor in support of new instrumentation needs for MYRRHA, and for diagnostic systems for the ITER reactor

  14. Instrumentation

    International Nuclear Information System (INIS)

    Decreton, M.

    2002-01-01

    SCK-CEN's R and D programme on instrumentation involves the development of advanced instrumentation systems for nuclear applications as well as the assessment of the performance of these instruments in a radiation environment. Particular emphasis is on the use of optical fibres as umbilincal links of a remote handling unit for use during maintanance of a fusion reacor, studies on the radiation hardening of plasma diagnostic systems; investigations on new instrumentation for the future MYRRHA accelerator driven system; space applications related to radiation-hardened lenses; the development of new approaches for dose, temperature and strain measurements; the assessment of radiation-hardened sensors and motors for remote handling tasks and studies of dose measurement systems including the use of optical fibres. Progress and achievements in these areas for 2001 are described

  15. Instrumentation

    Energy Technology Data Exchange (ETDEWEB)

    Decreton, M

    2002-04-01

    SCK-CEN's R and D programme on instrumentation involves the development of advanced instrumentation systems for nuclear applications as well as the assessment of the performance of these instruments in a radiation environment. Particular emphasis is on the use of optical fibres as umbilincal links of a remote handling unit for use during maintanance of a fusion reacor, studies on the radiation hardening of plasma diagnostic systems; investigations on new instrumentation for the future MYRRHA accelerator driven system; space applications related to radiation-hardened lenses; the development of new approaches for dose, temperature and strain measurements; the assessment of radiation-hardened sensors and motors for remote handling tasks and studies of dose measurement systems including the use of optical fibres. Progress and achievements in these areas for 2001 are described.

  16. Instrumentation

    Energy Technology Data Exchange (ETDEWEB)

    Decreton, M

    2000-07-01

    SCK-CEN's research and development programme on instrumentation aims at evaluating the potentials of new instrumentation technologies under the severe constraints of a nuclear application. It focuses on the tolerance of sensors to high radiation doses, including optical fibre sensors, and on the related intelligent data processing needed to cope with the nuclear constraints. Main achievements in these domains in 1999 are summarised.

  17. Instrumentation

    International Nuclear Information System (INIS)

    Umminger, K.

    2008-01-01

    A proper measurement of the relevant single and two-phase flow parameters is the basis for the understanding of many complex thermal-hydraulic processes. Reliable instrumentation is therefore necessary for the interaction between analysis and experiment especially in the field of nuclear safety research where postulated accident scenarios have to be simulated in experimental facilities and predicted by complex computer code systems. The so-called conventional instrumentation for the measurement of e. g. pressures, temperatures, pressure differences and single phase flow velocities is still a solid basis for the investigation and interpretation of many phenomena and especially for the understanding of the overall system behavior. Measurement data from such instrumentation still serves in many cases as a database for thermal-hydraulic system codes. However some special instrumentation such as online concentration measurement for boric acid in the water phase or for non-condensibles in steam atmosphere as well as flow visualization techniques were further developed and successfully applied during the recent years. Concerning the modeling needs for advanced thermal-hydraulic codes, significant advances have been accomplished in the last few years in the local instrumentation technology for two-phase flow by the application of new sensor techniques, optical or beam methods and electronic technology. This paper will give insight into the current state of instrumentation technology for safety-related thermohydraulic experiments. Advantages and limitations of some measurement processes and systems will be indicated as well as trends and possibilities for further development. Aspects of instrumentation in operating reactors will also be mentioned.

  18. Instrumentation system for pulsed neutron generator. Pt. 1. Electronic control and data acquisition

    International Nuclear Information System (INIS)

    Burda, J.; Igielski, A.; Janik, W.; Kosik, M.; Kurowski, A.; Zaleski, T.

    1997-01-01

    The paper presents an electronic instrumentation system which is successfully applied for pulsed neutron generator and measurements. In the paper there are described in details all modernized parts of the system as well as new designed and applied ones. The set of diagrams is enclosed. An important part of the system has been designed and built in the Neutron Transport Physics Laboratory. (author)

  19. Instruments

    International Nuclear Information System (INIS)

    Buehrer, W.

    1996-01-01

    The present paper mediates a basic knowledge of the most commonly used experimental techniques. We discuss the principles and concepts necessary to understand what one is doing if one performs an experiment on a certain instrument. (author) 29 figs., 1 tab., refs

  20. DISCOVERY OF THE HARD SPECTRUM VHE γ-RAY SOURCE HESS J1641–463

    Energy Technology Data Exchange (ETDEWEB)

    Abramowski, A. [Institut für Experimentalphysik, Universität Hamburg, Luruper Chaussee 149, D-22761 Hamburg (Germany); Aharonian, F.; Ait Benkhali, F.; Bernlöhr, K. [Max-Planck-Institut für Kernphysik, PO Box 103980, D-69029 Heidelberg (Germany); Akhperjanian, A. G. [National Academy of Sciences of the Republic of Armenia, Marshall Baghramian Avenue, 24, 0019 Yerevan, Republic of Armenia (Armenia); Angüner, E. O.; Birsin, E. [Institut für Physik, Humboldt-Universität zu Berlin, Newtonstr. 15, D-12489 Berlin (Germany); Backes, M. [Department of Physics, University of Namibia, Private Bag 13301, Windhoek (Namibia); Balenderan, S. [Department of Physics, University of Durham, South Road, Durham DH1 3LE (United Kingdom); Balzer, A. [GRAPPA, Anton Pannekoek Institute for Astronomy, University of Amsterdam, Science Park 904, 1098 XH Amsterdam (Netherlands); Barnacka, A. [Obserwatorium Astronomiczne, Uniwersytet Jagielloński, ul. Orla 171, 30-244 Kraków (Poland); Becherini, Y. [Department of Physics and Electrical Engineering, Linnaeus University, 351 95 Växjö (Sweden); Becker Tjus, J. [Institut für Theoretische Physik, Lehrstuhl IV: Weltraum und Astrophysik, Ruhr-Universität Bochum, D-44780 Bochum (Germany); Berge, D. [GRAPPA, Anton Pannekoek Institute for Astronomy and Institute of High-Energy Physics, University of Amsterdam, Science Park 904, 1098 XH Amsterdam (Netherlands); Bernhard, S. [Institut für Astro- und Teilchenphysik, Leopold-Franzens-Universität Innsbruck, A-6020 Innsbruck (Austria); Biteau, J. [Laboratoire Leprince-Ringuet, Ecole Polytechnique, CNRS/IN2P3, F-91128 Palaiseau (France); Böttcher, M. [Centre for Space Research, North-West University, Potchefstroom 2520 (South Africa); Boisson, C., E-mail: sabrina.casanova@ifj.edu.pl, E-mail: sabrina.casanova@mpi-hd.mpg.de [LUTH, Observatoire de Paris, CNRS, Université Paris Diderot, 5 Place Jules Janssen, F-92190 Meudon (France); Collaboration: H.E.S.S. Collaboration; and others

    2014-10-10

    This Letter reports the discovery of a remarkably hard spectrum source, HESS J1641–463, by the High Energy Stereoscopic System (H.E.S.S.) in the very high energy (VHE) domain. HESS J1641–463 remained unnoticed by the usual analysis techniques due to confusion with the bright nearby source HESS J1640–465. It emerged at a significance level of 8.5 standard deviations after restricting the analysis to events with energies above 4 TeV. It shows a moderate flux level of φ(E>1 TeV) = (3.64 ± 0.44{sub stat} ± 0.73{sub sys}) × 10{sup –13} cm{sup –2} s{sup –1}, corresponding to 1.8% of the Crab Nebula flux above the same energy, and a hard spectrum with a photon index of Γ = 2.07 ± 0.11{sub stat} ± 0.20{sub sys}. It is a point-like source, although an extension up to a Gaussian width of σ = 3 arcmin cannot be discounted due to uncertainties in the H.E.S.S. point-spread function. The VHE γ-ray flux of HESS J1641–463 is found to be constant over the observed period when checking time binnings from the year-by-year to the 28 minute exposure timescales. HESS J1641–463 is positionally coincident with the radio supernova remnant SNR G338.5+0.1. No X-ray candidate stands out as a clear association; however, Chandra and XMM-Newton data reveal some potential weak counterparts. Various VHE γ-ray production scenarios are discussed. If the emission from HESS J1641–463 is produced by cosmic ray protons colliding with the ambient gas, then their spectrum must extend close to 1 PeV. This object may represent a source population contributing significantly to the galactic cosmic ray flux around the knee.

  1. Instrumentation

    International Nuclear Information System (INIS)

    Muehllehner, G.; Colsher, J.G.

    1982-01-01

    This chapter reviews the parameters which are important to positron-imaging instruments. It summarizes the options which various groups have explored in designing tomographs and the methods which have been developed to overcome some of the limitations inherent in the technique as well as in present instruments. The chapter is not presented as a defense of positron imaging versus single-photon or other imaging modality, neither does it contain a description of various existing instruments, but rather stresses their common properties and problems. Design parameters which are considered are resolution, sampling requirements, sensitivity, methods of eliminating scattered radiation, random coincidences and attenuation. The implementation of these parameters is considered, with special reference to sampling, choice of detector material, detector ring diameter and shielding and variations in point spread function. Quantitation problems discussed are normalization, and attenuation and random corrections. Present developments mentioned are noise reduction through time-of-flight-assisted tomography and signal to noise improvements through high intrinsic resolution. Extensive bibliography. (U.K.)

  2. Portable generator-based X RF instrument for non-destructive analysis at crime scenes

    International Nuclear Information System (INIS)

    Schweitzer, Jeffrey S.; Trombka, Jacob I.; Floyd, Samuel; Selavka, Carl; Zeosky, Gerald; Gahn, Norman; McClanahan, Timothy; Burbine, Thomas

    2005-01-01

    Unattended and remote detection systems find applications in space exploration, telemedicine, teleforensics, homeland security and nuclear non-proliferation programs. The National Institute of Justice (NIJ) and the National Aeronautics and Space Administration's (NASA) Goddard Space Flight Center (GSFC) have teamed up to explore the use of NASA developed technologies to help criminal justice agencies and professionals investigate crimes. The objective of the program is to produce instruments and communication networks that have application within both NASA's space program and NIJ, together with state and local forensic laboratories. A general-purpose X-ray fluorescence system has been built for non-destructive analyses of trace and invisible material at crime scenes. This portable instrument is based on a generator that can operate to 60 kV and a Schottky CdTe detector. The instrument has been shown to be successful for the analysis of gunshot residue and a number of bodily fluids at crime scenes

  3. Flux Gain for Next-Generation Neutron-Scattering Instruments Resulting From Improved Supermirror Performance

    International Nuclear Information System (INIS)

    Rehm, C.

    2001-01-01

    Next-generation spallation neutron source facilities will offer instruments with unprecedented capabilities through simultaneous enhancement of source power and usage of advanced optical components. The Spallation Neutron Source (SNS), already under construction at Oak Ridge National Laboratory and scheduled to be completed by 2006, will provide greater than an order of magnitude more effective source flux than current state-of-the-art facilities, including the most advanced research reactors. An additional order of magnitude gain is expected through the use of new optical devices and instrumentation concepts. Many instrument designs require supermirror (SM) neutron guides with very high critical angles for total reflection. In this contribution, they discuss how the performance of modern neutron scattering instruments depends on the efficiency of these supermirrors. They outline ideas for enhancing the performance of the SM coatings, particularly for improving the reflectivity at the position of the critical wave vector transfer. A simulation program has been developed which allows different approaches for SM designs to be studied. Possible instrument performance gains are calculated for the example of the SNS reflectometer

  4. Instrumentation

    Energy Technology Data Exchange (ETDEWEB)

    None

    1973-07-01

    Developments discussed include a transistorized- power supply for the Beckman DU spectrophotometer, a master clock pulse generator, a modular printing unit, a flash photolysis setup, a glove box assembly for a Perkin-Elmer infrared spectrophotometer, and a Faraday balance for measuring the magnetic susceptibilities of actinide compounds. (WHK)

  5. Design of analytical instrumentation with D-T sealed neutron generators

    International Nuclear Information System (INIS)

    Qiao Yahua; Wu Jizong; Zheng Weiming; Liu Quanwei; Zhang Min

    2008-01-01

    Analytical instrumentation with D-T sealed neutron generators source activation, The 14 MeV D-T sealed neutron tube with 10 9 n · s -1 neutron yield is used as generator source. The optimal structure of moderator and shield was achieved by MC computing.The instrumentation's configuration is showed. The instrumentation is made up of the SMY-DT50.8-2.1 sealed neutron tube and the high-voltage power supply system, which center is the sealed neutron generators. 6 cm Pb and 20 cm polythene is chosen as moderator, Pb, polythene and 10 cm boron-PE was chosen as shield .The sample box is far the source from 9 cm, the measurement system were made up of HPGe detector and the sample transforming system. After moderator and shield, the thermal neutron fluence rate at the point of sample is 0.93 × 10 6 n · s -1 cm -2 , which is accorded with design demand, and the laboratory and surroundings reaches the safety standard of the dose levels. (authors)

  6. Designing Successful Next-Generation Instruments to Detect the Epoch of Reionization

    Science.gov (United States)

    Thyagarajan, Nithyanandan; Hydrogen Epoch of Reionization Array (HERA) team, Murchison Widefield Array (MWA) team

    2018-01-01

    The Epoch of Reionization (EoR) signifies a period of intense evolution of the Inter-Galactic Medium (IGM) in the early Universe caused by the first generations of stars and galaxies, wherein they turned the neutral IGM to be completely ionized by redshift ≥ 6. This important epoch is poorly explored to date. Measurement of redshifted 21 cm line from neutral Hydrogen during the EoR is promising to provide the most direct constraints of this epoch. Ongoing experiments to detect redshifted 21 cm power spectrum during reionization, including the Murchison Widefield Array (MWA), Precision Array for Probing the Epoch of Reionization (PAPER), and the Low Frequency Array (LOFAR), appear to be severely affected by bright foregrounds and unaccounted instrumental systematics. For example, the spectral structure introduced by wide-field effects, aperture shapes and angular power patterns of the antennas, electrical and geometrical reflections in the antennas and electrical paths, and antenna position errors can be major limiting factors. These mimic the 21 cm signal and severely degrade the instrument performance. It is imperative for the next-generation of experiments to eliminate these systematics at their source via robust instrument design. I will discuss a generic framework to set cosmologically motivated antenna performance specifications and design strategies using the Precision Radio Interferometry Simulator (PRISim) -- a high-precision tool that I have developed for simulations of foregrounds and the instrument transfer function intended primarily for 21 cm EoR studies, but also broadly applicable to interferometer-based intensity mapping experiments. The Hydrogen Epoch of Reionization Array (HERA), designed in-part based on this framework, is expected to detect the 21 cm signal with high significance. I will present this framework and the simulations, and their potential for designing upcoming radio instruments such as HERA and the Square Kilometre Array (SKA).

  7. PKS 2005-489 at VHE: four years of monitoring with HESS and simultaneous multi-wavelength observations

    Science.gov (United States)

    H.E.S.S. Collaboration; Acero, F.; Aharonian, F.; Akhperjanian, A. G.; Anton, G.; Barres de Almeida, U.; Bazer-Bachi, A. R.; Becherini, Y.; Behera, B.; Benbow, W.; Bernlöhr, K.; Bochow, A.; Boisson, C.; Bolmont, J.; Borrel, V.; Brucker, J.; Brun, F.; Brun, P.; Bühler, R.; Bulik, T.; Büsching, I.; Boutelier, T.; Chadwick, P. M.; Charbonnier, A.; Chaves, R. C. G.; Cheesebrough, A.; Chounet, L.-M.; Clapson, A. C.; Coignet, G.; Costamante, L.; Dalton, M.; Daniel, M. K.; Davids, I. D.; Degrange, B.; Deil, C.; Dickinson, H. J.; Djannati-Ataï, A.; Domainko, W.; O'C. Drury, L.; Dubois, F.; Dubus, G.; Dyks, J.; Dyrda, M.; Egberts, K.; Eger, P.; Espigat, P.; Fallon, L.; Farnier, C.; Fegan, S.; Feinstein, F.; Fiasson, A.; Förster, A.; Fontaine, G.; Füßling, M.; Gabici, S.; Gallant, Y. A.; Gérard, L.; Gerbig, D.; Giebels, B.; Glicenstein, J. F.; Glück, B.; Goret, P.; Göring, D.; Hauser, M.; Heinz, S.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hoffmann, A.; Hofmann, W.; Hofverberg, P.; Holleran, M.; Hoppe, S.; Horns, D.; Jacholkowska, A.; de Jager, O. C.; Jahn, C.; Jung, I.; Katarzyński, K.; Katz, U.; Kaufmann, S.; Kerschhaggl, M.; Khangulyan, D.; Khélifi, B.; Keogh, D.; Klochkov, D.; Kluźniak, W.; Kneiske, T.; Komin, Nu.; Kosack, K.; Kossakowski, R.; Lamanna, G.; Lenain, J.-P.; Lohse, T.; Marandon, V.; Martineau-Huynh, O.; Marcowith, A.; Masbou, J.; Maurin, D.; McComb, T. J. L.; Medina, M. C.; Méhault, J.; Moderski, R.; Moulin, E.; Naumann-Godo, M.; de Naurois, M.; Nedbal, D.; Nekrassov, D.; Nicholas, B.; Niemiec, J.; Nolan, S. J.; Ohm, S.; Olive, J.-F.; de Oña Wilhelmi, E.; Orford, K. J.; Ostrowski, M.; Panter, M.; Paz Arribas, M.; Pedaletti, G.; Pelletier, G.; Petrucci, P.-O.; Pita, S.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raubenheimer, B. C.; Raue, M.; Rayner, S. M.; Renaud, M.; Rieger, F.; Ripken, J.; Rob, L.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Ruppel, J.; Sahakian, V.; Santangelo, A.; Schlickeiser, R.; Schöck, F. M.; Schwanke, U.; Schwarzburg, S.; Schwemmer, S.; Shalchi, A.; Sikora, M.; Skilton, J. L.; Sol, H.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Superina, G.; Szostek, A.; Tam, P. H.; Tavernet, J.-P.; Terrier, R.; Tibolla, O.; Tluczykont, M.; van Eldik, C.; Vasileiadis, G.; Venter, C.; Venter, L.; Vialle, J. P.; Vincent, P.; Vivier, M.; Völk, H. J.; Volpe, F.; Wagner, S. J.; Ward, M.; Zdziarski, A. A.; Zech, A.

    2010-02-01

    Aims: Our aim is to study the very high energy (VHE; E>100 GeV) γ-ray emission from BL Lac objects and the evolution in time of their broad-band spectral energy distribution (SED). Methods: VHE observations of the high-frequency peaked BL Lac object PKS 2005-489 were made with the High Energy Stereoscopic System (HESS) from 2004 through 2007. Three simultaneous multi-wavelength campaigns at lower energies were performed during the HESS data taking, consisting of several individual pointings with the XMM-Newton and RXTE satellites. Results: A strong VHE signal, ~17σ total, from PKS 2005-489 was detected during the four years of HESS observations (90.3 h live time). The integral flux above the average analysis threshold of 400 GeV is ~3% of the flux observed from the Crab Nebula and varies weakly on time scales from days to years. The average VHE spectrum measured from ~300 GeV to ~5 TeV is characterized by a power law with a photon index, Γ = 3.20± 0.16_stat± 0.10_syst. At X-ray energies the flux is observed to vary by more than an order of magnitude between 2004 and 2005. Strong changes in the X-ray spectrum (ΔΓX ≈ 0.7) are also observed, which appear to be mirrored in the VHE band. Conclusions: The SED of PKS 2005-489, constructed for the first time with contemporaneous data on both humps, shows significant evolution. The large flux variations in the X-ray band, coupled with weak or no variations in the VHE band and a similar spectral behavior, suggest the emergence of a new, separate, harder emission component in September 2005. Supported by CAPES Foundation, Ministry of Education of Brazil.Now at Harvard-Smithsonian Center for Astrophysics, Cambridge, USA.Now at W.W. Hansen Experimental Physics Laboratory & Kavli Institute for Particle Astrophysics and Cosmology, Stanford University, Stanford, USA.

  8. Meteosat third generation imager: simulation of the flexible combined imager instrument chain

    Science.gov (United States)

    Just, Dieter; Gutiérrez, Rebeca; Roveda, Fausto; Steenbergen, Theo

    2014-10-01

    The Meteosat Third Generation (MTG) Programme is the next generation of European geostationary meteorological systems. The first MTG satellite, MTG-I1, which is scheduled for launch at the end of 2018, will host two imaging instruments: the Flexible Combined Imager (FCI) and the Lightning Imager. The FCI will provide continuation of the SEVIRI imager operations on the current Meteosat Second Generation satellites (MSG), but with an improved spatial, temporal and spectral resolution, not dissimilar to GOES-R (of NASA/NOAA). Unlike SEVIRI on the spinning MSG spacecraft, the FCI will be mounted on a 3-axis stabilised platform and a 2-axis tapered scan will provide a full coverage of the Earth in 10 minute repeat cycles. Alternatively, a rapid scanning mode can cover smaller areas, but with a better temporal resolution of up to 2.5 minutes. In order to assess some of the data acquisition and processing aspects which will apply to the FCI, a simplified end-to-end imaging chain prototype was set up. The simulation prototype consists of four different functional blocks: - A function for the generation of FCI-like references images - An image acquisition simulation function for the FCI Line-of-Sight calculation and swath generation - A processing function that reverses the swath generation process by rectifying the swath data - An evaluation function for assessing the quality of the processed data with respect to the reference images This paper presents an overview of the FCI instrument chain prototype, covering instrument characteristics, reference image generation, image acquisition simulation, and processing aspects. In particular, it provides in detail the description of the generation of references images, highlighting innovative features, but also limitations. This is followed by a description of the image acquisition simulation process, and the rectification and evaluation function. The latter two are described in more detail in a separate paper. Finally, results

  9. Quickly Getting the Best Data from Your Macromolecular Crystals with a New Generation of Beamline Instruments

    International Nuclear Information System (INIS)

    Cipriani, Florent; Felisaz, Franck; Lavault, Bernard; Brockhauser, Sandor; Ravelli, Raimond; Launer, Ludovic; Leonard, Gordon; Renier, Michel

    2007-01-01

    While routine Macromolecular x-ray (MX) crystallography has relied on well established techniques for some years all the synchrotrons around the world are improving the throughput of their MX beamlines. Third generation synchrotrons provide small intense beams that make data collection of 5-10 microns sized crystals possible. The EMBL/ESRF MX Group in Grenoble has developed a new generation of instruments to easily collect data on 10 μm size crystals in an automated environment. This work is part of the Grenoble automation program that enables FedEx like crystallography using fully automated data collection and web monitored experiments. Seven ESRF beamlines and the MRC BM14 ESRF/CRG beamline are currently equipped with these latest instruments. We describe here the main features of the MD2x diffractometer family and the SC3 sample changer robot. Although the SC3 was primarily designed to increase the throughput of MX beamlines, it has also been shown to be efficient in improving the quality of the data collected. Strategies in screening a large number of crystals, selecting the best, and collecting a full data set from several re-oriented micro-crystals can now be run with minimum time and effort. The MD2x and SC3 instruments are now commercialised by the company ACCEL GmbH

  10. Generation of on-line test signals for nuclear instrumentation for PFBR

    International Nuclear Information System (INIS)

    Ram, Rajit; Bhatnagar, P.V.; Rajesh, M.G.; Das, Debashis

    2010-01-01

    Neutron flux monitoring system for PFBR employs pulse signal processing in start up and intermediate power range of reactor operation and Campbell signal processing in intermediate and full power range of reactor operation. Pulse signal processing unit as well as Campbell signal processing unit incorporates FPGA that generates pulse/white noise signal for on-line testing and diagnostic of the channels. In pulse channel fixed/linearly/exponentially varying pulse rate signal is generated over three decades of reactor operation. In the Campbell channel, Poisson distributed noise varying linearly/exponentially is generated over four decades of reactor operation. Multiple numbers of Poisson distributed random pulse trains are summed and amplified to get the white noise signal. Exponentially increasing gain pattern, generated by MATLAB is used to increase the RMS value of the generated noise. The paper discuses the successful testing and validation of pulse and Campbell channel by making use of the generated pulse/white noise signal over wide range of operation for nuclear instrumentation. (author)

  11. Detection of variable VHE γ-ray emission from the extra-galactic γ-ray binary LMC P3

    Science.gov (United States)

    HESS Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Ait Benkhali, F.; Angüner, E. O.; Arakawa, M.; Armand, C.; Arrieta, M.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Becker Tjus, J.; Berge, D.; Bernhard, S.; Bernlöhr, K.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bonnefoy, S.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Büchele, M.; Bulik, T.; Capasso, M.; Caroff, S.; Carosi, A.; Casanova, S.; Cerruti, M.; Chakraborty, N.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Colafrancesco, S.; Condon, B.; Conrad, J.; Davids, I. D.; Decock, J.; Deil, C.; Devin, J.; deWilt, P.; Dirson, L.; Djannati-Ataï, A.; Donath, A.; Drury, L. O.'C.; Dyks, J.; Edwards, T.; Egberts, K.; Emery, G.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Funk, S.; Füßling, M.; Gabici, S.; Gallant, Y. A.; Garrigoux, T.; Gaté, F.; Giavitto, G.; Glawion, D.; Glicenstein, J. F.; Gottschall, D.; Grondin, M.-H.; Hahn, J.; Haupt, M.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holch, T. L.; Holler, M.; Horns, D.; Ivascenko, A.; Iwasaki, H.; Jacholkowska, A.; Jamrozy, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katsuragawa, M.; Katz, U.; Kerszberg, D.; Khangulyan, D.; Khélifi, B.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Komin, Nu.; Kosack, K.; Krakau, S.; Kraus, M.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lefaucheur, J.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; López-Coto, R.; Lypova, I.; Malyshev, D.; Marandon, V.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Mohrmann, L.; Morå, K.; Moulin, E.; Murach, T.; Nakashima, S.; de Naurois, M.; Ndiyavala, H.; Niederwanger, F.; Niemiec, J.; Oakes, L.; O'Brien, P.; Odaka, H.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Pekeur, N. W.; Pelletier, G.; Perennes, C.; Petrucci, P.-O.; Peyaud, B.; Piel, Q.; Pita, S.; Poireau, V.; Prokhorov, D. A.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Rauth, R.; Reimer, A.; Reimer, O.; Renaud, M.; de los Reyes, R.; Rieger, F.; Rinchiuso, L.; Romoli, C.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Saito, S.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Seglar-Arroyo, M.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Shiningayamwe, K.; Simoni, R.; Sol, H.; Spanier, F.; Spir-Jacob, M.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Steppa, C.; Sushch, I.; Takahashi, T.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tibaldo, L.; Tiziani, D.; Tluczykont, M.; Trichard, C.; Tsirou, M.; Tsuji, N.; Tuffs, R.; Uchiyama, Y.; van der Walt, D. J.; van Eldik, C.; van Rensburg, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zaborov, D.; Zacharias, M.; Zanin, R.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Zorn, J.; Żywucka, N.

    2018-03-01

    Context. Recently, the high-energy (HE, 0.1-100 GeV) γ-ray emission from the object LMC P3 in the Large Magellanic Cloud (LMC) has been discovered to be modulated with a 10.3-day period, making it the first extra-galactic γ-ray binary. Aim. This work aims at the detection of very-high-energy (VHE, >100 GeV) γ-ray emission and the search for modulation of the VHE signal with the orbital period of the binary system. Methods: LMC P3 has been observed with the High Energy Stereoscopic System (H.E.S.S.); the acceptance-corrected exposure time is 100 h. The data set has been folded with the known orbital period of the system in order to test for variability of the emission. Results: VHE γ-ray emission is detected with a statistical significance of 6.4 σ. The data clearly show variability which is phase-locked to the orbital period of the system. Periodicity cannot be deduced from the H.E.S.S. data set alone. The orbit-averaged luminosity in the 1-10 TeV energy range is (1.4 ± 0.2) × 1035 erg s-1. A luminosity of (5 ± 1) × 1035 erg s-1 is reached during 20% of the orbit. HE and VHE γ-ray emissions are anti-correlated. LMC P3 is the most luminous γ-ray binary known so far.

  12. Portable generator-based X RF instrument for non-destructive analysis at crime scenes

    Energy Technology Data Exchange (ETDEWEB)

    Schweitzer, Jeffrey S. [University of Connecticut, Department of Physics, Unit 3046 Storrs, CT 06269-3046 (United States)]. E-mail: schweitz@phys.uconn.edu; Trombka, Jacob I. [Goddard Space Flight Center, Code 691, Greenbelt Road, Greenbelt, MD 20771 (United States); Floyd, Samuel [Goddard Space Flight Center, Code 691, Greenbelt Road, Greenbelt, MD 20771 (United States); Selavka, Carl [Massachusetts State Police Crime Laboratory, 59 Horse Pond Road, Sudbury, MA 01776 (United States); Zeosky, Gerald [Forensic Investigation Center, Crime Laboratory Building, 22 State Campus, Albany, NY 12226 (United States); Gahn, Norman [Assistant District Attorney, Milwaukee County, District Attorney' s Office, 821 West State Street, Milwaukee, WI 53233-1427 (United States); McClanahan, Timothy [Goddard Space Flight Center, Code 691, Greenbelt Road, Greenbelt, MD 20771 (United States); Burbine, Thomas [Goddard Space Flight Center, Code 691, Greenbelt Road, Greenbelt, MD 20771 (United States)

    2005-12-15

    Unattended and remote detection systems find applications in space exploration, telemedicine, teleforensics, homeland security and nuclear non-proliferation programs. The National Institute of Justice (NIJ) and the National Aeronautics and Space Administration's (NASA) Goddard Space Flight Center (GSFC) have teamed up to explore the use of NASA developed technologies to help criminal justice agencies and professionals investigate crimes. The objective of the program is to produce instruments and communication networks that have application within both NASA's space program and NIJ, together with state and local forensic laboratories. A general-purpose X-ray fluorescence system has been built for non-destructive analyses of trace and invisible material at crime scenes. This portable instrument is based on a generator that can operate to 60 kV and a Schottky CdTe detector. The instrument has been shown to be successful for the analysis of gunshot residue and a number of bodily fluids at crime scenes.

  13. Design requirements of instrumentation and control systems for next generation reactor

    International Nuclear Information System (INIS)

    Koo, In Soo; Lee, Byung Sun; Park, Kwang Hyun; Park, Heu Yoon; Lee, Dong Young; Kim, Jung Taek; Hwang, In Koo; Chung, Chul Hwan; Hur, Seop; Kim, Chang Hoi; Na, Nan Ju

    1994-03-01

    In this report, the basic design requirements of Instrumentation and Control systems for next generation reactor are described, which are top-tier level, to support the advanced I and C systems. It contains the requirements in accordance with the plant reliability, the plant performance, the operator's aid functions, the features for maintenance and testing, licensing issues for I and C systems. Advanced I and C systems are characterized such as the application of the digital and the human engineering technologies. To development of this requirements, the I and C systems for the foreign passive and the evolutionary types of reactor and the domestic conventional reators were reviewed and anlysed. At the detail design stage, these requirements will be used for top-tier requirements. To develop the detail design requirements in the future, more quantitive and qualitive analyses are need to be added. (Author) 44 refs

  14. [Research on fractal tones generating method for tinnitus rehabilitation based on musical instrument digital interface technology].

    Science.gov (United States)

    Wang, Lu; He, Peiyu; Pan, Fan

    2014-08-01

    Tinnitus is a subjective sensation of sound without external stimulation. It has become ubiquitous and has therefore aroused much attention in recent years. According to the survey, ameliorating tinnitus based on special music and reducing pressure have good effects on the treatment of it. Meantime, vicious cycle chains between tinnitus and bad feelings have been broken. However, tinnitus therapy has been restricted by using looping music. Therefore, a method of generating fractal tones based on musical instrument digital interface (MIDI) technology and pink noise has been proposed in this paper. The experimental results showed that the fractal fragments were self-similar, incompletely reduplicate, and no sudden changes in pitches and would have a referential significance for tinnitus therapy.

  15. Design requirements of instrumentation and control systems for next generation reactor

    Energy Technology Data Exchange (ETDEWEB)

    Koo, In Soo; Lee, Byung Sun; Park, Kwang Hyun; Park, Heu Yoon; Lee, Dong Young; Kim, Jung Taek; Hwang, In Koo; Chung, Chul Hwan; Hur, Seop; Kim, Chang Hoi; Na, Nan Ju [Korea Atomic Energy Research Institute, Taejon (Korea, Republic of)

    1994-03-01

    In this report, the basic design requirements of Instrumentation and Control systems for next generation reactor are described, which are top-tier level, to support the advanced I and C systems. It contains the requirements in accordance with the plant reliability, the plant performance, the operator`s aid functions, the features for maintenance and testing, licensing issues for I and C systems. Advanced I and C systems are characterized such as the application of the digital and the human engineering technologies. To development of this requirements, the I and C systems for the foreign passive and the evolutionary types of reactor and the domestic conventional reators were reviewed and anlysed. At the detail design stage, these requirements will be used for top-tier requirements. To develop the detail design requirements in the future, more quantitive and qualitive analyses are need to be added. (Author) 44 refs.

  16. POTENTIAL DEFICIENCIES IN EDUCATION, INSTRUMENTATION, AND WARNINGS FOR LOCALLY GENERATED TSUNAMIS

    Directory of Open Access Journals (Sweden)

    Daniel A. Walker

    2010-01-01

    Full Text Available A review of historical data for Hawaii reveals that significant tsunamis have been reported for only four of twenty-six potentially tsunamigenic earthquakes from 1868 through 2009 with magnitudes of 6.0 or greater. During the same time period, three significant tsunamis have been reported for substantially smaller earthquakes. This historical perspective, the fact that the last significant local tsunami occurred in 1975, and an understandable preoccupation with tsunamis generated around the margins of the Pacific, all combine to suggest apparent deficiencies in: (1 personal awareness of what to do in the event of a possible local tsunami; (2 the distribution of instrumentation capable of providing rapid confirmation that a local tsunami has been generated; and (3 the subsequent issuance of timely warnings for local tsunamis. With these deficiencies, far more lives may be lost in Hawaii due to local tsunamis than will result from tsunamis that have originated along the margins of the Pacific. Similar deficiencies may exist in other areas of the world threatened by local tsunamis.

  17. Qualifying commercial grade instruments for use in nuclear power generating stations

    International Nuclear Information System (INIS)

    Lamothe, R.J.; Scally, C.R.

    1983-01-01

    Nuclear environmental qualification of instrumentation has been successfully accomplished by many commercial grade equipment manufacturers. This paper was prepared as a guide to those manufacturers who want some insight into a qualification program. The areas addressed are the regulations and documents, the qualification program, and a case history of a chart recorder qualifications. The principal standards relating to a nuclear qualification program are IEEE Std. 323-1974 IEEE Standard for Qualifying Class 1E Equipment for Nuclear Power Generating Stations, IEEE Std. 344-1975 IEEE Recommended Practices for Seismic Qualification of Class 1E Equipment for Nuclear Power Generating Stations and 10CFR50.49. Previously NUREG 0588 Interim Staff Position on Environmental Qualification of Safety-Related Equipment. These define the intent and purpose of the qualification. The qualification program itself consists of several distinct parts which require explanation, including the determination of qualified life, choice of test samples, selection of appropriate acceptance criteria, aging program, radiation testing, seismic testing, abnormal environment tests and others. The case history illustrates the qualification program and the thought processes involved

  18. The opto-mechanical design for GMOX: a next-generation instrument concept for Gemini

    Science.gov (United States)

    Smee, Stephen A.; Barkhouser, Robert; Robberto, Massimo; Ninkov, Zoran; Gennaro, Mario; Heckman, Timothy M.

    2016-08-01

    We present the opto-mechanical design of GMOX, the Gemini Multi-Object eXtra-wide-band spectrograph, a potential next-generation (Gen-4 #3) facility-class instrument for Gemini. GMOX is a wide-band, multi-object, spectrograph with spectral coverage spanning 350 nm to 2.4 um with a nominal resolving power of R 5000. Through the use of Digital Micromirror Device (DMD) technology, GMOX will be able to acquire spectra from hundreds of sources simultaneously, offering unparalleled flexibility in target selection. Utilizing this technology, GMOX can rapidly adapt individual slits to either seeing-limited or diffraction-limited conditions. The optical design splits the bandpass into three arms, blue, red, and near infrared, with the near-infrared arm being split into three channels covering the Y+J band, H band, and K band. A slit viewing camera in each arm provides imaging capability for target acquisition and fast-feedback for adaptive optics control with either ALTAIR (Gemini North) or GeMS (Gemini South). Mounted at the Cassegrain focus, GMOX is a large (1.3 m x 2.8 m x 2.0 m) complex instrument, with six dichroics, three DMDs (one per arm), five science cameras, and three acquisition cameras. Roughly half of these optics, including one DMD, operate at cryogenic temperature. To maximize stiffness and simplify assembly and alignment, the opto-mechanics are divided into three main sub-assemblies, including a near-infrared cryostat, each having sub-benches to facilitate ease of alignment and testing of the optics. In this paper we present the conceptual opto-mechanical design of GMOX, with an emphasis on the mounting strategy for the optics and the thermal design details related to the near-infrared cryostat.

  19. A flameless catalytic combustion-based thermoelectric generator for powering electronic instruments on gas pipelines

    International Nuclear Information System (INIS)

    Xiao, Heng; Qiu, Kuanrong; Gou, Xiaolong; Ou, Qiang

    2013-01-01

    Highlights: ► MPPT is used to improve the feature that TEG output is sensitive to load variation. ► The improved feature makes TEG suitable to power electronic device on gas pipeline. ► Test shows heat transfer uniformity plays an important role in improving TEG output. ► It can get an optimized TEG by uniformly filling a thermal insulation material. - Abstract: This paper presents a flameless catalytic combustion-based thermoelectric power generator that uses commercial thermoelectric modules. The structure of the thermoelectric generator (TEG) is introduced and the power performance is measured based on a designed circuit system. The open circuit voltage of the TEG is about 7.3 V. The maximum power output can reach up to 6.5 W when the load resistance matches the TEG internal resistance. However, the system output is sensitive to load variation. To improve this characteristic, maximum power point tracking technique is used and results in an open circuit voltage of 13.8 V. The improved characteristic makes the TEG system a good charger to keep the lead acid battery fully charged so as to meet the needs of electronic instruments on gas pipelines. In addition, the combustion features have been investigated based on the temperature measurement. Test results show that the uniformity of combustion heat transfer process and the combustion chamber structure play important roles in improving system power output. It can get an optimized TEG system (maximum power output: 8.3 W) by uniformly filling a thermal insulation material (asbestos) to avoid a non-uniform combustion heat transfer process

  20. Pressure loss characteristics of LSTF steam generator heat-transfer tubes. Pressure loss increase due to tube internal instruments

    International Nuclear Information System (INIS)

    Suzuki, Mitsuhiro

    1994-11-01

    The steam generator of the Large-Scale Test Facility (LSTF) includes 141 heat-transfer U-tubes with different lengths. Six U-tubes among them are furnished with 15 or 17 probe-type instruments (conduction probe with a thermocouple; CPT) protuberant into the primary side of the U-tubes. Other 135 U-tubes are not instrumented. This results in different hydraulic conditions between the instrumented and non-instrumented U-tubes with the same length. A series of pressure loss characteristics tests was conducted at a test apparatus simulating both types of U-tube. The following pressure loss coefficient (K CPT ) was reduced as a function of Reynolds number (Re) from these tests under single-phase water flow conditions. K CPT =0.16 5600≤Re≤52820, K CPT =60.66xRe -0.688 2420≤Re≤5600, K CPT =2.664x10 6 Re -2.06 1371≤Re≤2420. The maximum uncertainty is 22%. By using these results, the total pressure loss coefficients of full length U-tubes were estimated. It is clarified that the total pressure loss of the shortest instrumented U-tube is equivalent to that of the middle-length non-instrumented U-tube and also that a middle-length instrumented U-tube is equivalent to the longest non-instrumented U-tube. Concludingly. it is important to take account of the CPT pressure loss mentioned above in estimation of fluid behavior at the non-instrumented U-tubes either by using the LSTF experiment data from the CPT-installed U-tubes or by using any analytical codes. (author)

  1. PC-based analog signal generator for simulated detector signals and arbitrary test waveforms for testing the nuclear instruments

    International Nuclear Information System (INIS)

    Catanescu, V.

    1999-01-01

    This work is performed in cooperation with IAEA-Vienna as a project, proposed as part of Agency's C o-ordinated Research Programme of Development of Computer-based Troubleshooting Tools and Instruments. A convenient way for testing and calibrating modern scientific equipment is to connect the test instruments to a personal computer to get additional feasibilities. This way, all settings for test, measurement and data acquisition functions are done by means of PC and are controlled by software drivers. This multifunctional spectrometric pulse generator is able to characterize different parts of high-resolution nuclear spectroscopy chain (preamplifier, amplifier, analog to digital converter, multichannel analyzer) as well as the whole chain. For this it generates periodic or random pulses with shape, time and amplitude specifications controlled by PC. Characteristics such as integral linearity, differential linearity, dead time, rate channel shifting and others will be easily determined. The block diagram of the multifunctional spectrometric generator is shown. The main sections are: PC-interface, control registers and command generation; PC-controlled periodic and random logic pulse oscillators; PC-controlled delay and width of periodic or random logic pulses; constant and ultra-linear ramp references for spectrometric pulse generation; generation of the tail and flat top pulses with PC-controlled amplitude and decay time; semi-gaussian pulse generation, polarity inverter and output amplifier. The specifications for generated signal correspond to: shape, time specifications and amplitude size. (author)

  2. Generation of Long-time Complex Signals for Testing the Instruments for Detection of Voltage Quality Disturbances

    Science.gov (United States)

    Živanović, Dragan; Simić, Milan; Kokolanski, Zivko; Denić, Dragan; Dimcev, Vladimir

    2018-04-01

    Software supported procedure for generation of long-time complex test sentences, suitable for testing the instruments for detection of standard voltage quality (VQ) disturbances is presented in this paper. This solution for test signal generation includes significant improvements of computer-based signal generator presented and described in the previously published paper [1]. The generator is based on virtual instrumentation software for defining the basic signal parameters, data acquisition card NI 6343, and power amplifier for amplification of output voltage level to the nominal RMS voltage value of 230 V. Definition of basic signal parameters in LabVIEW application software is supported using Script files, which allows simple repetition of specific test signals and combination of more different test sequences in the complex composite test waveform. The basic advantage of this generator compared to the similar solutions for signal generation is the possibility for long-time test sequence generation according to predefined complex test scenarios, including various combinations of VQ disturbances defined in accordance with the European standard EN50160. Experimental verification of the presented signal generator capability is performed by testing the commercial power quality analyzer Fluke 435 Series II. In this paper are shown some characteristic complex test signals with various disturbances and logged data obtained from the tested power quality analyzer.

  3. Characterising the VHE diffuse emission in the central 200 parsecs of our Galaxy with H.E.S.S.

    Science.gov (United States)

    H.E.S.S. Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Ait Benkhali, F.; Akhperjanian, A. G.; Andersson, T.; Angüner, E. O.; Arakawa, M.; Arrieta, M.; Aubert, P.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Becker Tjus, J.; Berge, D.; Bernhard, S.; Bernlöhr, K.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bonnefoy, S.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Büchele, M.; Bulik, T.; Capasso, M.; Carr, J.; Casanova, S.; Cerruti, M.; Chakraborty, N.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Coffaro, M.; Colafrancesco, S.; Cologna, G.; Condon, B.; Conrad, J.; Cui, Y.; Davids, I. D.; Decock, J.; Degrange, B.; Deil, C.; Devin, J.; deWilt, P.; Dirson, L.; Djannati-Ataï, A.; Domainko, W.; Donath, A.; Drury, L. O.'C.; Dutson, K.; Dyks, J.; Edwards, T.; Egberts, K.; Eger, P.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Förster, A.; Funk, S.; Füßling, M.; Gabici, S.; Gallant, Y. A.; Garrigoux, T.; Giavitto, G.; Giebels, B.; Glicenstein, J. F.; Gottschall, D.; Goyal, A.; Grondin, M.-H.; Hahn, J.; Haupt, M.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holch, T. L.; Holler, M.; Horns, D.; Ivascenko, A.; Iwasaki, H.; Jacholkowska, A.; Jamrozy, M.; Janiak, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jogler, T.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katsuragawa, M.; Katz, U.; Kerszberg, D.; Khangulyan, D.; Khélifi, B.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Kolitzus, D.; Komin, Nu.; Kosack, K.; Krakau, S.; Kraus, M.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lees, J.-P.; Lefaucheur, J.; Lefranc, V.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; López-Coto, R.; Lypova, I.; Marandon, V.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Mohrmann, L.; Morå, K.; Moulin, E.; Murach, T.; Nakashima, S.; de Naurois, M.; Niederwanger, F.; Niemiec, J.; Oakes, L.; O'Brien, P.; Odaka, H.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Pekeur, N. W.; Pelletier, G.; Perennes, C.; Petrucci, P.-O.; Peyaud, B.; Piel, Q.; Pita, S.; Poon, H.; Prokhorov, D.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Rauth, R.; Reimer, A.; Reimer, O.; Renaud, M.; de los Reyes, R.; Richter, S.; Rieger, F.; Romoli, C.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Saito, S.; Salek, D.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Seglar-Arroyo, M.; Settimo, M.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Simoni, R.; Sol, H.; Spanier, F.; Spengler, G.; Spies, F.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stycz, K.; Sushch, I.; Takahashi, T.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tibaldo, L.; Tiziani, D.; Tluczykont, M.; Trichard, C.; Tsuji, N.; Tuffs, R.; Uchiyama, Y.; van der Walt, D. J.; van Eldik, C.; van Rensburg, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zaborov, D.; Zacharias, M.; Zanin, R.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Żywucka, N.

    2018-04-01

    The diffuse very high-energy (VHE; >100 GeV) γ-ray emission observed in the central 200 pc of the Milky Way by H.E.S.S. was found to follow dense matter distribution in the central molecular zone (CMZ) up to a longitudinal distance of about 130 pc to the Galactic centre (GC), where the flux rapidly decreases. This was initially interpreted as the result of a burst-like injection of energetic particles 104 yr ago, but a recent more sensitive H.E.S.S. analysis revealed that the cosmic-ray (CR) density profile drops with the distance to the centre, making data compatible with a steady cosmic PeVatron at the GC. In this paper, we extend this analysis to obtain, for the first time, a detailed characterisation of the correlation with matter and to search for additional features and individual γ-ray sources in the inner 200 pc. Taking advantage of 250 h of H.E.S.S. data and improved analysis techniques, we perform a detailed morphology study of the diffuse VHE emission observed from the GC ridge and reconstruct its total spectrum. To test the various contributions to the total γ-ray emission, we used an iterative 2D maximum-likelihood approach that allows us to build a phenomenological model of the emission by summing a number of different spatial components. We show that the emission correlated with dense matter covers the full CMZ and that its flux is about half the total diffuse emission flux. We also detect some emission at higher latitude that is likely produced by hadronic collisions of CRs in less dense regions of the GC interstellar medium. We detect an additional emission component centred on the GC and extending over about 15 pc that is consistent with the existence of a strong CR density gradient and confirms the presence of a CR accelerator at the very centre of our Galaxy. We show that the spectrum of full ridge diffuse emission is compatible with that previously derived from the central regions, suggesting that a single population of particles fills the

  4. Electronic constant current and current pulse signal generator for nuclear instrumentation testing

    International Nuclear Information System (INIS)

    Brown, R.A.

    1994-01-01

    Circuitry is described for testing the ability of an intermediate range nuclear instrument to detect and measure a constant current and a periodic current pulse. The invention simulates the resistance and capacitance of the signal connection of a nuclear instrument ion chamber detector and interconnecting cable. An LED flasher/oscillator illuminates an LED at a periodic rate established by a timing capacitor and circuitry internal to the flasher/oscillator. When the LED is on, a periodic current pulse is applied to the instrument. When the LED is off, a constant current is applied. An inductor opposes battery current flow when the LED is on. 1 figures

  5. Fault-tolerant NAND-flash memory module for next-generation scientific instruments

    Science.gov (United States)

    Lange, Tobias; Michel, Holger; Fiethe, Björn; Michalik, Harald; Walter, Dietmar

    2015-10-01

    Remote sensing instruments on today's space missions deliver a high amount of data which is typically evaluated on ground. Especially for deep space missions the telemetry downlink is very limited which creates the need for the scientific evaluation and thereby a reduction of data volume already on-board the spacecraft. A demanding example is the Polarimetric and Helioseismic Imager (PHI) instrument on Solar Orbiter. To enable on-board offline processing for data reduction, the instrument has to be equipped with a high capacity memory module. The module is based on non-volatile NAND-Flash technology, which requires more advanced operation than volatile DRAM. Unlike classical mass memories, the module is integrated into the instrument and allows readback of data for processing. The architecture and safe operation of such kind of memory module is described in the following paper.

  6. Vibration instrumentation of the tubes of the Paluel 1 steam generator no.4. Results of tests

    International Nuclear Information System (INIS)

    Gay, N.; Campistron, R.; Launay, J.

    1985-06-01

    This report gives an overview of the instrumentation and of the measuring unit. Then the different tests carried out as also their exploitation are presented. The results are presented in the lasp part [fr

  7. The 1997 HST Calibration Workshop with a New Generation of Instruments

    Science.gov (United States)

    Casertano, S. (Editor); Jedrzejewski, R. (Editor); Keyes, T. (Editor); Stevens, M. (Editor)

    1997-01-01

    The Second Servicing mission in early 1997 has brought major changes to the Hubble Space Telescope (HST). Two of the original instruments, Faint Object Spectrograph (FOS) and Goddard High Resolution Spectrograph (GHRS), were taken out, and replaced by completely new instruments, the Space Telescope Imaging Spectrograph (STIS) and the Near Infrared Camera Multi-Object Spectrograph (NICMOS). Two new types of detectors were installed, and for the first time, HST gained infrared capabilities. A new Fine Guidance Sensor (FGS) was installed, with an alignment mechanism that could improve substantially both guiding and astrometric capabilities. With all these changes come new challenges. The characterization of the new instruments has required a major effort, both by their respective Investigation Definition Teams and at the Space Telescope Science Institute. All necessary final calibrations for the retired spectrographs needed to be carried out, and their properties definitively characterized. At the same time, work has continued to improve our understanding of the instruments that have remained on board. The results of these activities were discussed in the 1997 HST (Hubble Space Telescope) Calibration Workshop. The main focus of the Workshop was to provide users with the tools and the understanding they need to use HST's instruments and archival data to the best of their possibilities. This book contains the written record of the Workshop. As such, it should provide a valuable tool to all interested in using existing HST data or in proposing for new observations.

  8. Seismic qualification of safety-related instrumentation cabinets for nuclear generating stations

    International Nuclear Information System (INIS)

    Sauve, R.G.; Bell, R.P.; Cuttler, J.M.

    1979-06-01

    The problem of seismically qualifying different electrical instruments mounted in cabinets of a standard design is discussed and the following economical approach is described in detail. An analytical model of the cabinet structure is developed and validated by comparison with the results of shake table tests on a prototype cabinet. Modal analysis is then used to calculate the input spectra for shake table tests to qualify the individual instruments that are mounted at the required elevations in the cabinet. The worst input spectrum, appropriate to qualify each instrument, is then specified to the suppliers. This approach avoids the need to test each cabinet configuration in an assembled state in order to qualify it. (auth)

  9. Risk management in power generation and trading planning with financial instruments; Risikomanagement fuer Stromerzeugungs- und Handelsunternehmen mit Finanzinstrumenten

    Energy Technology Data Exchange (ETDEWEB)

    Blaesig, B.; Huebner, M.; Hinueber, G.; Haubrich, H.J. [Technische Hochschule Aachen (Germany). Lehrstuhl und Inst. fuer Elektrische Anlagen und Energiewirtschaft

    2006-04-15

    Volatile prices in the electric power trade and varying customers' acceptance increasingly set the companies under competitive pressure and cause planning uncertainties on the producer side. In order to justice to the changed requirements in the energy economy, new methods for a systematic risk management must be developed within planning. On the basis of power generation planning and a commercial planning the authors of the contribution under consideration report on the development of a risk management with financial instruments.

  10. Extended VHE γ-ray emission towards SGR1806-20, LBV 1806-20, and stellar cluster Cl* 1806-20

    Science.gov (United States)

    H.E.S.S. Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Ait Benkhali, F.; Akhperjanian, A. G.; Angüner, E. O.; Arrieta, M.; Aubert, P.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Becker Tjus, J.; Berge, D.; Bernhard, S.; Bernlöhr, K.; Birsin, E.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Bulik, T.; Capasso, M.; Carr, J.; Casanova, S.; Chakraborty, N.; Chalme-Calvet, R.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Chrétien, M.; Colafrancesco, S.; Cologna, G.; Condon, B.; Conrad, J.; Couturier, C.; Cui, Y.; Davids, I. D.; Degrange, B.; Deil, C.; deWilt, P.; Djannati-Ataï, A.; Domainko, W.; Donath, A.; Drury, L. O.'C.; Dubus, G.; Dutson, K.; Dyks, J.; Dyrda, M.; Edwards, T.; Egberts, K.; Eger, P.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Förster, A.; Funk, S.; Füßling, M.; Gabici, S.; Gajdus, M.; Gallant, Y. A.; Garrigoux, T.; Giavitto, G.; Giebels, B.; Glicenstein, J. F.; Gottschall, D.; Goyal, A.; Grondin, M.-H.; Grudzińska, M.; Hadasch, D.; Hahn, J.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hervet, O.; Hillert, A.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holler, M.; Horns, D.; Ivascenko, A.; Jacholkowska, A.; Jamrozy, M.; Janiak, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jogler, T.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katz, U.; Kerszberg, D.; Khélifi, B.; Kieffer, M.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Kolitzus, D.; Komin, Nu.; Kosack, K.; Krakau, S.; Kraus, M.; Krayzel, F.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lees, J.-P.; Lefaucheur, J.; Lefranc, V.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; Lypova, I.; Marandon, V.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Menzler, U.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Morå, K.; Moulin, E.; Murach, T.; de Naurois, M.; Niederwanger, F.; Niemiec, J.; Oakes, L.; Odaka, H.; Öttl, S.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Paz Arribas, M.; Pekeur, N. W.; Pelletier, G.; Petrucci, P.-O.; Peyaud, B.; Pita, S.; Poon, H.; Prokhorov, D.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Reimer, A.; Reimer, O.; Renaud, M.; de Reyes, R.; Rieger, F.; Romoli, C.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Salek, D.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Simoni, R.; Sol, H.; Spanier, F.; Spengler, G.; Spies, F.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Stycz, K.; Sushch, I.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tluczykont, M.; Trichard, C.; Tuffs, R.; van der Walt, J.; van Eldik, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zabalza, V.; Zaborov, D.; Zacharias, M.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Żywucka, N.

    2018-04-01

    Using the High Energy Spectroscopic System (H.E.S.S.) telescopes we have discovered a steady and extended very high-energy (VHE) γ-ray source towards the luminous blue variable candidate LBV 1806-20, massive stellar cluster Cl* 1806-20, and magnetar SGR 1806-20. The new VHE source, HESS J1808-204, was detected at a statistical significance of >6σ (post-trial) with a photon flux normalisation (2.9 ± 0.4stat ± 0.5sys) × 10-13 ph cm-2 s-1 TeV-1 at 1 TeV and a power-law photon index of 2.3 ± 0.2stat ± 0.3sys. The luminosity of this source (0.2 to 10 TeV; scaled to distance d = 8.7 kpc) is LVHE 1.6 × 1034(d/8.7 kpc)2 erg s-1. The VHE γ-ray emission is extended and is well fit by a single Gaussian with statistical standard deviation of 0.095° ± 0.015°. This extension is similar to that of the synchrotron radio nebula G10.0-0.3, which is thought to be powered by LBV 1806-20. The VHE γ-ray luminosity could be provided by the stellar wind luminosity of LBV 1806-20 by itself and/or the massive star members of Cl* 1806-20. Alternatively, magnetic dissipation (e.g. via reconnection) from SGR 1806-20 can potentially account for the VHE luminosity. The origin and hadronic and/or leptonic nature of the accelerated particles responsible for HESS J1808-204 is not yet clear. If associated with SGR 1806-20, the potentially young age of the magnetar (650 yr) can be used to infer the transport limits of these particles to match the VHE source size. This discovery provides new interest in the potential for high-energy particle acceleration from magnetars, massive stars, and/or stellar clusters.

  11. Singer-Loomis TDI : the next generation of psychological type instrument

    Energy Technology Data Exchange (ETDEWEB)

    Dugan, S.; Wilson, K. [Calgary Univ., AB (Canada)

    2001-06-01

    This paper described the Singer-Loomis Type Development Instrument (TDI), a psychological type tool for personal and professional advancement. The key feature of the TDI is that it allows people to develop a better understanding of the challenges they face in interpersonal relationships and in teams. The TDI is also a tool to help learn competencies that will enable people to better align their skills and capacities with future challenges. Two applications of the S-L TDI were presented. Both applications have proven successful with hundreds of MBA and EMBA students. 6 refs.

  12. In-Pile Testing and Instrumentation for Development of Generation-IV Fuels and Materials. Proceedings of a Technical Meeting

    International Nuclear Information System (INIS)

    2013-12-01

    For many years, the increase in efficiency in the production of nuclear electricity has been an economic challenge in many countries which have developed this kind of energy. The increase in fuel burnup and fuel residence time leads to a reduction in the volume of fresh fuel loaded and spent fuel discharged, respectively. More demanding nuclear fuel cycle parameters are combined with a need to operate nuclear power plants with maximal availability and load factors, in load-follow mode and with longer fuel cycles. In meeting these requirements, fuel has to operate in a demanding environment of high radiation fields, high temperatures, high mechanical stresses and high coolant flow. Requirements of increased fuel reliability and minimal fuel failures also remain in force. Under such circumstances, continuous development of more radiation resistant fuel materials, especially advanced cladding, careful and incremental examinations, and improved understanding and modelling of high burnup fuel behaviour are required. Following a recommendation of the IAEA Technical Working Group on Fuel Performance and Technology, the Technical Meeting on In-pile Testing and Instrumentation for Development of Generation-IV Fuels and Materials was held in Halden, Norway, on 21-24 August 2012. The purpose of the meeting was to review the current status and the progress in methods and technologies used for the in-pile testing of nuclear fuel achieved since the previous IAEA meeting on In-core Instrumentation and Reactor Core Assessment, also held in Halden in 2007. Emphasis was placed on advanced techniques applied for the understanding of high burnup fuel behaviour of water cooled power reactors that represent the vast majority of the current nuclear reactor fleet. However, the meeting also included papers and discussion on testing techniques applied or developed specifically for new fuel and structural materials considered for Generation-IV systems. The meeting was attended by 43

  13. Fourth-generation spinal instrumentation: experience with adolescent idiopathic scoliosis at a tertiary care hospital in Pakistan.

    Science.gov (United States)

    Fazal, Akil; Lakdawala, Riaz H

    2012-01-01

    To evaluate the radiological and functional outcome of surgical treatment of adolescent idiopathic scoliosis using fourth-generation posterior spinal instrumentation at The Aga Khan University, Karachi, Pakistan. Case series. The Aga Khan University Hospital after a minimum of 2 years postoperatively. A total of 20 patients with adolescent idiopathic scoliosis were recruited into the study and evaluated for radiological and functional outcome. The study period was from 2000 to 2005. Radiological outcome was assessed using Cobb angle measurement pre and postoperatively, hence assessing percentage correction. The lower instrumented vertebra was taken as the neutral vertebra and the level was recorded. Functional outcome was determined using the Scoliosis Research Society patient administered questionnaire. All patients were called to the clinic and asked to fill in the form. Those patients who were out of the city were mailed the forms and requested via telephone to complete and return. Of the 20 patients operated on, twelve were female and eight were male. The average age at operation was 12.7 years. The mean Cobb angle was 69° preoperatively and 20° postoperatively, representing a percentage correction of 71%. The average duration of follow-up was 3.6 years. There was one major complication involving neurological injury post-op and two minor complications involving wound infection. The average Scoliosis Research Society score (on a scale of 1-5, with 5 being best) for pain was 4.5, self-image was 4.2, functional status was 4.1, mental status was 3.8, and satisfaction was 4.4. There was no relationship between the percentage correction of scoliosis and the functional outcome. Those patients with a high preoperative Cobb angle tended to have a better outcome for functional and mental status postoperatively. There was no relation between the lower instrumented vertebra and functional outcome. In the correct indications, fourth-generation posterior instrumentation

  14. RES-E-NEXT: Next Generation of RES-E Policy Instruments

    Energy Technology Data Exchange (ETDEWEB)

    Miller, M.; Bird, L.; Cochran, J.; Milligan, M.; Bazilian, M. [National Renewable Energy Laboratory, Golden, CO (United States); Denny, E.; Dillon, J.; Bialek, J.; O’Malley, M. [Ecar Limited (Ireland); Neuhoff, K. [DIW Berlin (Germany)

    2013-07-04

    The RES-E-NEXT study identifies policies that are required for the next phase of renewable energy support. The study analyses policy options that secure high shares of renewable electricity generation and adequate grid infrastructure, enhance flexibility and ensure an appropriate market design. Measures have limited costs or even save money, and policies can be gradually implemented.

  15. Fourth-generation spinal instrumentation: experience with adolescent idiopathic scoliosis at a tertiary care hospital in Pakistan

    Directory of Open Access Journals (Sweden)

    Fazal A

    2012-02-01

    Full Text Available Akil Fazal1, Riaz H Lakdawala21Hospital for Joint Disease, New York University, New York, USA; 2Section of Orthopaedics, Department of Surgery, The Aga Khan University Hospital, Karachi, PakistanObjective: To evaluate the radiological and functional outcome of surgical treatment of adolescent idiopathic scoliosis using fourth-generation posterior spinal instrumentation at The Aga Khan University, Karachi, Pakistan.Design: Case series.Place and duration of study: The Aga Khan University Hospital after a minimum of 2 years postoperatively.Patients and methods: A total of 20 patients with adolescent idiopathic scoliosis were recruited into the study and evaluated for radiological and functional outcome. The study period was from 2000 to 2005. Radiological outcome was assessed using Cobb angle measurement pre and postoperatively, hence assessing percentage correction. The lower instrumented vertebra was taken as the neutral vertebra and the level was recorded. Functional outcome was determined using the Scoliosis Research Society patient administered questionnaire. All patients were called to the clinic and asked to fill in the form. Those patients who were out of the city were mailed the forms and requested via telephone to complete and return.Results: Of the 20 patients operated on, twelve were female and eight were male. The average age at operation was 12.7 years. The mean Cobb angle was 69° preoperatively and 20° postoperatively, representing a percentage correction of 71%. The average duration of follow-up was 3.6 years. There was one major complication involving neurological injury post-op and two minor complications involving wound infection. The average Scoliosis Research Society score (on a scale of 1–5, with 5 being best for pain was 4.5, self-image was 4.2, functional status was 4.1, mental status was 3.8, and satisfaction was 4.4. There was no relationship between the percentage correction of scoliosis and the functional outcome

  16. DEVELOPMENT OF NEXT-GENERATION DETECTORS AND INSTRUMENTATION FOR PHOTOELECTRON SPECTROSCOPY, DIFFRACTION AND HOLOGRAPHY

    International Nuclear Information System (INIS)

    Charles S. Fadley, Principal Investigator

    2005-01-01

    We have developed a new multichannel detector for use in photoelectron spectroscopy (as well as other types of high-count-rate spectroscopy) that will operate at rates of up to 1 GHz. Such detectors are crucial to the full utilization of the high-brightness radiation generated by third-generation synchrotron radiation sources. In addition, new software and hardware has been developed to permit rapidly and accurately scanning photoelectron spectra that will be accumulated in as little as a 200 micros. A versatile next-generation sample goniometer permitting equally rapid scanning of specimen angles or photon energies for angle-resolved photoemission studies, photoelectron diffraction, and photoelectron holography measurements, and cooling to below 10K has also been designed and constructed. These capabilities have been incorporated into a unique photoelectron spectrometer/diffractometer at the Advanced Light Source of the Lawrence Berkeley National Laboratory; this experimental system includes ultrahigh energy resolution, in situ rotation, variable polarization, and optional spin detection. This overall system is now being used in studies of a variety of problems including magnetic metals and oxides; metal/metal, metal/metal oxide, and metal-oxide/metal-oxide multilayers; and systems exhibiting giant and colossal magnetoresistance

  17. SMORN-1: thermoelectrically generated noise in sheathed thermocouples and in other low level instrumentation cables

    International Nuclear Information System (INIS)

    Mathieu, F.; Meier, R.; Soenen, M.; Delcon, M.; Nysten, C.

    Starting from the fact that thermoelectric emfs of thermocouples are generated in the thermal gradients and not at the hot junction, it is shown how thermoelectric heterogeneity in conjunction with natural and forced convection phenomena gives rise to unwanted noise called: ''thermoelectric noise'' in the technological sense. A distinction is made between four different types of noise--i.e. uncorrelated noise, correlated noise, spectral noise and thermoelectric noise in the physical sense--each of which has its own characteristics. The experimental results presented reveal that noise amplitudes may be quite embarrassing when dealing with problems of quantitative signal fluctuation analysis. It is however emphasized that thermoelectric noise may also convey useful information which, without noise, might be lost

  18. Beyond Californium-A Neutron Generator Alternative for Dosimetry and Instrument Calibration in the U.S.

    Science.gov (United States)

    Piper, Roman K; Mozhayev, Andrey V; Murphy, Mark K; Thompson, Alan K

    2017-09-01

    Evaluations of neutron survey instruments, area monitors, and personal dosimeters rely on reference neutron radiations, which have evolved from the heavy reliance on (α,n) sources to a shared reliance on (α,n) and the spontaneous fission neutrons of californium-252 (Cf). Capable of producing high dose equivalent rates from an almost point source geometry, the characteristics of Cf are generally more favorable when compared to the use of (α,n) and (γ,n) sources or reactor-produced reference neutron radiations. Californium-252 is typically used in two standardized configurations: unmoderated, to yield a fission energy spectrum; or with the capsule placed within a heavy-water moderating sphere to produce a softened spectrum that is generally considered more appropriate for evaluating devices used in nuclear power plant work environments. The U.S. Department of Energy Cf Loan/Lease Program, a longtime origin of affordable Cf sources for research, testing and calibration, was terminated in 2009. Since then, high-activity sources have become increasingly cost-prohibitive for laboratories that formerly benefited from that program. Neutron generators, based on the D-T and D-D fusion reactions, have become economically competitive with Cf and are recognized internationally as important calibration and test standards. Researchers from the National Institute of Standards and Technology and the Pacific Northwest National Laboratory are jointly considering the practicality and technical challenges of implementing neutron generators as calibration standards in the U.S. This article reviews the characteristics of isotope-based neutron sources, possible isotope alternatives to Cf, and the rationale behind the increasing favor of electronically generated neutron options. The evaluation of a D-T system at PNNL has revealed characteristics that must be considered in adapting generators to the task of calibration and testing where accurate determination of a dosimetric quantity is

  19. Application of advanced optical probe instrumentation in steam generator tube bundles

    International Nuclear Information System (INIS)

    Bouchter, J.C.; Gouirand, J.M.; Haquet, J.F.; Ivars, J.F.

    1990-01-01

    The Department of Energy Transfer (DTE) of the French CEA has been developing for about 15 years optical probe techniques in order to better understand and predict nuclear components dealing with two-phase flows. More recently, in the scope of an International Program, the CEA has made an intensive use of bi-optical probes in order to very precisely investigate the distributions of void fraction and gas velocity in the secondary side of a Steam-generator mock-up operating with Freon 114 (80 degrees C, 9 x 10 5 Pa at nominal conditions). At the present time, the success of this program and the recent progress achieved in the technology of the probe, in particular to withstand higher pressures and temperatures allow us to reasonably think that this device will be soon available for industrial uses. So, this paper deals with the present state of the art of the technique within CEA and in particular it successively describes: what is required of a practical point of view when it comes to perform local measurements within tube bundles and what have been the technical choices to meet these requirements; how the bi-optical probe does operate with an emphasis on the signal processing description; how the whole device accuracy, i.e., the bi-optical probe plus its complete acquisition and signal processing chain, is determined by a calibration procedure comparing first separately then all together the different components to independent numerical and physical reference methods; typical examples of measurements of the emulsion fine structure within tube bundle subchannels as regards with void fraction, gas velocity and bubble granulometries; finally, the recent progress accomplished in terms of, higher reliability, resolution, pressure and temperature resistance

  20. Influence of water depth on the sound generated by air-bubble vibration in the water musical instrument

    Science.gov (United States)

    Ohuchi, Yoshito; Nakazono, Yoichi

    2014-06-01

    We have developed a water musical instrument that generates sound by the falling of water drops within resonance tubes. The instrument can give people who hear it the healing effect inherent in the sound of water. The sound produced by falling water drops arises from air- bubble vibrations. To investigate the impact of water depth on the air-bubble vibrations, we conducted experiments at varying values of water pressure and nozzle shape. We found that air-bubble vibration frequency does not change at a water depth of 50 mm or greater. Between 35 and 40 mm, however, the frequency decreases. At water depths of 30 mm or below, the air-bubble vibration frequency increases. In our tests, we varied the nozzle diameter from 2 to 4 mm. In addition, we discovered that the time taken for air-bubble vibration to start after the water drops start falling is constant at water depths of 40 mm or greater, but slower at depths below 40 mm.

  1. Evaluating musical instruments

    International Nuclear Information System (INIS)

    Campbell, D. Murray

    2014-01-01

    Scientific measurements of sound generation and radiation by musical instruments are surprisingly hard to correlate with the subtle and complex judgments of instrumental quality made by expert musicians

  2. Detection of VHE gamma-ray emission from the vicinity of PSR B1706-44 with H.E.S.S.

    Energy Technology Data Exchange (ETDEWEB)

    Chaves, Ryan C.G.; Ona Wilhelmi, Emma de [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Terrier, Regis [APC, CNRS, Univ. Paris-7 (France); Stegmann, Christian [Universitaet Erlangen-Nuernberg, Erlangen (Germany). Physikalisches Institut; Khelifi, Bruno [LLR, Ecole Polytechnique, CNRS/IN2P3, Palaiseau (France); Jager, Okkie C. de [Unit for Space Physics, North-West Univ., Potchefstroom (South Africa)

    2010-07-01

    The gamma-ray pulsar PSR B1706-44 and the adjacent supernova remnant (SNR) candidate G343.1-2.3 were observed by H.E.S.S. during a dedicated observational campaign in 2007. A new source of very-high-energy (VHE;E>100 GeV) gamma-ray emission, HESS J1708-443, was discovered with its centroid at RA(J2000.0)=17 h 8 m 10 s and Dec (J2000.0)=-44 d 21{sup '} ({+-}3{sup '} statistical error on each axis). The VHE gamma-ray source is significantly more extended than the H.E.S.S. point-spread function and has an intrinsic Gaussian width of 0.29 {+-}0.04 . Its energy spectrum can be described by a power law with a photon index=2.0{+-}0.1 (stat){+-}0.2 (syst). The integral flux measured between 1 and 10 TeV is {proportional_to}17% of the Crab Nebula flux in the same energy range. The possible associations with the energetic PSR B1706-44, also recently detected in the GeV domain with Fermi/LAT and AGILE, and SNR G343.1-2.3 are discussed.

  3. Research and engineering application of coordinated instrumentation control and protection technology between reactor and steam turbine generator on nuclear power plant

    International Nuclear Information System (INIS)

    Sun Xingdong

    2014-01-01

    The coordinated instrumentation control and protection technology between reactor and steam turbine generator (TG) usually is very significant and complicated for a new construction of nuclear power plant, because it carries the safety, economy and availability of nuclear power plant. Based on successful practice of a nuclear power plant, the experience on interface design and hardware architecture of coordinated instrumentation control and protection technology between reactor and steam turbine generator was abstracted and researched. In this paper, the key points and engineering experience were introduced to give the helpful instructions for the new project. (author)

  4. Tomographic intensity mapping versus galaxy surveys: observing the Universe in H α emission with new generation instruments

    Science.gov (United States)

    Silva, B. Marta; Zaroubi, Saleem; Kooistra, Robin; Cooray, Asantha

    2018-04-01

    The H α line emission is an important probe for a number of fundamental quantities in galaxies, including their number density, star formation rate (SFR), and overall gas content. A new generation of low-resolution intensity mapping (IM) probes, e.g. SPHEREx and CDIM, will observe galaxies in H α emission over a large fraction of the sky from the local Universe till a redshift of z ˜ 6 - 10, respectively. This will also be the target line for observations by the high-resolution Euclid and WFIRST instruments in the z ˜ 0.7-2 redshift range. In this paper, we estimate the intensity and power spectra of the H α line in the z ˜ 0-5 redshift range using observed line luminosity functions (LFs), when possible, and simulations, otherwise. We estimate the significance of our predictions by accounting for the modelling uncertainties (e.g. SFR, extinction, etc.) and observational contamination. We find that IM surveys can make a statistical detection of the full H α emission between z ˜ 0.8 and 5. Moreover, we find that the high-frequency resolution and the sensitivity of the planned CDIM surveys allow for the separation of H α emission from several interloping lines. We explore ways to use the combination of these line intensities to probe galaxy properties. As expected, our study indicates that galaxy surveys will only detect bright galaxies that contribute up to a few per cent of the overall H α intensity. However, these surveys will provide important constraints on the high end of the H α LF and put strong constraints on the active galactic nucleus LF.

  5. Methane Flux Estimation from Point Sources using GOSAT Target Observation: Detection Limit and Improvements with Next Generation Instruments

    Science.gov (United States)

    Kuze, A.; Suto, H.; Kataoka, F.; Shiomi, K.; Kondo, Y.; Crisp, D.; Butz, A.

    2017-12-01

    Atmospheric methane (CH4) has an important role in global radiative forcing of climate but its emission estimates have larger uncertainties than carbon dioxide (CO2). The area of anthropogenic emission sources is usually much smaller than 100 km2. The Thermal And Near infrared Sensor for carbon Observation Fourier-Transform Spectrometer (TANSO-FTS) onboard the Greenhouse gases Observing SATellite (GOSAT) has measured CO2 and CH4 column density using sun light reflected from the earth's surface. It has an agile pointing system and its footprint can cover 87-km2 with a single detector. By specifying pointing angles and observation time for every orbit, TANSO-FTS can target various CH4 point sources together with reference points every 3 day over years. We selected a reference point that represents CH4 background density before or after targeting a point source. By combining satellite-measured enhancement of the CH4 column density and surface measured wind data or estimates from the Weather Research and Forecasting (WRF) model, we estimated CH4emission amounts. Here, we picked up two sites in the US West Coast, where clear sky frequency is high and a series of data are available. The natural gas leak at Aliso Canyon showed a large enhancement and its decrease with time since the initial blowout. We present time series of flux estimation assuming the source is single point without influx. The observation of the cattle feedlot in Chino, California has weather station within the TANSO-FTS footprint. The wind speed is monitored continuously and the wind direction is stable at the time of GOSAT overpass. The large TANSO-FTS footprint and strong wind decreases enhancement below noise level. Weak wind shows enhancements in CH4, but the velocity data have large uncertainties. We show the detection limit of single samples and how to reduce uncertainty using time series of satellite data. We will propose that the next generation instruments for accurate anthropogenic CO2 and CH

  6. Instrumental variable analysis as a complementary analysis in studies of adverse effects : venous thromboembolism and second-generation versus third-generation oral contraceptives

    NARCIS (Netherlands)

    Boef, Anna G C; Souverein, Patrick C|info:eu-repo/dai/nl/243074948; Vandenbroucke, Jan P; van Hylckama Vlieg, Astrid; de Boer, Anthonius|info:eu-repo/dai/nl/075097346; le Cessie, Saskia; Dekkers, Olaf M

    2016-01-01

    PURPOSE: A potentially useful role for instrumental variable (IV) analysis may be as a complementary analysis to assess the presence of confounding when studying adverse drug effects. There has been discussion on whether the observed increased risk of venous thromboembolism (VTE) for

  7. A new generation of x-ray spectrometry UHV instruments at the SR facilities BESSY II, ELETTRA and SOLEIL

    Energy Technology Data Exchange (ETDEWEB)

    Lubeck, J., E-mail: janin.lubeck@ptb.de; Fliegauf, R.; Holfelder, I.; Hönicke, P.; Müller, M.; Pollakowski, B.; Ulm, G.; Weser, J.; Beckhoff, B. [Physikalisch-Technische Bundesanstalt (PTB), Abbestr. 2-12, 10587 Berlin (Germany); Bogovac, M.; Kaiser, R. B.; Karydas, A. G.; Leani, J. J.; Migliori, A.; Sghaier, H. [Nuclear Science and Instrumentation Laboratory, IAEA Laboratories, A-2444, Seibersdorf (Austria); Boyer, B.; Lépy, M. C.; Ménesguen, Y. [CEA, LIST, Laboratoire National Henri Becquerel, Bât. 602 PC 111, CEA-Saclay 91191 Gif-sur-Yvette c. (France); Detlefs, B. [CEA-LETI, Minatec Campus, 17 rue des Martyrs, 38054 Grenoble (France); Eichert, D. [Elettra - Sincrotrone Trieste (EST) S.C.p.A., 34149 Basovizza, Trieste (Italy); and others

    2016-07-27

    A novel type of ultra-high vacuum instrument for X-ray reflectometry and spectrometry-related techniques for nanoanalytics by means of synchrotron radiation (SR) has been constructed and commissioned at BESSY II. This versa-tile instrument was developed by the PTB, Germany’s national metrology institute, and includes a 9-axis manipulator that allows for an independent alignment of the samples with respect to all degrees of freedom. In addition, it integrates a rotational and translational movement of several photodiodes as well as a translational movement of a beam-geometry-defining aperture system. Thus, the new instrument enables various analytical techniques based on energy dispersive X-ray detectors such as reference-free X-Ray Fluorescence (XRF) analysis, total-reflection XRF, grazing-incidence XRF, in addition to optional X-Ray Reflectometry (XRR) measurements or polarization-dependent X-ray absorption fine structure analyses (XAFS). Samples having a size of up to (100 × 100) mm{sup 2}; can be analyzed with respect to their mass deposition, elemental, spatial or species composition. Surface contamination, nanolayer composition and thickness, depth pro-file of matrix elements or implants, nanoparticles or buried interfaces as well as molecular orientation of bonds can be accessed. Three technology transfer projects of adapted instruments have enhanced X-Ray Spectrometry (XRS) research activities within Europe at the synchrotron radiation facilities ELETTRA (IAEA) and SOLEIL (CEA/LNE-LNHB) as well as at the X-ray innovation laboratory BLiX (TU Berlin) where different laboratory sources are used. Here, smaller chamber requirements led PTB in cooperation with TU Berlin to develop a modified instrument equipped with a 7-axis manipulator: reduced freedom in the choice of experimental geometry modifications (absence of out-of-SR-plane and reference-free XRS options) has been compensated by encoder-enhanced angular accuracy for GIXRF and XRR.

  8. A high-voltage equipment (high voltage supply, high voltage pulse generators, resonant charging inductance, synchro-instruments for gyrotron frequency measurements) for plasma applications

    International Nuclear Information System (INIS)

    Spassov, Velin

    1996-01-01

    This document reports my activities as visitor-professor at the Gyrotron Project - INPE Plasma Laboratory. The main objective of my activities was designing, construction and testing a suitable high-voltage pulse generator for plasma applications, and efforts were concentrated on the following points: Design of high-voltage resonant power supply with tunable output (0 - 50 kV) for line-type high voltage pulse generator; design of line-type pulse generator (4 microseconds pulse duration, 0 - 25 kV tunable voltage) for non linear loads such as a gyrotron and P III reactor; design of resonant charging inductance for resonant line-type pulse generator, and design of high resolution synchro instrument for gyrotron frequency measurement. (author)

  9. Methods and apparatus for cleaning objects in a chamber of an optical instrument by generating reactive ions using photon radiation

    Science.gov (United States)

    Klebanoff, Leonard E.; Delgado, Gildardo R.; Hollenshead, Jeromy T.; Umstadter, Karl R.; Starodub, Elena; Zhuang, Guorong V.

    2015-10-13

    An optical instrument, including a chamber, an object exposed to an interior of the chamber, a source of low-pressure gas, the gas comprising at least one of low-pressure molecular hydrogen gas, low-pressure molecular oxygen and a low-pressure noble gas, the source of low pressure gas being fluidly coupled to the chamber, a low voltage source electrically coupled between the object and a remaining portion of the instrument that is exposed to the interior of the chamber so as to maintain the object at a low voltage relative to the remaining portion, and an EUV/VUV light source adapted to direct EUV/VUV light through the low pressure gas in the chamber onto the object. In such a system, when the EUV/VUV light source is activated ions of the low-pressure gas are formed and directed to the object. The ions may be ions of Hydrogen, Oxygen or a noble gas.

  10. Determination of PV Generator I-V/P-V Characteristic Curves Using a DC-DC Converter Controlled by a Virtual Instrument

    Directory of Open Access Journals (Sweden)

    E. Durán

    2012-01-01

    Full Text Available A versatile measurement system for systematic testing and measurement of the evolution of the I-V characteristic curves of photovoltaic panels or arrays (PV generators is proposed in this paper. The measurement system uses a circuit solution based on DC-DC converters that involves several advantages relative to traditional methods: simple structure, scalability, fast response, and low cost. The measurement of the desired characteristics of PV generators includes high speed of response and high fidelity. The prototype system built is governed by a microcontroller, and experimental results prove the proposed measurement system useful. A virtual instrument (VI was developed for full system control from a computer. The developed system enables monitoring the suitable operation of a PV generator in real time, since it allows comparing its actual curves with those provided by the manufacturer.

  11. Design of shared instruments to utilize simulated gravities generated by a large-gradient, high-field superconducting magnet.

    Science.gov (United States)

    Wang, Y; Yin, D C; Liu, Y M; Shi, J Z; Lu, H M; Shi, Z H; Qian, A R; Shang, P

    2011-03-01

    A high-field superconducting magnet can provide both high-magnetic fields and large-field gradients, which can be used as a special environment for research or practical applications in materials processing, life science studies, physical and chemical reactions, etc. To make full use of a superconducting magnet, shared instruments (the operating platform, sample holders, temperature controller, and observation system) must be prepared as prerequisites. This paper introduces the design of a set of sample holders and a temperature controller in detail with an emphasis on validating the performance of the force and temperature sensors in the high-magnetic field.

  12. Virtual instrumentation of a laboratory synchronous generator with LabVIEW; Instrumentacion virtual de un generador sincrono de laboratorio con LabVIEW

    Energy Technology Data Exchange (ETDEWEB)

    Uribe Fernandez, Uriel

    2003-07-01

    On this work measurement algorithms for variables from a synchronous generator are developed and implemented, in open architecture by means of virtual instrument in real time with the Laboratory Virtual Instrument Engineering Workbench (LabBIEW) that it is a development atmosphere based on the graphic programming. The main program menu of the virtual instrumentation has three options of measurement: The first option is a program that carries out the three phase measurement of: tension RMS, current RMS, magnitude, phase angle, power factor, apparent, active and reactive power and the graphic of these signals. The second option is a program that carries out the measurement of load angle from the synchronous generator. This measurement is made through the Fast Fourier Transformed (FFT), obtaining the voltage terminal, magnitude and phase angle with respect to the rotor position reference. This measurement varies from synchronous generator, operation conditions. The speed angle measurement is obtained from the load angle changes. These measurements are presented in graphic form in the time, with a virtual instrument type needle and in digital form. The range of load angle is +/- 180 degrees. The third option is a program that carries out the measurement of the load angle against active power (curve d-W), from the synchronous machine. [Spanish] En este trabajo se desarrollan e implementan algoritmos de medicion para variables de un generador sincrono, en arquitectura abierta, por medio de la instrumentacion virtual en tiempo real con el uso del Laboratory Virtual Instrument Engineering Workbench (LabVIEW) que es un ambiente de desarrollo basado en la programacion grafica. El programa principal menu de la instrumentacion virtual tiene tres opciones de medicion: La primera opcion es un programa que realiza la medicion trifasica de tension RMS, corriente RMS, magnitud, angulo de fase, factor de potencia, potencia aparente, activa y reactiva, y la graficacion de estas

  13. Effectiveness of Student-Generated Video as a Teaching Tool for an Instrumental Technique in the Organic Chemistry Laboratory

    Science.gov (United States)

    Jordan, Jeremy T.; Box, Melinda C.; Eguren, Kristen E.; Parker, Thomas A.; Saraldi-Gallardo, Victoria M.; Wolfe, Michael I.; Gallardo-Williams, Maria T.

    2016-01-01

    Multimedia instruction has been shown to serve as an effective learning aid for chemistry students. In this study, the viability of student-generated video instruction for organic chemistry laboratory techniques and procedure was examined and its effectiveness compared to instruction provided by a teaching assistant (TA) was evaluated. After…

  14. New generation pharmacogenomic tools: a SNP linkage disequilibrium Map, validated SNP assay resource, and high-throughput instrumentation system for large-scale genetic studies.

    Science.gov (United States)

    De La Vega, Francisco M; Dailey, David; Ziegle, Janet; Williams, Julie; Madden, Dawn; Gilbert, Dennis A

    2002-06-01

    Since public and private efforts announced the first draft of the human genome last year, researchers have reported great numbers of single nucleotide polymorphisms (SNPs). We believe that the availability of well-mapped, quality SNP markers constitutes the gateway to a revolution in genetics and personalized medicine that will lead to better diagnosis and treatment of common complex disorders. A new generation of tools and public SNP resources for pharmacogenomic and genetic studies--specifically for candidate-gene, candidate-region, and whole-genome association studies--will form part of the new scientific landscape. This will only be possible through the greater accessibility of SNP resources and superior high-throughput instrumentation-assay systems that enable affordable, highly productive large-scale genetic studies. We are contributing to this effort by developing a high-quality linkage disequilibrium SNP marker map and an accompanying set of ready-to-use, validated SNP assays across every gene in the human genome. This effort incorporates both the public sequence and SNP data sources, and Celera Genomics' human genome assembly and enormous resource ofphysically mapped SNPs (approximately 4,000,000 unique records). This article discusses our approach and methodology for designing the map, choosing quality SNPs, designing and validating these assays, and obtaining population frequency ofthe polymorphisms. We also discuss an advanced, high-performance SNP assay chemisty--a new generation of the TaqMan probe-based, 5' nuclease assay-and high-throughput instrumentation-software system for large-scale genotyping. We provide the new SNP map and validation information, validated SNP assays and reagents, and instrumentation systems as a novel resource for genetic discoveries.

  15. Modelling Angular Dependencies in Land Surface Temperatures From the SEVIRI Instrument onboard the Geostationary Meteosat Second Generation Satellites

    DEFF Research Database (Denmark)

    Rasmussen, Mads Olander; Pinheiro, AC; Proud, Simon Richard

    2010-01-01

    on vegetation structure and viewing and illumination geometry. Despite this, these effects are not considered in current operational LST products from neither polar-orbiting nor geostationary satellites. In this paper, we simulate the angular dependence that can be expected when estimating LST with the viewing...... geometry of the geostationary Meteosat Second Generation Spinning Enhanced Visible and Infrared Imager sensor across the African continent and compare it to a normalized view geometry. We use the modified geometric projection model that estimates the scene thermal infrared radiance from a surface covered...

  16. Validation of the mother-generated index in Iran: A specific postnatal quality-of-life instrument

    Directory of Open Access Journals (Sweden)

    Roghayeh Khabiri

    2013-01-01

    Full Text Available Background: The mother-generated index (MGI is one of only a few existing specific questionnaires for assessing the postnatal quality of life (QoL. MGI is a single-form questionnaire that asks postnatal mothers to specify up to eight areas of their lives which have been affected by giving birth to a baby. Using this tool, it is possible to score and rank the QoL of mothers. This study aimed to validate the questionnaire for use in Iran. Methods : Forward translation was used to translate the questionnaire from English to Farsi (Persian. The questionnaire was then administered to a sample of postnatal women attending two teaching hospitals in Tehran, Iran. Face validity and criterion validity were performed to establish the validity for the Iranian version of the MGI. Face validity was assessed by asking women to indicate whether they understood the wording of the questions, how easy the questionnaire was, and so on. Criterion validity was examined using the Short Form 36-item (SF-36 Health Survey. It was hypothesized that the MGI would significantly correlate with the SF-36. Results: In all, 124 women were approached. Of these, 119 women were eligible and 96 women agreed to take part in the study. Face validity was good and all of the women found the MGI straightforward to complete; as criterion validity, the MGI scores and the subscales of the SF-36 were moderately correlated (for all subscales: Pearson r > 0.4; P < 0.001. The mean MGI primary score was 5.38 (SD = 3.05. Women who had comorbidity had significantly lower MGI scores than women without comorbidity (P = 0.04. Correlation between aggregate of comments and primary score was high (r = 0.68, P < 0.01. Conclusions: In general, the Iranian version of the MGI performed well and our data suggest that it is a valid measure to assess health-related QoL among postnatal women.

  17. Instrument-Free and Autonomous Generation of H2O2 from Mg-ZnO/Au Hybrids for Disinfection and Organic Pollutant Degradations

    Science.gov (United States)

    Park, Seon Yeong; Jung, Yeon Wook; Hwang, Si Hyun; Jang, Gun Hyuk; Seo, Hyunseon; Kim, Yu-Chan; Ok, Myoung-Ryul

    2018-03-01

    We proposed a new hybrid system that autonomously generates H2O2 without any instrument or external energy source, such as light. Electrons formed during spontaneous degradation process of Mg were conveyed to ZnO/Au oxygen-reduction-reaction nanocatalysts, and these transferred electrons converted O2 molecules in aqueous solution into H2O2. Autonomously released H2O2 from Mg-ZnO/Au hybrids effectively killed 97% of Escherichia coli cells within 1 h. Moreover, Mg-ZnO/Au nanohybrids could gradually degrade methylene blue over time with Fe2+. We believe our approach utilizing degradable metals and catalytic metal oxides in mesoporous-film form can be a promising method in the field of environment remediation.

  18. Optimization of chemical and instrumental parameters in hydride generation laser-induced breakdown spectrometry for the determination of arsenic, antimony, lead and germanium in aqueous samples.

    Science.gov (United States)

    Yeşiller, Semira Unal; Yalçın, Serife

    2013-04-03

    A laser induced breakdown spectrometry hyphenated with on-line continuous flow hydride generation sample introduction system, HG-LIBS, has been used for the determination of arsenic, antimony, lead and germanium in aqueous environments. Optimum chemical and instrumental parameters governing chemical hydride generation, laser plasma formation and detection were investigated for each element under argon and nitrogen atmosphere. Arsenic, antimony and germanium have presented strong enhancement in signal strength under argon atmosphere while lead has shown no sensitivity to ambient gas type. Detection limits of 1.1 mg L(-1), 1.0 mg L(-1), 1.3 mg L(-1) and 0.2 mg L(-1) were obtained for As, Sb, Pb and Ge, respectively. Up to 77 times enhancement in detection limit of Pb were obtained, compared to the result obtained from the direct analysis of liquids by LIBS. Applicability of the technique to real water samples was tested through spiking experiments and recoveries higher than 80% were obtained. Results demonstrate that, HG-LIBS approach is suitable for quantitative analysis of toxic elements and sufficiently fast for real time continuous monitoring in aqueous environments. Copyright © 2013 Elsevier B.V. All rights reserved.

  19. Quality charter. Instrumentation of solar and wind powered electricity generating systems in isolated sites. A preliminary functional analysis; Charte de qualite. Instrumentation des systemes de production d`electricite en sites isoles a base d`energie photovoltaique et eolienne. Premiere analyse fonctionnelle

    Energy Technology Data Exchange (ETDEWEB)

    Schmitt, A.; Mauras, P.; Jacquin, P.

    1996-10-01

    This document is intended to become one of the Quality Charter documents. It presents the functions which must be provided by the instrumentation systems designed for use in solar and wind powered electricity generating systems in isolated designed for use in solar and wind powered electricity generating systems in isolated sites and should be viewed in close conjunction with the `Typology` and `Energy Management` documents covering the same systems of electricity generation in isolated sites; Together, these documents provide the definition of a range of eight energy management systems and four instrumentation systems specially adapted to the different types of facilities and requirements. (authors)

  20. The Crab pulsar at VHE

    Directory of Open Access Journals (Sweden)

    Zanin Roberta

    2017-01-01

    Full Text Available The last six years have witnessed major revisions of our knowledge about the Crab Pulsar. The consensus scenario for the origin of the high-energy pulsed emission has been challenged with the discovery of a very-high-energy power law tail extending up to ~400 GeV, above the expected spectral cut off at a few GeV. Now, new measurements obtained by the MAGIC collaboration extend the energy spectrum of the Crab Pulsar even further, on the TeV regime. Above ~400 GeV the pulsed emission comes mainly from the interpulse, which becomes more prominent with energy due to a harder spectral index. These findings require γ -ray production via inverse Compton scattering close to or beyond the light cylinder radius by an underlying particle population with Lorentz factors greater than 5 × 106. We will present those new results and discuss the implications in our current knowledge concerning pulsar environments.

  1. Radioisotope instruments

    CERN Document Server

    Cameron, J F; Silverleaf, D J

    1971-01-01

    International Series of Monographs in Nuclear Energy, Volume 107: Radioisotope Instruments, Part 1 focuses on the design and applications of instruments based on the radiation released by radioactive substances. The book first offers information on the physical basis of radioisotope instruments; technical and economic advantages of radioisotope instruments; and radiation hazard. The manuscript then discusses commercial radioisotope instruments, including radiation sources and detectors, computing and control units, and measuring heads. The text describes the applications of radioisotop

  2. Soil monitoring instrumentation

    International Nuclear Information System (INIS)

    Umbarger, C.J.

    1980-01-01

    The Los Alamos Scientific Laboratory (LASL) has an extensive program for the development of nondestructive assay instrumentation for the quantitative analysis of transuranic (TRU) materials found in bulk solid wastes generated by Department of Energy facilities and by the commercial nuclear power industry. Included are wastes generated in decontamination and decommissioning of outdated nuclear facilities as well as wastes from old waste burial ground exhumation programs. The assay instrumentation is designed to have detection limits below 10 nCi/g wherever practicable. Because of the topic of this workshop, only the assay instrumentation applied specifically to soil monitoring will be discussed here. Four types of soil monitors are described

  3. Soil monitoring instrumentation

    International Nuclear Information System (INIS)

    Umbarger, C.J.

    1981-01-01

    The Los Alamos Scientific Laboratory (LASL) has an extensive program for the development of nondestructive assay instrumentation for the quantitative analysis of transuranic (TRU) materials found in bulk solid wastes generated by Department of Energy facilities and by the commercial nuclear power industry. Included are wastes generated in decontamination and decommissioning of outdated nuclear facilities, as well as from old waste-burial-ground exhumation programs. The assay instrumentation is designed to have detection limits below 10 nCi/g wherever practicable. The assay instrumentation that is applied specifically to soil monitoring is discussed

  4. Instrumental interaction

    OpenAIRE

    Luciani , Annie

    2007-01-01

    International audience; The expression instrumental interaction as been introduced by Claude Cadoz to identify a human-object interaction during which a human manipulates a physical object - an instrument - in order to perform a manual task. Classical examples of instrumental interaction are all the professional manual tasks: playing violin, cutting fabrics by hand, moulding a paste, etc.... Instrumental interaction differs from other types of interaction (called symbolic or iconic interactio...

  5. Instrumentation Facility

    Data.gov (United States)

    Federal Laboratory Consortium — Provides instrumentation support for flight tests of prototype weapons systems using a vast array of airborne sensors, transducers, signal conditioning and encoding...

  6. Radiological instrument

    International Nuclear Information System (INIS)

    Kronenberg, S.; McLaughlin, W.L.; Seibentritt, C.R. Jr.

    1986-01-01

    An instrument is described for measuring radiation, particularly nuclear radiation, comprising: a radiation sensitive structure pivoted toward one end and including a pair of elongated solid members contiguously joined together along their length dimensions and having a common planar interface therebetween. One of the pairs of members is comprised of radiochromic material whose index of refraction changes due to anomolous dispersion as a result of being exposed to nuclear radiation. The pair of members further has mutually different indices of refraction with the member having the larger index of refraction further being transparent for the passage of light and of energy therethrough; means located toward the other end of the structure for varying the angle of longitudinal elevation of the pair of members; means for generating and projecting a beam of light into one end of the member having the larger index of refraction. The beam of light is projected toward the planar interface where it is reflected out of the other end of the same member as a first output beam; means projecting a portion of the beam of light into one end of the member having the larger index of refraction where it traverses therethrough without reflection and out of the other end of the same member as a second output beam; and means adjacent the structure for receiving the first and second output beams, whereby a calibrated change in the angle of elevation of the structure between positions of equal intensity of the first and second output beams prior to and following exposure provides a measure of the radiation sensed due to a change of refraction of the radiochromic material

  7. Instrumentation development

    International Nuclear Information System (INIS)

    Ubbes, W.F.; Yow, J.L. Jr.

    1988-01-01

    Instrumentation is developed for the Civilian Radioactive Waste Management Program to meet several different (and sometimes conflicting) objectives. This paper addresses instrumentation development for data needs that are related either directly or indirectly to a repository site, but does not touch on instrumentation for work with waste forms or other materials. Consequently, this implies a relatively large scale for the measurements, and an in situ setting for instrument performance. In this context, instruments are needed for site characterization to define phenomena, develop models, and obtain parameter values, and for later design and performance confirmation testing in the constructed repository. The former set of applications is more immediate, and is driven by the needs of program design and performance assessment activities. A host of general technical and nontechnical issues have arisen to challenge instrumentation development. Instruments can be classed into geomechanical, geohydrologic, or other specialty categories, but these issues cut across artificial classifications. These issues are outlined. Despite this imposing list of issues, several case histories are cited to evaluate progress in the area

  8. Instrumental analysis

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Seung Jae; Seo, Seong Gyu

    1995-03-15

    This textbook deals with instrumental analysis, which consists of nine chapters. It has Introduction of analysis chemistry, the process of analysis and types and form of the analysis, Electrochemistry on basic theory, potentiometry and conductometry, electromagnetic radiant rays and optical components on introduction and application, Ultraviolet rays and Visible spectrophotometry, Atomic absorption spectrophotometry on introduction, flame emission spectrometry and plasma emission spectrometry. The others like infrared spectrophotometry, X-rays spectrophotometry and mass spectrometry, chromatography and the other instrumental analysis like radiochemistry.

  9. Instrumental analysis

    International Nuclear Information System (INIS)

    Kim, Seung Jae; Seo, Seong Gyu

    1995-03-01

    This textbook deals with instrumental analysis, which consists of nine chapters. It has Introduction of analysis chemistry, the process of analysis and types and form of the analysis, Electrochemistry on basic theory, potentiometry and conductometry, electromagnetic radiant rays and optical components on introduction and application, Ultraviolet rays and Visible spectrophotometry, Atomic absorption spectrophotometry on introduction, flame emission spectrometry and plasma emission spectrometry. The others like infrared spectrophotometry, X-rays spectrophotometry and mass spectrometry, chromatography and the other instrumental analysis like radiochemistry.

  10. LOFT instrumentation

    International Nuclear Information System (INIS)

    Bixby, W.W.

    1979-01-01

    A description of instrumentation used in the Loss-of-Fluid Test (LOFT) large break Loss-of-Coolant Experiments is presented. Emphasis is placed on hydraulic and thermal measurements in the primary system piping and components, reactor vessel, and pressure suppression system. In addition, instrumentation which is being considered for measurement of phenomena during future small break testing is discussed. (orig.) 891 HP/orig. 892 BRE [de

  11. Detection techniques for the H.E.S.S. II telescope, data modeling of gravitational lensing and emission of blazars in HE-VHE astronomy

    International Nuclear Information System (INIS)

    Barnacka, Anna

    2013-01-01

    This thesis presents the study of four aspects of high energy astronomy. The first part of my thesis is dedicated to an aspect of instrument development for imaging atmospheric Cherenkov telescopes, namely the Level 2 trigger system of the High Energy Stereoscopic System (H.E.S.S.). My work on the project focused on the algorithm development and the Monte Carlo simulations of the trigger system and overall instrument. The hardware implementation of the system is described and its expected performances are then evaluated. The H.E.S.S. array has been used to observe the blazar PKS 1510-089. The second part of my thesis deals with the data analysis and modeling of broad-band emission of this particular blazar. In part II of my thesis, I am presenting the analysis of the H.E.S.S. data: the light curve and spectrum of PKS 1510-089, together with the FERMI data and a collection of multi-wavelength data obtained with various instruments. I am presenting the model of PKS 1510-089 observations carried out during a flare recorded by H.E.S.S.. The model is based on a single zone internal shock scenario. The third part of my thesis deals with blazars observed by the FERMI-LAT, but from the point of view of other phenomena: a strong gravitational lensing. This part of my thesis shows the first evidence for gravitational lensing phenomena in high energy gamma-rays. This evidence comes from the observation of a gravitational lens system induced echo in the light curve of the distant blazar PKS 1830-211. Traditional methods for the estimation of time delays in gravitational lensing systems rely on the cross-correlation of the light curves from individual images. In my thesis, I used 300 MeV-30 GeV photons detected by the Fermi-LAT instrument. The FERMI-LAT instrument cannot separate the images of known lenses. The observed light curve is thus the superposition of individual image light curves. The FERMI-LAT instrument has the advantage of providing long, evenly spaced, time series

  12. Instrumental Capital

    Directory of Open Access Journals (Sweden)

    Gabriel Valerio

    2007-07-01

    Full Text Available During the history of human kind, since our first ancestors, tools have represented a mean to reach objectives which might otherwise seemed impossibles. In the called New Economy, where tangibles assets appear to be losing the role as the core element to produce value versus knowledge, tools have kept aside man in his dairy work. In this article, the author's objective is to describe, in a simple manner, the importance of managing the organization's group of tools or instruments (Instrumental Capital. The characteristic conditions of this New Economy, the way Knowledge Management deals with these new conditions and the sub-processes that provide support to the management of Instrumental Capital are described.

  13. Seroprevalence for hepatitis E virus (HEV infection among volunteer blood donors of the Regional Blood Bank of Londrina, State of Paraná , Brazil Soroprevalência da infecção pelo virus da hepatite E (VHE em candidatos a doadores de sangue voluntários do Hemocentro Regional de Londrina, Londrina, Estado do Paraná, Brasil

    Directory of Open Access Journals (Sweden)

    André Luiz Bortoliero

    2006-04-01

    Full Text Available A cross-sectional study was carried out among 996 volunteer blood donors enrolled from May 1999 to December 1999 to determine the seroprevalence of hepatitis E virus (HEV infection among volunteer blood donors of the Regional Blood Bank of Londrina, State of Paraná, Brazil, and to evaluate whether the rate of seroprevalence of IgG anti-HEV antibodies is associated with sociodemographic variables and with seropositivity for hepatitis A virus (HAV infection. All participants answered the questionnaire regarding the sociodemographic characterisitcs. Serum samples were tested for IgG antibodies to HEV (anti-HEV by an enzyme linked immunoassay (ELISA. All serum samples positive for anti-HEV IgG and 237 serum samples negative for anti-HEV were also assayed for IgG anti-HAV antibodies by ELISA. Anti-HEV IgG was confirmed in 23/996 samples, resulting in a seroprevalence of 2.3% for HEV infection, similar to previous results obtained in developed countries. No significant association was found between the presence of anti-HEV IgG antibodies and the sociodemographic variables including gender, age, educational level, rural or urban areas, source of water, and sewer system (p > 0.05. Also, no association with seropositivity for anti-HAV IgG antibodies was observed (p > 0.05. Although this study revealed a low seroprevalence of HEV infection in the population evaluated, the results showed that this virus is circulating among the population from Londrina, South Brazil, and point out the need of further studies to define the clinical and epidemiological importance of HEV infection and to identify additional risk factors involved in the epidemiology and pathogenesis of this infection in this population.Os objetivos do estudo foram determinar a soroprevalência da infecção pelo vírus da hepatite E (VHE em candidatos a doadores de sangue voluntários do Hemocentro Regional de Londrina, Paraná, e avaliar se essa soroprevalência está associada com vari

  14. Innovative instrumentation

    International Nuclear Information System (INIS)

    Anon.

    1983-01-01

    At this year's particle physics conference at Brighton, a parallel session was given over to instrumentation and detector development. While this work is vital to the health of research and its continued progress, its share of prime international conference time is limited. Instrumentation can be innovative three times — first when a new idea is outlined, secondly when it is shown to be feasible, and finally when it becomes productive in a real experiment, amassing useful data rather than operational experience. Hyams' examples showed that it can take a long time for a new idea to filter through these successive stages, if it ever makes it at all

  15. Innovative instrumentation

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1983-11-15

    At this year's particle physics conference at Brighton, a parallel session was given over to instrumentation and detector development. While this work is vital to the health of research and its continued progress, its share of prime international conference time is limited. Instrumentation can be innovative three times — first when a new idea is outlined, secondly when it is shown to be feasible, and finally when it becomes productive in a real experiment, amassing useful data rather than operational experience. Hyams' examples showed that it can take a long time for a new idea to filter through these successive stages, if it ever makes it at all.

  16. Instrumental aspects

    Directory of Open Access Journals (Sweden)

    Qureshi Navid

    2017-01-01

    Full Text Available Every neutron scattering experiment requires the choice of a suited neutron diffractometer (or spectrometer in the case of inelastic scattering with its optimal configuration in order to accomplish the experimental tasks in the most successful way. Most generally, the compromise between the incident neutron flux and the instrumental resolution has to be considered, which is depending on a number of optical devices which are positioned in the neutron beam path. In this chapter the basic instrumental principles of neutron diffraction will be explained. Examples of different types of experiments and their respective expectable results will be shown. Furthermore, the production and use of polarized neutrons will be stressed.

  17. Surgical Instrument

    NARCIS (Netherlands)

    Dankelman, J.; Horeman, T.

    2009-01-01

    The present invention relates to a surgical instrument for minimall-invasive surgery, comprising a handle, a shaft and an actuating part, characterised by a gastight cover surrounding the shaft, wherein the cover is provided with a coupler that has a feed- through opening with a loskable seal,

  18. Weather Instruments.

    Science.gov (United States)

    Brantley, L. Reed, Sr.; Demanche, Edna L.; Klemm, E. Barbara; Kyselka, Will; Phillips, Edwin A.; Pottenger, Francis M.; Yamamoto, Karen N.; Young, Donald B.

    This booklet presents some activities to measure various weather phenomena. Directions for constructing a weather station are included. Instruments including rain gauges, thermometers, wind vanes, wind speed devices, humidity devices, barometers, atmospheric observations, a dustfall jar, sticky-tape can, detection of gases in the air, and pH of…

  19. Advanced optical instruments technology

    Science.gov (United States)

    Shao, Mike; Chrisp, Michael; Cheng, Li-Jen; Eng, Sverre; Glavich, Thomas; Goad, Larry; Jones, Bill; Kaarat, Philip; Nein, Max; Robinson, William

    1992-08-01

    The science objectives for proposed NASA missions for the next decades push the state of the art in sensitivity and spatial resolution over a wide range of wavelengths, including the x-ray to the submillimeter. While some of the proposed missions are larger and more sensitive versions of familiar concepts, such as the next generation space telescope, others use concepts, common on the Earth, but new to space, such as optical interferometry, in order to provide spatial resolutions impossible with other concepts. However, despite their architecture, the performance of all of the proposed missions depends critically on the back-end instruments that process the collected energy to produce scientifically interesting outputs. The Advanced Optical Instruments Technology panel was chartered with defining technology development plans that would best improve optical instrument performance for future astrophysics missions. At this workshop the optical instrument was defined as the set of optical components that reimage the light from the telescope onto the detectors to provide information about the spatial, spectral, and polarization properties of the light. This definition was used to distinguish the optical instrument technology issues from those associated with the telescope, which were covered by a separate panel. The panel identified several areas for optical component technology development: diffraction gratings; tunable filters; interferometric beam combiners; optical materials; and fiber optics. The panel also determined that stray light suppression instruments, such as coronagraphs and nulling interferometers, were in need of general development to support future astrophysics needs.

  20. Astronomical Instrumentation System Markup Language

    Science.gov (United States)

    Goldbaum, Jesse M.

    2016-05-01

    The Astronomical Instrumentation System Markup Language (AISML) is an Extensible Markup Language (XML) based file format for maintaining and exchanging information about astronomical instrumentation. The factors behind the need for an AISML are first discussed followed by the reasons why XML was chosen as the format. Next it's shown how XML also provides the framework for a more precise definition of an astronomical instrument and how these instruments can be combined to form an Astronomical Instrumentation System (AIS). AISML files for several instruments as well as one for a sample AIS are provided. The files demonstrate how AISML can be utilized for various tasks from web page generation and programming interface to instrument maintenance and quality management. The advantages of widespread adoption of AISML are discussed.

  1. Speciation analysis of arsenic by selective hydride generation- cryotrapping-atomic fluorescence spectrometry with flame-in-gas- shield atomizer: Achieving extremely low detection limits with inexpensive instrumentation

    Czech Academy of Sciences Publication Activity Database

    Musil, Stanislav; Matoušek, Tomáš; Currier, J. M.; Stýblo, M.; Dědina, Jiří

    2014-01-01

    Roč. 86, č. 20 (2014), s. 10422-10428 ISSN 0003-2700 R&D Projects: GA ČR GA14-23532S; GA MŠk LH12040 Institutional support: RVO:68081715 Keywords : speciation analysis of arsenic * selective hydride generation * flame-in-gas-shield atomizer * cryotrapping-atomic fluorescence spectrometry Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 5.636, year: 2014

  2. Nuclear instrumentation

    International Nuclear Information System (INIS)

    Weill, Jacky; Fabre, Rene.

    1981-01-01

    This article sums up the Research and Development effort at present being carried out in the five following fields of applications: Health physics and Radioprospection, Control of nuclear reactors, Plant control (preparation and reprocessing of the fuel, testing of nuclear substances, etc.), Research laboratory instrumentation, Detectors. It also sets the place of French industrial activities by means of an estimate of the French market, production and flow of trading with other countries [fr

  3. Divided Instruments

    Science.gov (United States)

    Chapman, A.; Murdin, P.

    2000-11-01

    Although the division of the zodiac into 360° probably derives from Egypt or Assyria around 2000 BC, there is no surviving evidence of Mesopotamian cultures embodying this division into a mathematical instrument. Almost certainly, however, it was from Babylonia that the Greek geometers learned of the 360° circle, and by c. 80 BC they had incorporated it into that remarkably elaborate device gener...

  4. Instrumentation development

    International Nuclear Information System (INIS)

    Anon.

    1976-01-01

    Areas being investigated for instrumentation improvement during low-level pollution monitoring include laser opto-acoustic spectroscopy, x-ray fluorescence spectroscopy, optical fluorescence spectroscopy, liquid crystal gas detectors, advanced forms of atomic absorption spectroscopy, electro-analytical chemistry, and mass spectroscopy. Emphasis is also directed toward development of physical methods, as opposed to conventional chemical analysis techniques for monitoring these trace amounts of pollution related to energy development and utilization

  5. Instrumentation maintenance

    International Nuclear Information System (INIS)

    Mack, D.A.

    1976-09-01

    It is essential to any research activity that accurate and efficient measurements be made for the experimental parameters under consideration for each individual experiment or test. Satisfactory measurements in turn depend upon having the necessary instruments and the capability of ensuring that they are performing within their intended specifications. This latter requirement can only be achieved by providing an adequate maintenance facility, staffed with personnel competent to understand the problems associated with instrument adjustment and repair. The Instrument Repair Shop at the Lawrence Berkeley Laboratory is designed to achieve this end. The organization, staffing and operation of this system is discussed. Maintenance policy should be based on studies of (1) preventive vs. catastrophic maintenance, (2) records indicating when equipment should be replaced rather than repaired and (3) priorities established to indicate the order in which equipment should be repaired. Upon establishing a workable maintenance policy, the staff should be instructed so that they may provide appropriate scheduled preventive maintenance, calibration and corrective procedures, and emergency repairs. The education, training and experience of the maintenance staff is discussed along with the organization for an efficient operation. The layout of the various repair shops is described in the light of laboratory space and financial constraints

  6. New isostatic mounting concept for a space born Three Mirror Anastigmat (TMA) on the Meteosat Third Generation Infrared Sounder Instrument (MTG-IRS)

    Science.gov (United States)

    Freudling, Maximilian; Klammer, Jesko; Lousberg, Gregory; Schumacher, Jean-Marc; Körner, Christian

    2016-07-01

    A novel isostatic mounting concept for a space born TMA of the Meteosat Third Generation Infrared Sounder is presented. The telescope is based on a light-weight all-aluminium design. The mounting concept accommodates the telescope onto a Carbon-Fiber-Reinforced Polymer (CRFP) structure. This design copes with the high CTE mismatch without introducing high stresses into the telescope structure. Furthermore a Line of Sight stability of a few microrads under geostationary orbit conditions is provided. The design operates with full performance at a temperature 20K below the temperature of the CFRP structure and 20K below the integration temperature. The mounting will sustain launch loads of 47g. This paper will provide the design of the Back Telescope Assembly (BTA) isostatic mounting and will summarise the consolidated technical baseline reached following a successful Preliminary Design Review (PDR).

  7. A Musical instrument in MEMS

    NARCIS (Netherlands)

    Engelen, Johannes Bernardus Charles; de Boer, Hans L.; de Boer, H.; Beekman, J.G.; Been, A.J.; Folkertsma, Gerrit Adriaan; Folkertsma, G.A.; Fortgens, L.; de Graaf, D.; Vocke, S.; Woldering, L.A.; Abelmann, Leon; Elwenspoek, Michael Curt

    In this work we describe a MEMS instrument that resonates at audible frequencies, and with which music can be made. The sounds are generated by mechanical resonators and capacitive displacement sensors. Damping by air scales unfavourably for generating audible frequencies with small devices.

  8. New-Generation NASA Aura Ozone Monitoring Instrument (OMI) Volcanic SO2 Dataset: Algorithm Description, Initial Results, and Continuation with the Suomi-NPP Ozone Mapping and Profiler Suite (OMPS)

    Science.gov (United States)

    Li, Can; Krotkov, Nickolay A.; Carn, Simon; Zhang, Yan; Spurr, Robert J. D.; Joiner, Joanna

    2017-01-01

    Since the fall of 2004, the Ozone Monitoring Instrument (OMI) has been providing global monitoring of volcanic SO2 emissions, helping to understand their climate impacts and to mitigate aviation hazards. Here we introduce a new-generation OMI volcanic SO2 dataset based on a principal component analysis (PCA) retrieval technique. To reduce retrieval noise and artifacts as seen in the current operational linear fit (LF) algorithm, the new algorithm, OMSO2VOLCANO, uses characteristic features extracted directly from OMI radiances in the spectral fitting, thereby helping to minimize interferences from various geophysical processes (e.g., O3 absorption) and measurement details (e.g., wavelength shift). To solve the problem of low bias for large SO2 total columns in the LF product, the OMSO2VOLCANO algorithm employs a table lookup approach to estimate SO2 Jacobians (i.e., the instrument sensitivity to a perturbation in the SO2 column amount) and iteratively adjusts the spectral fitting window to exclude shorter wavelengths where the SO2 absorption signals are saturated. To first order, the effects of clouds and aerosols are accounted for using a simple Lambertian equivalent reflectivity approach. As with the LF algorithm, OMSO2VOLCANO provides total column retrievals based on a set of predefined SO2 profiles from the lower troposphere to the lower stratosphere, including a new profile peaked at 13 km for plumes in the upper troposphere. Examples given in this study indicate that the new dataset shows significant improvement over the LF product, with at least 50% reduction in retrieval noise over the remote Pacific. For large eruptions such as Kasatochi in 2008 (approximately 1700 kt total SO2/ and Sierra Negra in 2005 (greater than 1100DU maximum SO2), OMSO2VOLCANO generally agrees well with other algorithms that also utilize the full spectral content of satellite measurements, while the LF algorithm tends to underestimate SO2. We also demonstrate that, despite the

  9. Power station instrumentation

    International Nuclear Information System (INIS)

    Jervis, M.W.

    1993-01-01

    Power stations are characterized by a wide variety of mechanical and electrical plant operating with structures, liquids and gases working at high pressures and temperatures and with large mass flows. The voltages and currents are also the highest that occur in most industries. In order to achieve maximum economy, the plant is operated with relatively small margins from conditions that can cause rapid plant damage, safety implications, and very high financial penalties. In common with other process industries, power stations depend heavily on control and instrumentation. These systems have become particularly significant, in the cost-conscious privatized environment, for providing the means to implement the automation implicit in maintaining safety standards, improving generation efficiency and reducing operating manpower costs. This book is for professional instrumentation engineers who need to known about their use in power stations and power station engineers requiring information about the principles and choice of instrumentation available. There are 8 chapters; chapter 4 on instrumentation for nuclear steam supply systems is indexed separately. (Author)

  10. EPRTM Reactor neutron instrumentation

    International Nuclear Information System (INIS)

    Pfeiffer, Maxime; SALA, Stephanie

    2013-06-01

    The core safety during operation is linked, in particular, to the respect of criteria related to the heat generated in fuel rods and to the heat exchange between the rods and the coolant. This local power information is linked to the power distribution in the core. In order to evaluate the core power distribution, the EPR TM reactor relies on several types of neutron detectors: - ionization chambers located outside the vessel and used for protection and monitoring - a fixed in-core instrumentation based on Cobalt Self Powered Neutron Detectors used for protection and monitoring - a mobile reference in-core instrumentation based on Vanadium aero-balls This document provides a description of this instrumentation and its use in core protection, limitation, monitoring and control functions. In particular, a description of the detectors and the principles of their signal generation is supplied as well as the description of the treatments related to these detectors in the EPR TM reactor I and C systems (including periodical calibration). (authors)

  11. Seismic instrumentation

    International Nuclear Information System (INIS)

    1984-06-01

    RFS or Regles Fondamentales de Surete (Basic Safety Rules) applicable to certain types of nuclear facilities lay down requirements with which compliance, for the type of facilities and within the scope of application covered by the RFS, is considered to be equivalent to compliance with technical French regulatory practice. The object of the RFS is to take advantage of standardization in the field of safety, while allowing for technical progress in that field. They are designed to enable the operating utility and contractors to know the rules pertaining to various subjects which are considered to be acceptable by the Service Central de Surete des Installations Nucleaires, or the SCSIN (Central Department for the Safety of Nuclear Facilities). These RFS should make safety analysis easier and lead to better understanding between experts and individuals concerned with the problems of nuclear safety. The SCSIN reserves the right to modify, when considered necessary, any RFS and specify, if need be, the terms under which a modification is deemed retroactive. The aim of this RFS is to define the type, location and operating conditions for seismic instrumentation needed to determine promptly the seismic response of nuclear power plants features important to safety to permit comparison of such response with that used as the design basis

  12. Meteorological instrumentation

    International Nuclear Information System (INIS)

    1982-06-01

    RFS or ''Regles Fondamentales de Surete'' (Basic Safety Rules) applicable to certain types of nuclear facilities lay down requirements with which compliance, for the type of facilities and within the scope of application covered by the RFS, is considered to be equivalent to compliance with technical French regulatory practice. The object of the RFS is to take advantage of standardization in the field of safety , while allowing for technical progress in that field. They are designed to enable the operating utility and contractors to know the rules pertaining to various subjects which are considered to be acceptable by the ''Service Central de Surete des Installations Nucleaires'' or the SCSIN (Central Department for the Safety of Nuclear Facilities). These RFS should make safety analysis easier and lead to better understanding between experts and individuals concerned with the problems of nuclear safety. The SCSIN reserves the right to modify, when considered necessary any RFS and specify, if need be, the terms under which a modification is deemed retroactive. The purpose of this RFS is to specify the meteorological instrumentation required at the site of each nuclear power plant equipped with at least one pressurized water reactor

  13. Radiation measuring instrument

    International Nuclear Information System (INIS)

    Genrich, V.

    1985-01-01

    A highly sensitive and compactly structured radiation measuring instrument for detecting ionizing radiation, in particular for measuring dose rates and contamination. The laminar structure of the associated counter tube, using only a few, simple plastic parts and a highly elastic counter wire, makes it possible to use the simplest manufacturing techniques. The service life of the counter tube construction, which is completely and permanently sealed and filled with gas, is expected to be more than 12 years. The described counter tube can be adapted in optimal fashion to the available space in a pocket instrument if it is used in combination with a specialized high-voltage generator which is low in interference voltage and with a pulse evaluation circuit having a means of compensating for interference voltage

  14. Instrumentation in elementary particle physics

    Energy Technology Data Exchange (ETDEWEB)

    Fabjan, C W [European Organization for Nuclear Research, Geneva (Switzerland); Pilcher, J E [Chicago Univ., IL (United States); eds.

    1988-01-01

    The first International Committee for Future Accelerators Instrumentation School was held at the International Centre for Theoretical Physics, Trieste, Italy from 8 to 19 June 1987. The School was attended by 74 students of whom 45 were from developing countries, 10 lecturers and 9 laboratory instructors. The next generation of elementary particle physics experiments would depend vitally on new ideas in instrumentation. This is a field where creativity and imagination play a major role and large budgets are not a prerequisite. One of the unique features was the presentation of four laboratory experiments using modern techniques and instrumentation. Refs, figs and tabs.

  15. Instrumentation in elementary particle physics

    International Nuclear Information System (INIS)

    Fabjan, C.W.; Pilcher, J.E.

    1988-01-01

    The first International Committee for Future Accelerators Instrumentation School was held at the International Centre for Theoretical Physics, Trieste, Italy from 8 to 19 June 1987. The School was attended by 74 students of whom 45 were from developing countries, 10 lecturers and 9 laboratory instructors. The next generation of elementary particle physics experiments would depend vitally on new ideas in instrumentation. This is a field where creativity and imagination play a major role and large budgets are not a prerequisite. One of the unique features was the presentation of four laboratory experiments using modern techniques and instrumentation. Refs, figs and tabs

  16. Technical presentation - KEITHLEY Instruments - CANCELLED

    CERN Multimedia

    FI Department

    2009-01-01

    10 March 2009 13:30 – 15:30, Council Chamber, Bldg. 503 Keithley markets highly accurate instruments and data acquisition products, as well as complete system solutions for high-volume production and assembly testing. Keithley Instruments, Inc. designs, develops, manufactures and markets complex electronic instruments and systems geared to the specialized needs of electronics manufacturers for high-performance production testing, process monitoring, product development and research. Products and Services: Digital Multimeters and Data Acquisition Systems Current / Voltage Source and Measure Products Low Current / High Resistance Measurement Products Function/Pulse/Arbitrary/Pattern Generators Low Voltage/Low Resistance Measurement Products RF Spectrum Analyzer / RF Signal Generator / RF Switching Semiconductor Device Characterization Program: Topic 1: Welcome and short overview of new Products SMU 26XXA / ARB Generator 3390 / DMM 3706 / E-Meter 6517B Topic 2a: Te...

  17. Multi-pollutants sensors based on near-IR telecom lasers and mid-IR difference frequency generation: development and applications; Instruments de mesure multi-polluants par spectroscopie infrarouge bases sur des lasers fibres et par generation de difference de frequences: developpement et applications

    Energy Technology Data Exchange (ETDEWEB)

    Cousin, J

    2006-12-15

    At present the detection of VOC and other anthropic trace pollutants is an important challenge in the measurement of air quality. Infrared spectroscopy, allowing spectral regions rich in molecular absorption to be probed, is a suitable technique for in-situ monitoring of the air pollution. Thus the aim of this work was to develop instruments capable of detecting multiple pollutants for in-situ monitoring by IR spectroscopy. A first project benefited from the availability of the telecommunications lasers emitting in near-IR. This instrument was based on an external cavity diode laser (1500 - 1640 nm) in conjunction with a multipass cell (100 m). The detection sensitivity was optimised by employing a balanced detection and a sweep integration procedure. The instrument developed is deployable for in-situ measurements with a sensitivity of < 10{sup -8} cm{sup -1} Hz{sup -1/2} and allowed the quantification of chemical species such as CO{sub 2}, CO, C{sub 2}H{sub 2}, CH{sub 4} and the determination of the isotopic ratio {sup 13}CO{sub 2}/{sup 12}CO{sub 2} in combustion environment The second project consisted in mixing two near-IR fiber lasers in a non-linear crystal (PPLN) in order to produce a laser radiation by difference frequency generation in the middle-IR (3.15 - 3.43 {mu}m), where the absorption bands of the molecules are the most intense. The first studies with this source were carried out on detection of ethylene (C{sub 2}H{sub 4}) and benzene (C{sub 6}H{sub 6}). Developments, characterizations and applications of these instruments in the near and middle IR are detailed and the advantages of the 2 spectral ranges is highlighted. (author)

  18. VHE Gamma-ray Supernova Remnants

    Energy Technology Data Exchange (ETDEWEB)

    Funk, Stefan; /KIPAC, Menlo Park

    2007-01-22

    Increasing observational evidence gathered especially in X-rays and {gamma}-rays during the course of the last few years support the notion that Supernova remnants (SNRs) are Galactic particle accelerators up to energies close to the ''knee'' in the energy spectrum of Cosmic rays. This review summarizes the current status of {gamma}-ray observations of SNRs. Shell-type as well as plerionic type SNRs are addressed and prospect for observations of these two source classes with the upcoming GLAST satellite in the energy regime above 100 MeV are given.

  19. Information system for data management of civil buildings instrumentation in generating power stations; Sistema de informacion para el manejo de datos de la instrumentacion de las obras civiles de las centrales generadoras

    Energy Technology Data Exchange (ETDEWEB)

    Alvarado, Alonso; Escamilla, Juan Carlos; Alaniz, Felipe de Jesus [Instituto de Investigaciones Electricas, Cuernavaca (Mexico); Gonzalez, Francisco; Mena, Enrique [Comision Federal de Electricidad, Mexico, D. F. (Mexico)

    1997-12-31

    A relevant task performed by Comision Federal de Electricidad (CFE) is the analysis of the structural behavior and safety assessment of the country`s large electric energy generating stations. This task is performed capturing, revising an analyzing the information generated by measuring instruments installed in the power station civil structures. Such activity generates a large amount of data and the collection, analysis and assessment is a long and tiresome process; additionally, the generated information is kept in plain isolated files, that causes sluggishness in the process and delays in the access to the information. This article describes the characteristics of the Information System for Structure Measurements (Sistema de Informacion de Medicion de Estructuras) (SIME), developed by the Instituto de Investigaciones Electricas (IIE) for CFE in order to enhance the opportunity for the information management. SIME captures, arranges, stores and reports the data obtained from the measurements at the works with great efficiency and flexibility. This system is part of another of greater scope with which CFE will ensure an optimum operation condition of its civil buildings. [Espanol] Una tarea relevante que realiza la Comision Federal de Electricidad (CFE) es analizar el comportamiento estructural y evaluar la seguridad de las grandes obras generadoras de energia electrica del pais. Esta tarea la realiza capturando, revisando y analizando la informacion que generan instrumentos de medicion instalados en las estructuras civiles de las centrales. Tal actividad genera gran cantidad de datos y el proceso de recopilacion, analisis y evaluacion es tardado y tedioso; ademas, la informacion que se genera se guarda en archivos planos aislados, lo que ocasiona lentitud en el proceso y retraso en el acceso a la informacion. Este articulo describe las caracteristicas del Sistema de Informacion de Medicion de Estructuras (SIME) desarrollado por el Instituto de Investigaciones

  20. Information system for data management of civil buildings instrumentation in generating power stations; Sistema de informacion para el manejo de datos de la instrumentacion de las obras civiles de las centrales generadoras

    Energy Technology Data Exchange (ETDEWEB)

    Alvarado, Alonso; Escamilla, Juan Carlos; Alaniz, Felipe de Jesus [Instituto de Investigaciones Electricas, Cuernavaca (Mexico); Gonzalez, Francisco; Mena, Enrique [Comision Federal de Electricidad, Mexico, D. F. (Mexico)

    1998-12-31

    A relevant task performed by Comision Federal de Electricidad (CFE) is the analysis of the structural behavior and safety assessment of the country`s large electric energy generating stations. This task is performed capturing, revising an analyzing the information generated by measuring instruments installed in the power station civil structures. Such activity generates a large amount of data and the collection, analysis and assessment is a long and tiresome process; additionally, the generated information is kept in plain isolated files, that causes sluggishness in the process and delays in the access to the information. This article describes the characteristics of the Information System for Structure Measurements (Sistema de Informacion de Medicion de Estructuras) (SIME), developed by the Instituto de Investigaciones Electricas (IIE) for CFE in order to enhance the opportunity for the information management. SIME captures, arranges, stores and reports the data obtained from the measurements at the works with great efficiency and flexibility. This system is part of another of greater scope with which CFE will ensure an optimum operation condition of its civil buildings. [Espanol] Una tarea relevante que realiza la Comision Federal de Electricidad (CFE) es analizar el comportamiento estructural y evaluar la seguridad de las grandes obras generadoras de energia electrica del pais. Esta tarea la realiza capturando, revisando y analizando la informacion que generan instrumentos de medicion instalados en las estructuras civiles de las centrales. Tal actividad genera gran cantidad de datos y el proceso de recopilacion, analisis y evaluacion es tardado y tedioso; ademas, la informacion que se genera se guarda en archivos planos aislados, lo que ocasiona lentitud en el proceso y retraso en el acceso a la informacion. Este articulo describe las caracteristicas del Sistema de Informacion de Medicion de Estructuras (SIME) desarrollado por el Instituto de Investigaciones

  1. Experiences in the instrumentation of power generators with the on-line analysis of generators AnGel system, for the internal insulation condition diagnosis; Experiencias en la instrumentacion de generadores de potencia con el sistema de analisis de generadores en linea AnGeL, para el diagnostico del estado del aislamiento interno

    Energy Technology Data Exchange (ETDEWEB)

    Carrillo C, Jaime; Ramirez N, Jose T. [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)

    2009-07-01

    The instrumentation of power generators with monitoring systems on-line, allows the personnel responsible for its operation to determine the stator and rotor windings insulation condition, as well as to emit an opportune diagnosis of possible anomalies, to implant programs of predictive maintenance, to reduce costs and to increase its reliability. The experiences of the last five years in the commissioning of the AnGel System; the problematic to which these equipment is subjected to, is described within the intrinsic atmosphere of the area where they are installed in the turbo-generators and hydro-generators, and finally, the experiences in the commissioning of the monitoring systems are revised and analyzed. [Spanish] La instrumentacion de los generadores de potencia con sistemas de monitoreo en linea, permite al personal responsable de su operacion determinar el estado del aislamiento de los devanados del estator y rotor, asi como emitir un diagnostico oportuno de posibles anomalias, implantar programas de mantenimiento predictivo, reducir costos e incrementar su confiabilidad. Se presentan las experiencias de los ultimos cinco anos en la puesta en operacion del Sistema AnGeL; se describe la problematica a la que son sometidos estos equipos dentro del ambiente intrinseco del area donde se instalan en los turbogeneradores e hidrogeneradores, y por ultimo, se analizan y discuten las experiencias en la puesta en servicio de los sistemas de monitoreo.

  2. A GC Instrument Simulator

    Science.gov (United States)

    Armitage, D. Bruce

    1999-02-01

    This simulator was developed to help students beginning the study of gas chromatographic instruments to understand their operation. It is not meant to teach chromatographic theory. The instrument simulator is divided into 5 sections. One is for sample preparation. Another is used to manage carrier gases and choose a detector and column. The third sets the conditions for either isothermal or programmed temperature operation. A fourth section models manual injections, and the fifth is the autosampler. The operator has a choice among 6 columns of differing diameters and packing polarities and a choice of either isothermal or simple one-stage temperature programming. The simulator can be operated in either single-sample mode or as a 10-sample autosampler. The integrator has two modes of operation, a "dumb" mode in which only the retention time, area of the peak, and percentage area are listed and a "smart" mode that also lists the components' identities. The identities are obtained from a list of names and retention times created by the operator. Without this list only the percentages and areas are listed. The percentages are based on the areas obtained from the chromatogram and not on the actual percentages assigned during sample preparation. The data files for the compounds used in the simulator are ASCII files and can be edited easily to add more compounds than the 11 included with the simulator. A maximum of 10 components can be used in any one sample. Sample mixtures can be made on a percent-by-volume basis, but not by mass of sample per volume of solvent. A maximum of 30 compounds can be present in any one file, but the number of files is limited only by the operating system. (I suggest that not more than 20 compounds be used in any one file, as scrolling through large numbers of compounds is annoying to say the least.) File construction and layout are discussed in detail in the User's Manual. Chromatograms are generated by calculating a retention time based on

  3. CARMENES instrument overview

    Science.gov (United States)

    Quirrenbach, A.; Amado, P. J.; Caballero, J. A.; Mundt, R.; Reiners, A.; Ribas, I.; Seifert, W.; Abril, M.; Aceituno, J.; Alonso-Floriano, F. J.; Ammler-von Eiff, M.; Antona Jiménez, R.; Anwand-Heerwart, H.; Azzaro, M.; Bauer, F.; Barrado, D.; Becerril, S.; Béjar, V. J. S.; Benítez, D.; Berdiñas, Z. M.; Cárdenas, M. C.; Casal, E.; Claret, A.; Colomé, J.; Cortés-Contreras, M.; Czesla, S.; Doellinger, M.; Dreizler, S.; Feiz, C.; Fernández, M.; Galadí, D.; Gálvez-Ortiz, M. C.; García-Piquer, A.; García-Vargas, M. L.; Garrido, R.; Gesa, L.; Gómez Galera, V.; González Álvarez, E.; González Hernández, J. I.; Grözinger, U.; Guàrdia, J.; Guenther, E. W.; de Guindos, E.; Gutiérrez-Soto, J.; Hagen, H.-J.; Hatzes, A. P.; Hauschildt, P. H.; Helmling, J.; Henning, T.; Hermann, D.; Hernández Castaño, L.; Herrero, E.; Hidalgo, D.; Holgado, G.; Huber, A.; Huber, K. F.; Jeffers, S.; Joergens, V.; de Juan, E.; Kehr, M.; Klein, R.; Kürster, M.; Lamert, A.; Lalitha, S.; Laun, W.; Lemke, U.; Lenzen, R.; López del Fresno, Mauro; López Martí, B.; López-Santiago, J.; Mall, U.; Mandel, H.; Martín, E. L.; Martín-Ruiz, S.; Martínez-Rodríguez, H.; Marvin, C. J.; Mathar, R. J.; Mirabet, E.; Montes, D.; Morales Muñoz, R.; Moya, A.; Naranjo, V.; Ofir, A.; Oreiro, R.; Pallé, E.; Panduro, J.; Passegger, V.-M.; Pérez-Calpena, A.; Pérez Medialdea, D.; Perger, M.; Pluto, M.; Ramón, A.; Rebolo, R.; Redondo, P.; Reffert, S.; Reinhardt, S.; Rhode, P.; Rix, H.-W.; Rodler, F.; Rodríguez, E.; Rodríguez-López, C.; Rodríguez-Pérez, E.; Rohloff, R.-R.; Rosich, A.; Sánchez-Blanco, E.; Sánchez Carrasco, M. A.; Sanz-Forcada, J.; Sarmiento, L. F.; Schäfer, S.; Schiller, J.; Schmidt, C.; Schmitt, J. H. M. M.; Solano, E.; Stahl, O.; Storz, C.; Stürmer, J.; Suárez, J. C.; Ulbrich, R. G.; Veredas, G.; Wagner, K.; Winkler, J.; Zapatero Osorio, M. R.; Zechmeister, M.; Abellán de Paco, F. J.; Anglada-Escudé, G.; del Burgo, C.; Klutsch, A.; Lizon, J. L.; López-Morales, M.; Morales, J. C.; Perryman, M. A. C.; Tulloch, S. M.; Xu, W.

    2014-07-01

    This paper gives an overview of the CARMENES instrument and of the survey that will be carried out with it during the first years of operation. CARMENES (Calar Alto high-Resolution search for M dwarfs with Exoearths with Near-infrared and optical Echelle Spectrographs) is a next-generation radial-velocity instrument under construction for the 3.5m telescope at the Calar Alto Observatory by a consortium of eleven Spanish and German institutions. The scientific goal of the project is conducting a 600-night exoplanet survey targeting ~ 300 M dwarfs with the completed instrument. The CARMENES instrument consists of two separate echelle spectrographs covering the wavelength range from 0.55 to 1.7 μm at a spectral resolution of R = 82,000, fed by fibers from the Cassegrain focus of the telescope. The spectrographs are housed in vacuum tanks providing the temperature-stabilized environments necessary to enable a 1 m/s radial velocity precision employing a simultaneous calibration with an emission-line lamp or with a Fabry-Perot etalon. For mid-M to late-M spectral types, the wavelength range around 1.0 μm (Y band) is the most important wavelength region for radial velocity work. Therefore, the efficiency of CARMENES has been optimized in this range. The CARMENES instrument consists of two spectrographs, one equipped with a 4k x 4k pixel CCD for the range 0.55 - 1.05 μm, and one with two 2k x 2k pixel HgCdTe detectors for the range from 0.95 - 1.7μm. Each spectrograph will be coupled to the 3.5m telescope with two optical fibers, one for the target, and one for calibration light. The front end contains a dichroic beam splitter and an atmospheric dispersion corrector, to feed the light into the fibers leading to the spectrographs. Guiding is performed with a separate camera; on-axis as well as off-axis guiding modes are implemented. Fibers with octagonal cross-section are employed to ensure good stability of the output in the presence of residual guiding errors. The

  4. IOT Overview: IR Instruments

    Science.gov (United States)

    Mason, E.

    In this instrument review chapter the calibration plans of ESO IR instruments are presented and briefly reviewed focusing, in particular, on the case of ISAAC, which has been the first IR instrument at VLT and whose calibration plan served as prototype for the coming instruments.

  5. Health physics instrument manual

    International Nuclear Information System (INIS)

    Gupton, E.D.

    1978-08-01

    The purpose of this manual is to provide apprentice health physics surveyors and other operating groups not directly concerned with radiation detection instruments a working knowledge of the radiation detection and measuring instruments in use at the Laboratory. The characteristics and applications of the instruments are given. Portable instruments, stationary instruments, personnel monitoring instruments, sample counters, and miscellaneous instruments are described. Also, information sheets on calibration sources, procedures, and devices are included. Gamma sources, beta sources, alpha sources, neutron sources, special sources, a gamma calibration device for badge dosimeters, and a calibration device for ionization chambers are described

  6. Astronomical Instruments in India

    Science.gov (United States)

    Sarma, Sreeramula Rajeswara

    The earliest astronomical instruments used in India were the gnomon and the water clock. In the early seventh century, Brahmagupta described ten types of instruments, which were adopted by all subsequent writers with minor modifications. Contact with Islamic astronomy in the second millennium AD led to a radical change. Sanskrit texts began to lay emphasis on the importance of observational instruments. Exclusive texts on instruments were composed. Islamic instruments like the astrolabe were adopted and some new types of instruments were developed. Production and use of these traditional instruments continued, along with the cultivation of traditional astronomy, up to the end of the nineteenth century.

  7. The Micronium-A Musical MEMS instrument

    NARCIS (Netherlands)

    Engelen, Johannes Bernardus Charles; de Boer, Hans L.; de Boer, Hylco; Beekman, Jethro G.; Fortgens, Laurens C.; de Graaf, Derk B.; Vocke, Sander; Abelmann, Leon

    The Micronium is a musical instrument fabricated from silicon using microelectromechanical system (MEMS) technology. It is—to the best of our knowledge—the first musical micro-instrument fabricated using MEMS technology, where the actual sound is generated by mechanical microstructures. The

  8. Troubleshooting in nuclear instruments

    International Nuclear Information System (INIS)

    1987-06-01

    This report on troubleshooting of nuclear instruments is the product of several scientists and engineers, who are closely associated with nuclear instrumentation and with the IAEA activities in the field. The text covers the following topics: Preamplifiers, amplifiers, scalers, timers, ratemeters, multichannel analyzers, dedicated instruments, tools, instruments, accessories, components, skills, interfaces, power supplies, preventive maintenance, troubleshooting in systems, radiation detectors. The troubleshooting and repair of instruments is illustrated by some real examples

  9. HTGR Measurements and Instrumentation Systems

    International Nuclear Information System (INIS)

    Ball, Sydney J.; Holcomb, David Eugene; Cetiner, Mustafa Sacit

    2012-01-01

    This report provides an integrated overview of measurements and instrumentation for near-term future high-temperature gas-cooled reactors (HTGRs). Instrumentation technology has undergone revolutionary improvements since the last HTGR was constructed in the United States. This report briefly describes the measurement and communications needs of HTGRs for normal operations, maintenance and inspection, fuel fabrication, and accident response. The report includes a description of modern communications technologies and also provides a potential instrumentation communications architecture designed for deployment at an HTGR. A principal focus for the report is describing new and emerging measurement technologies with high potential to improve operations, maintenance, and accident response for the next generation of HTGRs, known as modular HTGRs, which are designed with passive safety features. Special focus is devoted toward describing the failure modes of the measurement technologies and assessing the technology maturity.

  10. Performing the Super Instrument

    DEFF Research Database (Denmark)

    Kallionpaa, Maria

    2016-01-01

    can empower performers by producing super instrument works that allow the concert instrument to become an ensemble controlled by a single player. The existing instrumental skills of the performer can be multiplied and the qualities of regular acoustic instruments extended or modified. Such a situation......The genre of contemporary classical music has seen significant innovation and research related to new super, hyper, and hybrid instruments, which opens up a vast palette of expressive potential. An increasing number of composers, performers, instrument designers, engineers, and computer programmers...... have become interested in different ways of “supersizing” acoustic instruments in order to open up previously-unheard instrumental sounds. Super instruments vary a great deal but each has a transformative effect on the identity and performance practice of the performing musician. Furthermore, composers...

  11. Detectors for Tomorrow's Instruments

    Science.gov (United States)

    Moseley, Harvey

    2009-01-01

    Cryogenically cooled superconducting detectors have become essential tools for a wide range of measurement applications, ranging from quantum limited heterodyne detection in the millimeter range to direct searches for dark matter with superconducting phonon detectors operating at 20 mK. Superconducting detectors have several fundamental and practical advantages which have resulted in their rapid adoption by experimenters. Their excellent performance arises in part from reductions in noise resulting from their low operating temperatures, but unique superconducting properties provide a wide range of mechanisms for detection. For example, the steep dependence of resistance with temperature on the superconductor/normal transition provides a sensitive thermometer for calorimetric and bolometric applications. Parametric changes in the properties of superconducting resonators provides a mechanism for high sensitivity detection of submillimeter photons. From a practical point of view, the use of superconducting detectors has grown rapidly because many of these devices couple well to SQUID amplifiers, which are easily integrated with the detectors. These SQUID-based amplifiers and multiplexers have matured with the detectors; they are convenient to use, and have excellent noise performance. The first generation of fully integrated large scale superconducting detection systems are now being deployed. I will discuss the prospects for a new generation of instruments designed to take full advantage of the revolution in detector technology.

  12. LOFT instrumented fuel design and operating experience

    International Nuclear Information System (INIS)

    Russell, M.L.

    1979-01-01

    A summary description of the Loss-of-Fluid Test (LOFT) system instrumented core construction details and operating experience through reactor startup and loss-of-coolant experiment (LOCE) operations performed to date are discussed. The discussion includes details of the test instrumentation attachment to the fuel assembly, the structural response of the fuel modules to the forces generated by a double-ended break of a pressurized water reactor (PWR) coolant pipe at the inlet to the reactor vessel, the durability of the LOFT fuel and test instrumentation, and the plans for incorporation of improved fuel assembly test instrumentation features in the LOFT core

  13. THE 2010 VERY HIGH ENERGY {gamma}-RAY FLARE AND 10 YEARS OF MULTI-WAVELENGTH OBSERVATIONS OF M 87

    Energy Technology Data Exchange (ETDEWEB)

    Abramowski, A. [Institut fuer Experimentalphysik, Universitaet Hamburg, Luruper Chaussee 149, D 22761 Hamburg (Germany); Acero, F. [Laboratoire Univers et Particules de Montpellier, Universite Montpellier 2, CNRS/IN2P3, CC 72, Place Eugene Bataillon, F-34095 Montpellier Cedex 5 (France); Aharonian, F.; Bernloehr, K.; Bochow, A. [Max-Planck-Institut fuer Kernphysik, P.O. Box 103980, D 69029 Heidelberg (Germany); Akhperjanian, A. G. [National Academy of Sciences of the Republic of Armenia, 24 Marshall Baghramian Avenue, 0019 Yerevan (Armenia); Anton, G.; Balzer, A. [Physikalisches Institut, Universitaet Erlangen-Nuernberg, Erwin-Rommel-Str. 1, D 91058 Erlangen (Germany); Barnacka, A. [Nicolaus Copernicus Astronomical Center, ul. Bartycka 18, 00-716 Warsaw (Poland); Barres de Almeida, U. [Department of Physics, University of Durham, South Road, Durham DH1 3LE (United Kingdom); Becherini, Y. [Astroparticule et Cosmologie (APC), CNRS, Universite Paris 7 Denis Diderot, 10, rue Alice Domon et Leonie Duquet, F-75205 Paris Cedex 13 (France); Becker, J. [Institut fuer Theoretische Physik, Lehrstuhl IV: Weltraum und Astrophysik, Ruhr-Universitaet Bochum, D 44780 Bochum (Germany); Behera, B. [Landessternwarte, Universitaet Heidelberg, Koenigstuhl, D 69117 Heidelberg (Germany); Birsin, E. [Institut fuer Physik, Humboldt-Universitaet zu Berlin, Newtonstr. 15, D 12489 Berlin (Germany); Biteau, J. [Laboratoire Leprince-Ringuet, Ecole Polytechnique, CNRS/IN2P3, F-91128 Palaiseau (France); Boisson, C. [LUTH, Observatoire de Paris, CNRS, Universite Paris Diderot, 5 Place Jules Janssen, 92190 Meudon (France); Bolmont, J. [LPNHE, Universite Pierre et Marie Curie Paris 6, Universite Denis Diderot Paris 7, CNRS/IN2P3, 4 Place Jussieu, F-75252, Paris Cedex 5 (France); Bordas, P., E-mail: martin.raue@desy.de [Institut fuer Astronomie und Astrophysik, Universitaet Tuebingen, Sand 1, D 72076 Tuebingen (Germany); Collaboration: H.E.S.S. Collaboration; MAGIC Collaboration; VERITAS Collaboration; and others

    2012-02-20

    The giant radio galaxy M 87 with its proximity (16 Mpc), famous jet, and very massive black hole ((3 - 6) Multiplication-Sign 10{sup 9} M{sub Sun }) provides a unique opportunity to investigate the origin of very high energy (VHE; E > 100 GeV) {gamma}-ray emission generated in relativistic outflows and the surroundings of supermassive black holes. M 87 has been established as a VHE {gamma}-ray emitter since 2006. The VHE {gamma}-ray emission displays strong variability on timescales as short as a day. In this paper, results from a joint VHE monitoring campaign on M 87 by the MAGIC and VERITAS instruments in 2010 are reported. During the campaign, a flare at VHE was detected triggering further observations at VHE (H.E.S.S.), X-rays (Chandra), and radio (43 GHz Very Long Baseline Array, VLBA). The excellent sampling of the VHE {gamma}-ray light curve enables one to derive a precise temporal characterization of the flare: the single, isolated flare is well described by a two-sided exponential function with significantly different flux rise and decay times of {tau}{sup rise}{sub d} = (1.69 {+-} 0.30) days and {tau}{sup decay}{sub d} = (0.611 {+-} 0.080) days, respectively. While the overall variability pattern of the 2010 flare appears somewhat different from that of previous VHE flares in 2005 and 2008, they share very similar timescales ({approx}day), peak fluxes ({Phi}{sub >0.35TeV} {approx_equal} (1-3) Multiplication-Sign 10{sup -11} photons cm{sup -2} s{sup -1}), and VHE spectra. VLBA radio observations of 43 GHz of the inner jet regions indicate no enhanced flux in 2010 in contrast to observations in 2008, where an increase of the radio flux of the innermost core regions coincided with a VHE flare. On the other hand, Chandra X-ray observations taken {approx}3 days after the peak of the VHE {gamma}-ray emission reveal an enhanced flux from the core (flux increased by factor {approx}2; variability timescale <2 days). The long-term (2001-2010) multi-wavelength (MWL

  14. Evaluation Framework for Search Instruments

    International Nuclear Information System (INIS)

    Warren, Glen A.; Smith, Leon E.; Cooper, Matt W.; Kaye, William R.

    2005-01-01

    A framework for quantitatively evaluating current and proposed gamma-ray search instrument designs has been developed. The framework is designed to generate a large library of ''virtual neighborhoods'' that can be used to test and evaluate nearly any gamma-ray sensor type. Calculating nuisance-source emissions and combining various sources to create a large number of random virtual scenes places a significant computational burden on the development of the framework. To reduce this burden, a number of radiation transport simplifications have been made which maintain the essential physics ingredients for the quantitative assessment of search instruments while significantly reducing computational times. The various components of the framework, from the simulation and benchmarking of nuisance source emissions to the computational engine for generating the gigabytes of simulated search scenes, are discussed

  15. Operational and reliability experience with reactor instrumentation

    International Nuclear Information System (INIS)

    Dixon, F.; Gow, R.S.

    1978-01-01

    In the last 15 years the CEGB has experienced progressive plant development, integration and changes in operating regime through nine nuclear (gas-cooled reactor) power stations with corresponding instrumentation advances leading towards more refined centralized control. Operation and reliability experience with reactor instrumentation is reported in this paper with reference to the progressive changes related to the early magnox, late magnox and AGR periods. Data on instrumentation reliability in terms of reactor forced outages are presented and show that the instrumentation contributions to loss of generating plant availability are small. Reactor safety circuits, neutron flux and temperature measurements, gas analysis and vibration monitoring are discussed. In reviewing the reactor instrumentation the emphasis is on reporting recent experience, particularly on AGR equipment, but overall performance and changes to magnox equipment are included so that some appreciation can be obtained of instrumentation requirements with respect to plant lifetimes. (author)

  16. Instrument Modeling and Synthesis

    Science.gov (United States)

    Horner, Andrew B.; Beauchamp, James W.

    During the 1970s and 1980s, before synthesizers based on direct sampling of musical sounds became popular, replicating musical instruments using frequency modulation (FM) or wavetable synthesis was one of the “holy grails” of music synthesis. Synthesizers such as the Yamaha DX7 allowed users great flexibility in mixing and matching sounds, but were notoriously difficult to coerce into producing sounds like those of a given instrument. Instrument design wizards practiced the mysteries of FM instrument design.

  17. Nuclear reactor instrumentation

    International Nuclear Information System (INIS)

    Duncombe, E.; McGonigal, G.

    1975-01-01

    A liquid metal cooled nuclear reactor is described which has an equal number of fuel sub-assemblies and sensing instruments. Each instrument senses temperature and rate of coolant flow of a coolant derived from a group of three sub-assemblies so that an abnormal value for one sub-assembly will be indicated on three instruments thereby providing for redundancy of up to two of the three instruments. The abnormal value may be a precurser to unstable boiling of coolant

  18. Aeroacoustics of Musical Instruments

    NARCIS (Netherlands)

    Fabre, B.; Gilbert, J.; Hirschberg, Abraham; Pelorson, X.

    2012-01-01

    We are interested in the quality of sound produced by musical instruments and their playability. In wind instruments, a hydrodynamic source of sound is coupled to an acoustic resonator. Linear acoustics can predict the pitch of an instrument. This can significantly reduce the trial-and-error process

  19. Status of safeguards instrumentation

    International Nuclear Information System (INIS)

    Higinbotham, W.A.

    The International Atomic Energy Agency is performing safeguards at some nuclear power reactors, 50 bulk processing facilities, and 170 research facilities. Its verification activities require the use of instruments to measure nuclear materials and of surveillance instruments to maintain continuity of knowledge of the locations of nuclear materials. Instruments that are in use and under development to measure weight, volume, concentration, and isotopic composition of nuclear materials, and the major surveillance instruments, are described in connection with their uses at representative nuclear facilities. The current status of safeguards instrumentation and the needs for future development are discussed

  20. Early modern mathematical instruments.

    Science.gov (United States)

    Bennett, Jim

    2011-12-01

    In considering the appropriate use of the terms "science" and "scientific instrument," tracing the history of "mathematical instruments" in the early modern period is offered as an illuminating alternative to the historian's natural instinct to follow the guiding lights of originality and innovation, even if the trail transgresses contemporary boundaries. The mathematical instrument was a well-defined category, shared across the academic, artisanal, and commercial aspects of instrumentation, and its narrative from the sixteenth to the eighteenth century was largely independent from other classes of device, in a period when a "scientific" instrument was unheard of.

  1. Maintenance of nuclear medicine instruments

    Energy Technology Data Exchange (ETDEWEB)

    Ambro, P

    1993-12-31

    Maintenance of instruments is generally of two kinds: (a) corrective maintenance, on a non-scheduled basis, to restore equipment to a functional status by repairs; (b) preventive maintenance, to keep equipment in a specified functional condition by providing systematic inspection, quality control, detection and correction of early malfunctions. Most of the instruments used in nuclear medicine are rather complex systems built from mechanical, electrical and electronic parts. Any one of these components is liable to fail at some time or other. Repair could be done only by a specialist who is able to evaluate the condition of the various parts ranging from cables to connectors, from scintillators to photomultipliers, from microprocessors to microswitches. The knowledge of the intricacies of the various electronic components required for their repairs is quite wide and varied. The electronics industry turns out more and more multi-purpose chips which can carry out the functions of many parts used in the instruments of the earlier generation. This provides protection against unauthorized copying of the circuits but it serves another purpose as well of inhibiting repairs by non-factory personnel. These trends of the instrument design should be taken into consideration when a policy has to be developed for the repairs of the hospital based equipment 1 fig., 1 tab

  2. Maintenance of nuclear medicine instruments

    International Nuclear Information System (INIS)

    Ambro, P.

    1992-01-01

    Maintenance of instruments is generally of two kinds: (a) corrective maintenance, on a non-scheduled basis, to restore equipment to a functional status by repairs; (b) preventive maintenance, to keep equipment in a specified functional condition by providing systematic inspection, quality control, detection and correction of early malfunctions. Most of the instruments used in nuclear medicine are rather complex systems built from mechanical, electrical and electronic parts. Any one of these components is liable to fail at some time or other. Repair could be done only by a specialist who is able to evaluate the condition of the various parts ranging from cables to connectors, from scintillators to photomultipliers, from microprocessors to microswitches. The knowledge of the intricacies of the various electronic components required for their repairs is quite wide and varied. The electronics industry turns out more and more multi-purpose chips which can carry out the functions of many parts used in the instruments of the earlier generation. This provides protection against unauthorized copying of the circuits but it serves another purpose as well of inhibiting repairs by non-factory personnel. These trends of the instrument design should be taken into consideration when a policy has to be developed for the repairs of the hospital based equipment

  3. 47 CFR 2.1505 - Test instrumentation and equipment.

    Science.gov (United States)

    2010-10-01

    ... instrument is to be DC coupled and capable of manually triggered single sweeps. (d) Frequency counter. A... frequency. (e) Signal generator. A calibrated signal generator with an output of at least 75 mW at 121.5 and...

  4. Instrumentation a reader

    CERN Document Server

    Pope, P

    1990-01-01

    This book contains a selection of papers and articles in instrumentation previously pub­ lished in technical periodicals and journals of learned societies. Our selection has been made to illustrate aspects of current practice and applications of instrumentation. The book does not attempt to be encyclopaedic in its coverage of the subject, but to provide some examples of general transduction techniques, of the sensing of particular measurands, of components of instrumentation systems and of instrumentation practice in two very different environments, the food industry and the nuclear power industry. We have made the selection particularly to provide papers appropriate to the study of the Open University course T292 Instrumentation. The papers have been chosen so that the book covers a wide spectrum of instrumentation techniques. Because of this, the book should be of value not only to students of instrumen­ tation, but also to practising engineers and scientists wishing to glean ideas from areas of instrumen...

  5. Instrumentation for Nuclear Applications

    International Nuclear Information System (INIS)

    1998-01-01

    The objective of this project was to develop and coordinate nuclear instrumentation standards with resulting economies for the nuclear and radiation fields. There was particular emphasis on coordination and management of the Nuclear Instrument Module (NIM) System, U.S. activity involving the CAMAC international standard dataway system, the FASTBUS modular high-speed data acquisition and control system and processing and management of national nuclear instrumentation and detector standards, as well as a modest amount of assistance and consultation services to the Pollutant Characterization and Safety Research Division of the Office of Health and Environmental Research. The principal accomplishments were the development and maintenance of the NIM instrumentation system that is the predominant instrumentation system in the nuclear and radiation fields worldwide, the CAMAC digital interface system in coordination with the ESONE Committee of European Laboratories, the FASTBUS high-speed system and numerous national and international nuclear instrumentation standards

  6. VIRUS instrument enclosures

    Science.gov (United States)

    Prochaska, T.; Allen, R.; Mondrik, N.; Rheault, J. P.; Sauseda, M.; Boster, E.; James, M.; Rodriguez-Patino, M.; Torres, G.; Ham, J.; Cook, E.; Baker, D.; DePoy, Darren L.; Marshall, Jennifer L.; Hill, G. J.; Perry, D.; Savage, R. D.; Good, J. M.; Vattiat, Brian L.

    2014-08-01

    The Visible Integral-Field Replicable Unit Spectrograph (VIRUS) instrument will be installed at the Hobby-Eberly Telescope† in the near future. The instrument will be housed in two enclosures that are mounted adjacent to the telescope, via the VIRUS Support Structure (VSS). We have designed the enclosures to support and protect the instrument, to enable servicing of the instrument, and to cool the instrument appropriately while not adversely affecting the dome environment. The system uses simple HVAC air handling techniques in conjunction with thermoelectric and standard glycol heat exchangers to provide efficient heat removal. The enclosures also provide power and data transfer to and from each VIRUS unit, liquid nitrogen cooling to the detectors, and environmental monitoring of the instrument and dome environments. In this paper, we describe the design and fabrication of the VIRUS enclosures and their subsystems.

  7. Radiation protection instrument 1993

    International Nuclear Information System (INIS)

    1993-04-01

    The Radiation Protection Instrument, 1993 (Legislative Instrument 1559) prescribes the powers and functions of the Radiation Protection Board established under the Ghana Atomic Energy Commission by the Atomic Energy Commission (Amendment) Law, 1993 (P.N.D.C. Law 308). Also included in the Legislative Instrument are schedules on control and use of ionising radiation and radiation sources as well as procedures for notification, licensing and inspection of ionising radiation facilities. (EAA)

  8. Repairing method of color TV with measuring instrument

    International Nuclear Information System (INIS)

    1996-01-01

    This book concentrates on repairing method of color TV with measuring instrument, which deals with direction and sorts of measuring instrument for service, application and basic technique of an oscilloscope and a synchroscope, constituent of TV and wave reading, everything for test skill for service man, service technique by electronic voltmeter, service technique by sweep generator and maker generator, dot-bar generator and support skill for color TV and color bar generator and application technology of color circuit.

  9. Networked Instrumentation Element

    Data.gov (United States)

    National Aeronautics and Space Administration — Armstrong researchers have developed a networked instrumentation system that connects modern experimental payloads to existing analog and digital communications...

  10. Instrument validation project

    International Nuclear Information System (INIS)

    Reynolds, B.A.; Daymo, E.A.; Geeting, J.G.H.; Zhang, J.

    1996-06-01

    Westinghouse Hanford Company Project W-211 is responsible for providing the system capabilities to remove radioactive waste from ten double-shell tanks used to store radioactive wastes on the Hanford Site in Richland, Washington. The project is also responsible for measuring tank waste slurry properties prior to injection into pipeline systems, including the Replacement of Cross-Site Transfer System. This report summarizes studies of the appropriateness of the instrumentation specified for use in Project W-211. The instruments were evaluated in a test loop with simulated slurries that covered the range of properties specified in the functional design criteria. The results of the study indicate that the compact nature of the baseline Project W-211 loop does not result in reduced instrumental accuracy resulting from poor flow profile development. Of the baseline instrumentation, the Micromotion densimeter, the Moore Industries thermocouple, the Fischer and Porter magnetic flow meter, and the Red Valve Pressure transducer meet the desired instrumental accuracy. An alternate magnetic flow meter (Yokagawa) gave nearly identical results as the baseline fischer and Porter. The Micromotion flow meter did not meet the desired instrument accuracy but could potentially be calibrated so that it would meet the criteria. The Nametre on-line viscometer did not meet the desired instrumental accuracy and is not recommended as a quantitative instrument although it does provide qualitative information. The recommended minimum set of instrumentation necessary to ensure the slurry meets the Project W-058 acceptance criteria is the Micromotion mass flow meter and delta pressure cells

  11. Instrument performance evaluation

    International Nuclear Information System (INIS)

    Swinth, K.L.

    1993-03-01

    Deficiencies exist in both the performance and the quality of health physics instruments. Recognizing the implications of such deficiencies for the protection of workers and the public, in the early 1980s the DOE and the NRC encouraged the development of a performance standard and established a program to test a series of instruments against criteria in the standard. The purpose of the testing was to establish the practicality of the criteria in the standard, to determine the performance of a cross section of available instruments, and to establish a testing capability. Over 100 instruments were tested, resulting in a practical standard and an understanding of the deficiencies in available instruments. In parallel with the instrument testing, a value-impact study clearly established the benefits of implementing a formal testing program. An ad hoc committee also met several times to establish recommendations for the voluntary implementation of a testing program based on the studies and the performance standard. For several reasons, a formal program did not materialize. Ongoing tests and studies have supported the development of specific instruments and have helped specific clients understand the performance of their instruments. The purpose of this presentation is to trace the history of instrument testing to date and suggest the benefits of a centralized formal program

  12. [Controlling instruments in radiology].

    Science.gov (United States)

    Maurer, M

    2013-10-01

    Due to the rising costs and competitive pressures radiological clinics and practices are now facing, controlling instruments are gaining importance in the optimization of structures and processes of the various diagnostic examinations and interventional procedures. It will be shown how the use of selected controlling instruments can secure and improve the performance of radiological facilities. A definition of the concept of controlling will be provided. It will be shown which controlling instruments can be applied in radiological departments and practices. As an example, two of the controlling instruments, material cost analysis and benchmarking, will be illustrated.

  13. Ocean Optics Instrumentation Systems

    Data.gov (United States)

    Federal Laboratory Consortium — FUNCTION: Provides instrumentation suites for a wide variety of measurements to characterize the ocean’s optical environment. These packages have been developed to...

  14. Instrumentation and test gear circuits manual

    CERN Document Server

    Marston, R M

    2013-01-01

    Instrumentation and Test Gear Circuits Manual provides diagrams, graphs, tables, and discussions of several types of practical circuits. The practical circuits covered in this book include attenuators, bridges, scope trace doublers, timebases, and digital frequency meters. Chapter 1 discusses the basic instrumentation and test gear principles. Chapter 2 deals with the design of passive attenuators, and Chapter 3 with passive and active filter circuits. The subsequent chapters tackle 'bridge' circuits, analogue and digital metering techniques and circuitry, signal and waveform generation, and p

  15. Measurement noise of a point autofocus surface topography instrument

    DEFF Research Database (Denmark)

    Feng, Xiaobing; Quagliotti, Danilo; Maculotti, Giacomo

    Optical instruments for areal topography measurement can be especially sensitive to noise when scanning is required. Such noise has different sources, including those internally generated and external sources from the environment.......Optical instruments for areal topography measurement can be especially sensitive to noise when scanning is required. Such noise has different sources, including those internally generated and external sources from the environment....

  16. Particle size distribution instrument. Topical report 13

    Energy Technology Data Exchange (ETDEWEB)

    Okhuysen, W.; Gassaway, J.D.

    1995-04-01

    The development of an instrument to measure the concentration of particles in gas is described in this report. An in situ instrument was designed and constructed which sizes individual particles and counts the number of occurrences for several size classes. Although this instrument was designed to detect the size distribution of slag and seed particles generated at an experimental coal-fired magnetohydrodynamic power facility, it can be used as a nonintrusive diagnostic tool for other hostile industrial processes involving the formation and growth of particulates. Two of the techniques developed are extensions of the widely used crossed beam velocimeter, providing simultaneous measurement of the size distribution and velocity of articles.

  17. The Power of Optical/IR Interferometry: Recent Scientific Results and 2nd Generation Instrumentation Proceedings of the ESO Workshop held in Garching, Germany, 4-8 April 2005

    CERN Document Server

    Richichi, A; Paresce, F; Chelli, A

    2008-01-01

    Long-baseline interferometry has been traditionally regarded as a very technical method with a limited number of applications. At the turn of the millennium, with the introduction of large community-oriented facilities such as the VLTI, we are seeing a transformation into a major astronomical technique, with a corresponding dramatic increase in the number of publications. This book marks this transition, by providing a wide and deep insight into a large number of diverse and compelling results recently obtained by long-baseline interferometers. It also provides an insight into concepts which form the basis of future instruments and further developments in this technique.

  18. Overview of LOFT instrumentation

    International Nuclear Information System (INIS)

    Bixby, W.W.

    1979-01-01

    A description of instrumentation used in the Loss-of-Fluid Test (LOFT) large break Loss-of-Coolant Experiments is presented. Emphasis is placed on hydraulic and thermal measurements in the primary system piping and components, reactor vessel, and pressure suppression system. In addition, instrumentation which is being considered for measurement of phenomena during future small break testing is discussed

  19. The instrumentation of fast reactor

    International Nuclear Information System (INIS)

    Endo, Akira

    2003-03-01

    The author has been engaged in the development of fast reactors over the last 30 years with both an involvement with the early technology development on the experimental breeder reactor Joyo, and latterly continuing this work on the prototype breeder reactor, Monju. In order to pass on this experience to younger engineers this paper is produced to outline this experience in the sincere hope that the information given will be utilised in future educational training material. The paper discusses the wide diversity on the associated instrument technology which the fast breeder reactor requires. The first chapter outlines the fast reactor system, followed by discussions on reactor instrumentation, measurement principles, temperature dependencies, and verification response characteristics from various viewpoints, are discussed in chapters two and three. The important issues of failed fuel location detection, and sodium leak detection from steam generators are discussed in chapters 4 and 5 respectively. Appended to this report is an explanation on the methods of measuring response characteristics on instrumentation systems using error analysis, random signal theory and measuring method of response characteristic by AR (autoregressive) model on which it appears is becoming an indispensable problem for persons involved with this technology in the future. (author)

  20. Instrumentation reference book

    CERN Document Server

    Boyes, Walt

    2002-01-01

    Instrumentation is not a clearly defined subject, having a 'fuzzy' boundary with a number of other disciplines. Often categorized as either 'techniques' or 'applications' this book addresses the various applications that may be needed with reference to the practical techniques that are available for the instrumentation or measurement of a specific physical quantity or quality. This makes it of direct interest to anyone working in the process, control and instrumentation fields where these measurements are essential.* Comprehensive and authoritative collection of technical information* Writte

  1. The latest radiation instrument

    International Nuclear Information System (INIS)

    Kang, Se Sik; Gwon, Dal Gwan; Kim, Gyeong Geum

    2008-08-01

    This book deals with the latest radiation instrument, which is comprised of eight chapters. It explains X rays instrument for medial treatment, X-ray tube instrument and permissible burden with its history, structure and characteristic high voltage apparatus with high voltage rectifier circuit, X-ray control apparatus for medical treatment, X-ray image equipment X-ray television apparatus and CCD 205, X-ray apparatus of install and types, Digital X-ray apparatus with CR 261 and DR 269, performance management on X-ray for medical treatment with its history, necessity and management in the radiation field.

  2. Jones' instrument technology

    CERN Document Server

    Jones, Ernest Beachcroft; Kingham, Edward G; Radnai, Rudolf

    1985-01-01

    Jones' Instrument Technology, Volume 5: Automatic Instruments and Measuring Systems deals with general trends in automatic instruments and measuring systems. Specific examples are provided to illustrate the principles of such devices. A brief review of a considerable number of standards is undertaken, with emphasis on the IEC625 Interface System. Other relevant standards are reviewed, including the interface and backplane bus standards. This volume is comprised of seven chapters and begins with a short introduction to the principles of automatic measurements, classification of measuring system

  3. Medical instruments in museums

    DEFF Research Database (Denmark)

    Söderqvist, Thomas; Arnold, Ken

    2011-01-01

    This essay proposes that our understanding of medical instruments might benefit from adding a more forthright concern with their immediate presence to the current historical focus on simply decoding their meanings and context. This approach is applied to the intriguingly tricky question of what...... actually is meant by a "medical instrument." It is suggested that a pragmatic part of the answer might lie simply in reconsidering the holdings of medical museums, where the significance of the physical actuality of instruments comes readily to hand....

  4. Environment for the instruments

    International Nuclear Information System (INIS)

    Ambro, P.

    1992-01-01

    A properly conditioned AC power supply is necessary for reliable functioning of instruments. Electric mains power is produced primarily for industry, workshops, lighting and household uses. Its quality is adjusted to these uses. In areas sand countries with a fast growing demand for electric power, these requirements are far from being met. Electronic instruments and computers, especially in these countries, need protection against disturbances of the mains supply. A clean and dry environment is needed for reliable functioning and long life of instruments. High humidity, specially at higher temperatures, changes the characteristics of electronic components. Moreover, under these conditions fungal growth causes leakage of currents and corrosion causes poor contacts. The presence of dust enhances these effects. They give rise to malfunction of instruments, particularly of high voltage equipment

  5. CCAT Heterodyne Instrument Development

    Data.gov (United States)

    National Aeronautics and Space Administration — This work will extend and proof-out the design concept for a high pixel count (128 pixels in 2 bands) submillimeter-wave heterodyne receiver array instrument for the...

  6. Environment for the instruments

    Energy Technology Data Exchange (ETDEWEB)

    Ambro, P

    1993-12-31

    A properly conditioned AC power supply is necessary for reliable functioning of instruments. Electric mains power is produced primarily for industry, workshops, lighting and household uses. Its quality is adjusted to these uses. In areas sand countries with a fast growing demand for electric power, these requirements are far from being met. Electronic instruments and computers, especially in these countries, need protection against disturbances of the mains supply. A clean and dry environment is needed for reliable functioning and long life of instruments. High humidity, specially at higher temperatures, changes the characteristics of electronic components. Moreover, under these conditions fungal growth causes leakage of currents and corrosion causes poor contacts. The presence of dust enhances these effects. They give rise to malfunction of instruments, particularly of high voltage equipment

  7. Fiber Optics Instrumentation Development

    Science.gov (United States)

    Chan, Patrick Hon Man; Parker, Allen R., Jr.; Richards, W. Lance

    2010-01-01

    This is a general presentation of fiber optics instrumentation development work being conducted at NASA Dryden for the past 10 years and recent achievements in the field of fiber optics strain sensors.

  8. Nuclear instrument technician training

    International Nuclear Information System (INIS)

    Wollesen, E.S.

    1991-01-01

    This paper reports on Nuclear Instrument Technician (NIT) training that has developed at an accelerated rate over the past three decades. During the 1960's commercial nuclear power plants were in their infancy. For that reason, there is little wonder that NIT training had little structure and little creditability. NIT training, in many early plants, was little more than On-The Job Training (OJT). The seventies brought changes in Instrumentation and Controls as well as emphasis on the requirements for more in depth training and documentation. As in the seventies, the eighties saw not only changes in technologies but tighter requirements, standardized training and the development of accredited Nuclear Instrument Training; thus the conclusion: Nuclear Instrument Training Isn't What It Used To Be

  9. Carbon Footprint Reduction Instruments

    Science.gov (United States)

    This page outlines the major differences between Renewable Energy Certificates (REC) and Project Offsets and what types of claims each instrument allows the organization to make in regards to environmental emissions claims.

  10. Instrument care: everyone's responsibility

    Directory of Open Access Journals (Sweden)

    Renée du Toit

    2011-12-01

    Full Text Available Everyone working in an ophthalmic operating theatre must be competent in the care, handling, storage, and maintenance of instruments. This will help to improve surgical outcomes, maintain an economic and affordable service for patients, and provide a safe environment for the wellbeing of patients and staff.Including instrument care in theatre courses and in-service training is one way of ensuring staff competence.

  11. Instrument uncertainty predictions

    International Nuclear Information System (INIS)

    Coutts, D.A.

    1991-07-01

    The accuracy of measurements and correlations should normally be provided for most experimental activities. The uncertainty is a measure of the accuracy of a stated value or equation. The uncertainty term reflects a combination of instrument errors, modeling limitations, and phenomena understanding deficiencies. This report provides several methodologies to estimate an instrument's uncertainty when used in experimental work. Methods are shown to predict both the pretest and post-test uncertainty

  12. Experimenting with woodwind instruments

    Science.gov (United States)

    Lo Presto, Michael C.

    2007-05-01

    Simple experiments involving musical instruments of the woodwind family can be used to demonstrate the basic physics of vibrating air columns in resonance tubes using nothing more than straightforward measurements and data collection hardware and software. More involved experimentation with the same equipment can provide insight into the effects of holes in the tubing and other factors that make simple tubes useful as musical instruments.

  13. Maintenance of scientific instruments

    International Nuclear Information System (INIS)

    Lucero, E.

    1986-01-01

    During the last years Colombia has increased the use of nuclear techniques, instruments and equipment in ambitious health programs, as well as in research centers, industry and education; this has resulted in numerous maintenance problems. As an alternative solution IAN has established a Central Maintenance Laboratory for nuclear instruments within an International Atomic Energy Agency program for eight Latin American and nine Asian Countries. Established strategies and some results are detailed in this writing

  14. Problems with radiological surveillance instrumentation

    International Nuclear Information System (INIS)

    Swinth, K.L.; Tanner, J.E.; Fleming, D.M.

    1984-09-01

    Many radiological surveillance instruments are in use at DOE facilities throughout the country. These instruments are an essential part of all health physics programs, and poor instrument performance can increase program costs or compromise program effectiveness. Generic data from simple tests on newly purchased instruments shows that many instruments will not meet requirements due to manufacturing defects. In other cases, lack of consideration of instrument use has resulted in poor acceptance of instruments and poor reliability. The performance of instruments is highly variable for electronic and mechanical performance, radiation response, susceptibility to interferences and response to environmental factors. Poor instrument performance in these areas can lead to errors or poor accuracy in measurements

  15. Problems with radiological surveillance instrumentation

    International Nuclear Information System (INIS)

    Swinth, K.L.; Tanner, J.E.; Fleming, D.M.

    1985-01-01

    Many radiological surveillance instruments are in use at DOE facilities throughout the country. These instruments are an essential part of all health physics programs, and poor instrument performance can increase program costs or compromise program effectiveness. Generic data from simple tests on newly purchased instruments shows that many instruments will not meet requirements due to manufacturing defects. In other cases, lack of consideration of instrument use has resulted in poor acceptance of instruments and poor reliability. The performance of instruments is highly variable for electronic and mechanical performance, radiation response, susceptibility to interferences and response to environmental factors. Poor instrument performance in these areas can lead to errors or poor accuracy in measurements

  16. Programmable pulse generator

    International Nuclear Information System (INIS)

    Xue Zhihua; Lou Binqiao; Duan Xiaohui

    2002-01-01

    The author introduces the design of programmable pulse generator that is based on a micro-controller and controlled by RS232 interface of personal computer. The whole system has good stability. The pulse generator can produce TTL pulse and analog pulse. The pulse frequency can be selected by EPLD. The voltage amplitude and pulse width of analog pulse can be adjusted by analog switches and digitally-controlled potentiometers. The software development tools of computer is National Instruments LabView5.1. The front panel of this virtual instrumentation is intuitive and easy-to-use. Parameters can be selected and changed conveniently by knob and slide

  17. Automation of a thermal expansion instrument

    Energy Technology Data Exchange (ETDEWEB)

    Holland, L.L.

    1979-03-01

    Automation of a thermal expansion instrument using a minicomputer system and with analog-to-digital converter inputs and flip-flop relay outputs is described. The necessary hardware link and the software were developed to allow equipment control, data acquisition, data reduction, and report generation by the minicomputer. The design of the automation allows non-programmers to run the experiment, reduce the data, and generate the report.

  18. Robust Instrumentation[Water treatment for power plant]; Robust Instrumentering

    Energy Technology Data Exchange (ETDEWEB)

    Wik, Anders [Vattenfall Utveckling AB, Stockholm (Sweden)

    2003-08-01

    Cementa Slite Power Station is a heat recovery steam generator (HRSG) with moderate steam data; 3.0 MPa and 420 deg C. The heat is recovered from Cementa, a cement industry, without any usage of auxiliary fuel. The Power station commenced operation in 2001. The layout of the plant is unusual, there are no similar in Sweden and very few world-wide, so the operational experiences are limited. In connection with the commissioning of the power plant a R and D project was identified with the objective to minimise the manpower needed for chemistry management of the plant. The lean chemistry management is based on robust instrumentation and chemical-free water treatment plant. The concept with robust instrumentation consists of the following components; choice of on-line instrumentation with a minimum of O and M and a chemical-free water treatment. The parameters are specific conductivity, cation conductivity, oxygen and pH. In addition to that, two fairly new on-line instruments were included; corrosion monitors and differential pH calculated from specific and cation conductivity. The chemical-free water treatment plant consists of softening, reverse osmosis and electro-deionisation. The operational experience shows that the cycle chemistry is not within the guidelines due to major problems with the operation of the power plant. These problems have made it impossible to reach steady state and thereby not viable to fully verify and validate the concept with robust instrumentation. From readings on the panel of the online analysers some conclusions may be drawn, e.g. the differential pH measurements have fulfilled the expectations. The other on-line analysers have been working satisfactorily apart from contamination with turbine oil, which has been noticed at least twice. The corrosion monitors seem to be working but the lack of trend curves from the mainframe computer system makes it hard to draw any clear conclusions. The chemical-free water treatment has met all

  19. FY 2000 report on the results of the research and development project for the photon-aided instrumentation and processing technologies. R and D of the high-performance maintenance technologies for power generation plants; 2000 nendo photon keisoku kako gijutsu seika hokokusho. Hatsuden shisetsuyo kokino maintenance gijutsu kaihatsu

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2001-03-01

    Described herein are the FY 2000 results of development of the photon-aided instrumentation and processing technologies, as part of the R and D of the high-performance maintenance technologies for power generation plants. Production of the fine, functional circuits is studied for microscopic processing technology. The light source with variable wavelength-in a range of 2 to 5{mu}m for the solid-state laser, to measure concentration and composition of gases by the infrared absorption laser. The photon wave front compensator is being developed, to prevent disturbance-induced sensitivity deterioration for measurement of high temperature by the laser-aided ultrasonic instrumentation. The prototype of superconducting X-ray detector is developed, for high-sensitivity detection of impurities by measuring fluorescent X-ray. Development of the 10kW-class solid-state, rod-type laser is started for high-speed, high-precision laser-aided welding and cutting, and output of 11.3kW and electrical/optical conversion efficiency of 21.5% are achieved. An electrical/optical conversion efficiency of 17% is also achieved with the slab-type laser. An all-solid-state laser is being developed. It will produce high-energy pulses and high-quality beams capable of generating the beams which are converged very finely on the work with an average output power of 1KW (fundamental wave) and electrical/optical conversion efficiency of at least 20%. (NEDO)

  20. Some emergency instrumentation

    Energy Technology Data Exchange (ETDEWEB)

    Burgess, P H

    1986-10-01

    The widespread release of activity and the resultant spread of contamination after the Chernobyl accident resulted in requests to NRPB to provide instruments for, and expertise in, the measurement of radiation. The most common request was for advice on the usefulness of existing instruments, but Board staff were also involved in their adaptation or in the development of new instruments specially to meet the circumstances of the accident. The accident occurred on 26 April. On 1 May, NRPB was involved at Heathrow Airport in the monitoring of the British students who had returned from Kiev and Minsk. The main purpose was to reassure the students by checking that their persons and belongings did not have significant surface contamination. Additional measurements were also made of iodine activity in thyroid using hand-held detectors or a mobile body monitor. This operation was arranged with the Foreign and Commonwealth Office, which had also received numerous requests for instruments from embassies and consulates in countries close to the scene of the accident. There was concern for the well-being of staff and other United Kingdom nationals who resided in or intended to visit the most affected countries. The board supplied suitable instruments, and the FCO distributed them to embassies. The frequency of environmental monitoring was increased from 29 April in anticipation of contamination and appropriate Board instrumentation was deployed. After the Chernobyl cloud arrived in the UK on 2 May, there were numerous requests from local government, public authorities, private companies and members of the public for information and advice on monitoring equipment and procedures. Some of these requirements could be met with existing equipment but members of the public were usually advised not to proceed. At a later stage, the contamination of foodstuffs and livestock required the development of an instrument capable of detecting low levels of {sup 137}Cs and {sup 134}Cs in food

  1. Reactor instrumentation and control

    International Nuclear Information System (INIS)

    Wach, D.; Beraha, D.

    1980-01-01

    The methods for measuring radiation are shortly reviewed. The instrumentation for neutron flux measurement is classified into out-of-core and in-core instrumentation. The out-of-core instrumentation monitors the operational range from the subcritical reactor to full power. This large range is covered by several measurement channels which derive their signals from counter tubes and ionization chambers. The in-core instrumentation provides more detailed information on the power distribution in the core. The self-powered neutron detectors and the aeroball system in PWR reactors are discussed. Temperature and pressure measurement devices are briefly discussed. The different methods for leak detection are described. In concluding the plant instrumentation part some new monitoring systems and analysis methods are presented: early failure detection methods by noise analysis, acoustic monitoring and vibration monitoring. The presentation of the control starts from an qualitative assessment of the reactor dynamics. The chosen control strategy leads to the definition of the part-load diagram, which provides the set-points for the different control systems. The tasks and the functions of these control systems are described. In additiion to the control, a number of limiting systems is employed to keep the reactor in a safe operating region. Finally, an outlook is given on future developments in control, concerning mainly the increased application of process computers. (orig./RW)

  2. Instrumental analysis, second edition

    International Nuclear Information System (INIS)

    Christian, G.D.; O'Reilly, J.E.

    1988-01-01

    The second edition of Instrumental Analysis is a survey of the major instrument-based methods of chemical analysis. It appears to be aimed at undergraduates but would be equally useful in a graduate course. The volume explores all of the classical quantitative methods and contains sections on techniques that usually are not included in a semester course in instrumentation (such as electron spectroscopy and the kinetic methods). Adequate coverage of all of the methods contained in this book would require several semesters of focused study. The 25 chapters were written by different authors, yet the style throughout the book is more uniform than in the earlier edition. With the exception of a two-chapter course in analog and digital circuits, the book purports to de-emphasize instrumentation, focusing more on the theory behind the methods and the application of the methods to analytical problems. However, a detailed analysis of the instruments used in each method is by no means absent. The book has the favor of a user's guide to analysis

  3. Biochemistry Instrumentation Core Technology Center

    Data.gov (United States)

    Federal Laboratory Consortium — The UCLA-DOE Biochemistry Instrumentation Core Facility provides the UCLA biochemistry community with easy access to sophisticated instrumentation for a wide variety...

  4. Heat Flux Instrumentation Laboratory (HFIL)

    Data.gov (United States)

    Federal Laboratory Consortium — Description: The Heat Flux Instrumentation Laboratory is used to develop advanced, flexible, thin film gauge instrumentation for the Air Force Research Laboratory....

  5. Characteristics of protective instrumentation

    International Nuclear Information System (INIS)

    Reichart, G.

    1982-01-01

    Protective Instrumentation (PI) for Nuclear Power Plants (NPP) is a general term for an highly reliable instrumentation, which provides information for keeping the system within safe limits, for initation of countermeasures in the case of an incident or for mitigation of consequences of an accident. In German NPPs one can find a hierarchical structure of protective instrumentation, wherein the Reactor Protection System (RPS) has the highest priority. To meet the reliability requirements different design principles are used, like - redundancy - diversity - fail safe - decoupling. The presentation gives an overview about the different design principles and characterizes their reliability aspects. As an example for the technical realization the RPS of a German NPP is discussed in some detail. Furthermore some information about other type of PI is given and reliability aspects of the interaction of operating personell with these systems are mentioned. (orig.)

  6. Aethalometer™ Instrument Handbook

    Energy Technology Data Exchange (ETDEWEB)

    Sedlacek, Arthur J. [Brookhaven National Lab. (BNL), Upton, NY (United States)

    2016-04-01

    The Aethalometer is an instrument that provides a real-time readout of the concentration of “Black” or “Elemental” carbon aerosol particles (BC or E) in an air stream (see Figure 1 and Figure 2). It is a self-contained instrument that measures the rate of change of optical transmission through a spot on a filter where aerosol is being continuously collected and uses the information to calculate the concentration of optically absorbing material in the sampled air stream. The instrument measures the transmitted light intensities through the “sensing” portion of the filter, on which the aerosol spot is being collected, and a “reference” portion of the filter as a check on the stability of the optical source. A mass flowmeter monitors the sample air flow rate. The data from these three measurements is used to determine the mean BC content of the air stream.

  7. The IKARUS instrument

    International Nuclear Information System (INIS)

    Gerster, H.J.; Stein, G.

    1994-01-01

    When the Federal Government decided on a 25% reduction of CO 2 emissions till 2005 in 1990 the necessity resulted that an instrument has to be developed for the analysis and assessment of the ecological, economic and energetic impact of different reduction strategies. The development task was awarded by the BMFT to the Research Centre Juelich in cooperation with well-known institutions of energy system research. The total instrument is scheduled to be finished by the end of 1994. For the decentral use of the instrument by a wide specialist public the developed models and data banks which are equipped with a user-friendly surface are suited for larger PCs (486, 16 MB RAM/500-1000 MB ROM). (orig.) [de

  8. ISSUERS OF FINANCIAL INSTRUMENTS

    Directory of Open Access Journals (Sweden)

    Cristian GHEORGHE

    2016-05-01

    Full Text Available The rules laid down by Romanian Capital Market Law and the regulations put in force for its implementation apply to issuers of financial instruments admitted to trading on the regulated market established in Romania. But the issuers remain companies incorporated under Company Law of 1990. Such dual regulations need increased attention in order to observe the legal status of the issuers/companies and financial instruments/shares. Romanian legislator has chosen to implement in Capital Market Law special rules regarding the administration of the issuers of financial instruments, not only rules regarding admitting and maintaining to a regulated market. Thus issuers are, in Romanian Law perspective, special company that should comply special rule regarding board of administration and general shareholders meeting.

  9. Research and realization of signal simulation on virtual instrument

    Science.gov (United States)

    Zhao, Qi; He, Wenting; Guan, Xiumei

    2010-02-01

    In the engineering project, arbitrary waveform generator controlled by software interface is needed by simulation and test. This article discussed the program using the SCPI (Standard Commands For Programmable Instruments) protocol and the VISA (Virtual Instrument System Architecture) library to control the Agilent signal generator (Agilent N5182A) by instrument communication over the LAN interface. The program can conduct several signal generations such as CW (continuous wave), AM (amplitude modulation), FM (frequency modulation), ΦM (phase modulation), Sweep. As the result, the program system has good operability and portability.

  10. Virtual Sensor Test Instrumentation

    Science.gov (United States)

    Wang, Roy

    2011-01-01

    Virtual Sensor Test Instrumentation is based on the concept of smart sensor technology for testing with intelligence needed to perform sell-diagnosis of health, and to participate in a hierarchy of health determination at sensor, process, and system levels. A virtual sensor test instrumentation consists of five elements: (1) a common sensor interface, (2) microprocessor, (3) wireless interface, (4) signal conditioning and ADC/DAC (analog-to-digital conversion/ digital-to-analog conversion), and (5) onboard EEPROM (electrically erasable programmable read-only memory) for metadata storage and executable software to create powerful, scalable, reconfigurable, and reliable embedded and distributed test instruments. In order to maximize the efficient data conversion through the smart sensor node, plug-and-play functionality is required to interface with traditional sensors to enhance their identity and capabilities for data processing and communications. Virtual sensor test instrumentation can be accessible wirelessly via a Network Capable Application Processor (NCAP) or a Smart Transducer Interlace Module (STIM) that may be managed under real-time rule engines for mission-critical applications. The transducer senses the physical quantity being measured and converts it into an electrical signal. The signal is fed to an A/D converter, and is ready for use by the processor to execute functional transformation based on the sensor characteristics stored in a Transducer Electronic Data Sheet (TEDS). Virtual sensor test instrumentation is built upon an open-system architecture with standardized protocol modules/stacks to interface with industry standards and commonly used software. One major benefit for deploying the virtual sensor test instrumentation is the ability, through a plug-and-play common interface, to convert raw sensor data in either analog or digital form, to an IEEE 1451 standard-based smart sensor, which has instructions to program sensors for a wide variety of

  11. ICFA: Instrumentation school

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1987-10-15

    74 students, including 45 from developing countries, ten lecturers and nine laboratory instructors participated in the novel instrumentation school held in June at the International Centre for Theoretical Physics (ICTP), Trieste, Italy, sponsored by ICTP and arranged through the Instrumentation Panel of the International Committee for Future Accelerators (ICF). During the two weeks of the course, students had the chance to construct and test a proportional chamber, measure the lifetime of cosmic ray muons, operate and analyse the performance of an 8-wire imaging drift chamber, or study noise and signal processing using a silicon photodiode.

  12. Interfacing to accelerator instrumentation

    International Nuclear Information System (INIS)

    Shea, T.J.

    1995-01-01

    As the sensory system for an accelerator, the beam instrumentation provides a tremendous amount of diagnostic information. Access to this information can vary from periodic spot checks by operators to high bandwidth data acquisition during studies. In this paper, example applications will illustrate the requirements on interfaces between the control system and the instrumentation hardware. A survey of the major accelerator facilities will identify the most popular interface standards. The impact of developments such as isochronous protocols and embedded digital signal processing will also be discussed

  13. Spectroelectrochemical Instrument Measures TOC

    Science.gov (United States)

    Kounaves, Sam

    2011-01-01

    A spectroelectrochemical instrument has been developed for measuring the total organic carbon (TOC) content of an aqueous solution. Measurements of TOC are frequently performed in environmental, clinical, and industrial settings. Until now, techniques for performing such measurements have included, various ly, the use of hazardous reagents, ultraviolet light, or ovens, to promote reactions in which the carbon contents are oxidized. The instrument now being developed is intended to be a safer, more economical means of oxidizing organic carbon and determining the TOC levels of aqueous solutions and for providing a low power/mass unit for use in planetary missions.

  14. Neutron multiplication measurement instrument

    International Nuclear Information System (INIS)

    Nixon, K.V.; Dowdy, E.J.; France, S.W.; Millegan, D.R.; Robba, A.A.

    1983-01-01

    The Advanced Nuclear Technology Group of the Los Alamos National Laboratory is now using intelligent data-acquisition and analysis instrumentation for determining the multiplication of nuclear material. Earlier instrumentation, such as the large NIM-crate systems, depended on house power and required additional computation to determine multiplication or to estimate error. The portable, battery-powered multiplication measurement unit, with advanced computational power, acquires data, calculates multiplication, and completes error analysis automatically. Thus, the multiplication is determined easily and an available error estimate enables the user to judge the significance of results

  15. Standard NIM instrumentation system

    International Nuclear Information System (INIS)

    1990-05-01

    NIM is a standard modular instrumentation system that is in wide use throughout the world. As the NIM system developed and accommodations were made to a dynamic instrumentation field and a rapidly advancing technology, additions, revisions and clarifications were made. These were incorporated into the standard in the form of addenda and errata. This standard is a revision of the NIM document, AEC Report TID-20893 (Rev. 4) dated July 1974. It includes all the addenda and errata items that were previously issued as well as numerous additional items to make the standard current with modern technology and manufacturing practice

  16. Virtual Reality Musical Instruments

    DEFF Research Database (Denmark)

    Serafin, Stefania; Erkut, Cumhur; Kojs, Juraj

    2016-01-01

    The rapid development and availability of low-cost technologies have created a wide interest in virtual reality. In the field of computer music, the term “virtual musical instruments” has been used for a long time to describe software simulations, extensions of existing musical instruments......, and ways to control them with new interfaces for musical expression. Virtual reality musical instruments (VRMIs) that include a simulated visual component delivered via a head-mounted display or other forms of immersive visualization have not yet received much attention. In this article, we present a field...

  17. ICFA: Instrumentation school

    International Nuclear Information System (INIS)

    Anon.

    1987-01-01

    74 students, including 45 from developing countries, ten lecturers and nine laboratory instructors participated in the novel instrumentation school held in June at the International Centre for Theoretical Physics (ICTP), Trieste, Italy, sponsored by ICTP and arranged through the Instrumentation Panel of the International Committee for Future Accelerators (ICF). During the two weeks of the course, students had the chance to construct and test a proportional chamber, measure the lifetime of cosmic ray muons, operate and analyse the performance of an 8-wire imaging drift chamber, or study noise and signal processing using a silicon photodiode

  18. Instrumentation Cables Test Plan

    Energy Technology Data Exchange (ETDEWEB)

    Muna, Alice Baca [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); LaFleur, Chris Bensdotter [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2016-10-01

    A fire at a nuclear power plant (NPP) has the potential to damage structures, systems, and components important to safety, if not promptly detected and suppressed. At Browns Ferry Nuclear Power Plant on March 22, 1975, a fire in the reactor building damaged electrical power and control systems. Damage to instrumentation cables impeded the function of both normal and standby reactor coolant systems, and degraded the operators’ plant monitoring capability. This event resulted in additional NRC involvement with utilities to ensure that NPPs are properly protected from fire as intended by the NRC principle design criteria (i.e., general design criteria 3, Fire Protection). Current guidance and methods for both deterministic and performance based approaches typically make conservative (bounding) assumptions regarding the fire-induced failure modes of instrumentation cables and those failure modes effects on component and system response. Numerous fire testing programs have been conducted in the past to evaluate the failure modes and effects of electrical cables exposed to severe thermal conditions. However, that testing has primarily focused on control circuits with only a limited number of tests performed on instrumentation circuits. In 2001, the Nuclear Energy Institute (NEI) and the Electric Power Research Institute (EPRI) conducted a series of cable fire tests designed to address specific aspects of the cable failure and circuit fault issues of concern1. The NRC was invited to observe and participate in that program. The NRC sponsored Sandia National Laboratories to support this participation, whom among other things, added a 4-20 mA instrumentation circuit and instrumentation cabling to six of the tests. Although limited, one insight drawn from those instrumentation circuits tests was that the failure characteristics appeared to depend on the cable insulation material. The results showed that for thermoset insulated cables, the instrument reading tended to drift

  19. Celadon Figurines Play Instruments

    Institute of Scientific and Technical Information of China (English)

    1995-01-01

    This group of figurines, each 0.15m tall, were unearthed from a Tang Dynasty tomb in Changsha in 1977. Music was very developed in the Tang Dynasty. Colorful musical instruments and dances were popular both among the people and in the palace. These vivid-looking figurines wear pleated skirts with small sleeves and open chest, a style influenced by the non-Han nationalities living in the north and west of China. Some of the musical instruments were brought from the Western Regions. The figurines are playing the xiao (a vertical bamboo flute), the konghou (an

  20. Inspector-instrument interface in portable NDA instrumentation

    International Nuclear Information System (INIS)

    Halbig, J.K.; Klosterbuer, S.F.

    1981-01-01

    Recent electronics technology advances make it possible to design sophisticated instruments in small packages for convenient field implementation. An inspector-instrument interface design that allows communication of procedures, responses, and results between the instrument and user is presented. This capability has been incorporated into new spent-fuel instrumentation and a battery-powered multichannel analyzer

  1. Inspector-instrument interface in portable NDA instrumentation

    International Nuclear Information System (INIS)

    Halbig, J.K.; Klosterbuer, S.F.

    1981-01-01

    Recent electronics technology advances make it possible to design sophisticated instruments in small packages for convenient field implementation. This report describes an inspector-instrument interface design which allows communication of procedures, responses, and results between the instrument and user. The interface has been incorporated into new spent-fuel instrumentation and a battery-powered multichannel analyzer

  2. Human factors aspects of advanced instrumentation in the nuclear industry

    International Nuclear Information System (INIS)

    Carter, R.J.

    1989-01-01

    An important consideration in regards to the use of advanced instrumentation in the nuclear industry is the interface between the instrumentation system and the human. A survey, oriented towards identifying the human factors aspects of digital instrumentation, was conducted at a number of United States (US) and Canadian nuclear vendors and utilities. Human factors issues, subsumed under the categories of computer-generated displays, controls, organizational support, training, and related topics were identified. 20 refs., 2 tabs

  3. University Reactor Instrumentation Program

    International Nuclear Information System (INIS)

    Vernetson, W.G.

    1992-11-01

    Recognizing that the University Reactor Instrumentation Program was developed in response to widespread needs in the academic community for modernization and improvement of research and training reactors at institutions such as the University of Florida, the items proposed to be supported by this grant over its two year period have been selected as those most likely to reduce foreed outages, to meet regulatory concerns that had been expressed in recent years by Nuclear Regulatory Commission inspectors or to correct other facility problems and limitations. Department of Energy Grant Number DE-FG07-90ER129969 was provided to the University of Florida Training Reactor(UFTR) facility through the US Department of Energy's University Reactor Instrumentation Program. The original proposal submitted in February, 1990 requested support for UFTR facility instrumentation and equipment upgrades for seven items in the amount of $107,530 with $13,800 of this amount to be the subject of cost sharing by the University of Florida and $93,730 requested as support from the Department of Energy. A breakdown of the items requested and total cost for the proposed UFTR facility instrumentation and equipment improvements is presented

  4. Neutron instrumentation for biology

    Energy Technology Data Exchange (ETDEWEB)

    Mason, S.A. [Institut Laue-Langevin, Grenoble (France)

    1994-12-31

    In the October 1994 round of proposals at the ILL, the external biology review sub- committee was asked to allocate neutron beam time to a wide range of experiments, on almost half the total number of scheduled neutron instruments: on 3 diffractometers, on 3 small angle scattering instruments, and on some 6 inelastic scattering spectrometers. In the 3.5 years since the temporary reactor shutdown, the ILL`s management structure has been optimized, budgets and staff have been trimmed, the ILL reactor has been re-built, and many of the instruments up-graded, many powerful (mainly Unix) workstations have been introduced, and the neighboring European Synchrotron Radiation Facility has established itself as the leading synchrotron radiation source and has started its official user program. The ILL reactor remains the world`s most intense dedicated neutron source. In this challenging context, it is of interest to review briefly the park of ILL instruments used to study the structure and energetics of small and large biological systems. A brief summary will be made of each class of experiments actually proposed in the latest ILL proposal round.

  5. The ozone monitoring instrument

    NARCIS (Netherlands)

    Levelt, P.F.; Oord, G.H.J. van den; Dobber, M.R.; Mälkki, A.; Visser, H.; Vries, J. de; Stammes, P.; Lundell, J.O.V.; Saari, H.

    2006-01-01

    The Ozone Monitoring Instrument (OMI) flies on the National Aeronautics and Space Adminsitration's Earth Observing System Aura satellite launched in July 2004. OMI is a ultraviolet/visible (UV/VIS) nadir solar backscatter spectrometer, which provides nearly global coverage in one day with a spatial

  6. Economic Policy Instruments

    DEFF Research Database (Denmark)

    Klemmensen, Børge

    2007-01-01

    Økonomiske instrumenter begrundes med behovet for politiske indgreb, der muliggør internaliseringen af omkostningerne ved de miljøpåvirkninger, produktion and levevis afstedkommer, således at hensyntagen til miljøet bliver en del af virksomheders og husholdningers omkostninger og dermed en tilsky...

  7. Radiometric well logging instruments

    International Nuclear Information System (INIS)

    Davydov, A.V.

    1975-01-01

    The technical properties of well instruments for radioactive logging used in the radiometric logging complexes PKS-1000-1 (''Sond-1'') and PRKS-2 (''Vitok-2'') are described. The main features of the electric circuit of the measuring channels are given

  8. Advanced instrumentation and teleoperation

    International Nuclear Information System (INIS)

    Decreton, M.

    1998-01-01

    SCK-CEN's advanced instrumentation and teleoperation project aims at evaluating the potential of a telerobotic approach in a nuclear environment and, in particular, the use of remote-perception systems. Main achievements in 1997 in the areas of R and D on radiation tolerance for remote sensing, optical fibres and optical-fibre sensors, and computer-aided teleoperation are reported

  9. Health physics instrumentation needs

    International Nuclear Information System (INIS)

    Selby, J.M.; Swinth, K.L.; Kenoyer, J.L.

    1984-10-01

    Deficiencies and desirable improvements can be identified in every technical area in which health physics instruments are employed. The needed improvements cover the full spectrum including long-term reliability, human factors, accuracy, ruggedness, ease of calibration, improved radiation response, and improved mixed field response. Some specific areas of deficiency noted along with needed improvements. 17 references

  10. Virtual reality musical instruments

    DEFF Research Database (Denmark)

    Serafin, Stefania; Erkut, Cumhur; Kojs, Juraj

    2016-01-01

    The rapid development and availability of low cost technologies has created a wide interest in virtual reality (VR), but how to design and evaluate multisensory interactions in VR remains as a challenge. In this paper, we focus on virtual reality musical instruments, present an overview of our...

  11. Creating a Super Instrument

    DEFF Research Database (Denmark)

    Kallionpää, Maria; Gasselseder, Hans-Peter

    2015-01-01

    Thanks to the development of new technology, musical instruments are no more tied to their existing acoustic or technical limitations as almost all parameters can be augmented or modified in real time. An increasing number of composers, performers, and computer programmers have thus become intere...

  12. CMO Site: Ocean Instrumentation

    Science.gov (United States)

    1997-02-01

    Precipitation , Lightning, Visibility 0150 A InterOcea Hawser Strain 1.. systems, inc. and more... n 1946 3540 aero court san diego ca 92123-1799 usa phone: (619...AGU’s Microgal culture Association, P.O. Box 1004, April 8-10, 1997-Underwater Gravimetry : Instruments, Observa- Niland, CA 92257; (619) 359-3474

  13. Instrumentation in thermoluminescence dosimetry

    International Nuclear Information System (INIS)

    Julius, H.W.

    1986-01-01

    In the performance of a thermoluminescence dosimetry (TLD) system the equipment plays an important role. Crucial parameters of instrumentation in TLD are discussed in some detail. A review is given of equipment available on the market today - with some emphasis on automation - which is partly based on information from industry and others involved in research and development. (author)

  14. Ion chamber instrument

    International Nuclear Information System (INIS)

    Stephan, D.H.

    1975-01-01

    An electrical ionization chamber is described having a self-supporting wall of cellular material which is of uniform areal density and formed of material, such as foamed polystyrene, having an average effective atomic number between about 4 and about 9, and easily replaceable when on the instrument. (auth)

  15. Integrating Nephelometer Instrument Handbook

    Energy Technology Data Exchange (ETDEWEB)

    Uin, J. [Brookhaven National Lab. (BNL), Upton, NY (United States)

    2016-03-01

    The Integrating Nephelometer (Figure 1) is an instrument that measures aerosol light scattering. It measures aerosol optical scattering properties by detecting (with a wide angular integration – from 7 to 170°) the light scattered by the aerosol and subtracting the light scattered by the carrier gas, the instrument walls and the background noise in the detector (zeroing). Zeroing is typically performed for 5 minutes every day at midnight UTC. The scattered light is split into red (700 nm), green (550 nm), and blue (450 nm) wavelengths and captured by three photomultiplier tubes. The instrument can measure total scatter as well as backscatter only (from 90 to 170°) (Heintzenberg and Charlson 1996; Anderson et al. 1996; Anderson and Ogren 1998; TSI 3563 2015) At ARM (Atmospheric Radiation Measurement), two identical Nephelometers are usually run in series with a sample relative humidity (RH) conditioner between them. This is possible because Nephelometer sampling is non-destructive and the sample can be passed on to another instrument. The sample RH conditioner scans through multiple RH values in cycles, treating the sample. This kind of setup allows to study how aerosol particles’ light scattering properties are affected by humidification (Anderson et al. 1996). For historical reasons, the two Nephelometers in this setup are labeled “wet” and “dry”, with the “dry” Nephelometer usually being the one before the conditioner and sampling ambient air (the names are switched for the MAOS measurement site due to the high RH of the ambient air).

  16. Measurement and Instrumentation

    Energy Technology Data Exchange (ETDEWEB)

    Kirkham, Harold

    2018-01-02

    This is a chapter for a book called the Standard Handbook for Electrical Engineering. Though it is not obvious from the title, the book deals mainly with power engineering. The first chapter (not mine) is about the fundamental quantities used in measurement. This chapter is about the process and the instrumentation.

  17. Analytical chemistry instrumentation

    International Nuclear Information System (INIS)

    Laing, W.R.

    1986-01-01

    In nine sections, 48 chapters cover 1) analytical chemistry and the environment 2) environmental radiochemistry 3) automated instrumentation 4) advances in analytical mass spectrometry 5) fourier transform spectroscopy 6) analytical chemistry of plutonium 7) nuclear analytical chemistry 8) chemometrics and 9) nuclear fuel technology

  18. CRISP instrument manual

    International Nuclear Information System (INIS)

    Bucknall, D.G.; Langridge, Sean

    1997-05-01

    This document is a user manual for CRISP, one of the two neutron reflectomers at ISIS. CRISP is highly automated allowing precision reproducible measurements. The manual provides detailed instructions for the setting-up and running of the instrument and advice on data analysis. (UK)

  19. Instruments to measure behavioural and psychological symptoms of dementia.

    Science.gov (United States)

    van der Linde, Rianne M; Stephan, Blossom C M; Dening, Tom; Brayne, Carol

    2014-03-01

    Reliable and valid measurement of behavioural and psychological symptoms of dementia (BPSD) is important for research and clinical practice. Here we provide an overview of the different instruments and discuss issues involved in the choice of the most appropriate instrument to measure BPSD in research. A list of BPSD instruments was generated. For each instrument Pubmed and SCOPUS were searched for articles that reported on their use or quality. Eighty-three instruments that are used to measure BPSD were identified. Instruments differ in length and detail, whether the interview is with participants, informants or by observation, the target sample and the time frames for use. Reliability and validity is generally good, but reported in few independent samples. When choosing a BPSD instrument for research the research question should be carefully scrutinised and the symptoms of interest, population, quality, detail, time frame and practical issues should be considered. Copyright © 2014 John Wiley & Sons, Ltd.

  20. The Science of String Instruments

    CERN Document Server

    Rossing, Thomas D

    2010-01-01

    Many performing musicians, as well as instrument builders, are coming to realize the importance of understanding the science of musical instruments. This book explains how string instruments produce sound. It presents basic ideas in simple language, and it also translates some more sophisticated ideas in non-technical language. It should be of interest to performers, researchers, and instrument makers alike.

  1. The Overtone Fiddle: an Actuated Acoustic Instrument

    DEFF Research Database (Denmark)

    Overholt, Daniel

    2011-01-01

    both traditional violin techniques, as well as extended playing techniques that incorporate shared man/machine control of the resulting sound. A magnetic pickup system is mounted to the end of the fiddle’s fingerboard in order to detect the signals from the vibrating strings, deliberately not capturing...... vibrations from the full body of the instrument. This focused sensing approach allows less restrained use of DSP-generated feedback signals, as there is very little direct leakage from the actuator embedded in the body of the instrument back to the pickup....

  2. Radon-daughter chamber instrumentation system reference manual

    International Nuclear Information System (INIS)

    Showalter, R.; Johnson, L.

    1985-01-01

    The radon-daughter chamber instrumentation system collects environmental data from the radon-daughter chamber. These data are then recorded on a Tandberg system tape cartridge and transmitted to the HP-1000 computer for processing. Generators which inject radon and condensation nuclei into the chamber are also included with the instrumentation system

  3. Distributed Framework for Dynamic Telescope and Instrument Control

    Science.gov (United States)

    Ames, Troy J.; Case, Lynne

    2002-01-01

    been working with the Submillimetre High Angular Resolution Camera IInd Generation (SHARCII) at the CSO to investigate using IRC capabilities with the SHARC instrument.

  4. New GOES satellite synchronized time code generation

    Science.gov (United States)

    Fossler, D. E.; Olson, R. K.

    1984-01-01

    The TRAK Systems' GOES Satellite Synchronized Time Code Generator is described. TRAK Systems has developed this timing instrument to supply improved accuracy over most existing GOES receiver clocks. A classical time code generator is integrated with a GOES receiver.

  5. netherland hydrological modeling instrument

    Science.gov (United States)

    Hoogewoud, J. C.; de Lange, W. J.; Veldhuizen, A.; Prinsen, G.

    2012-04-01

    Netherlands Hydrological Modeling Instrument A decision support system for water basin management. J.C. Hoogewoud , W.J. de Lange ,A. Veldhuizen , G. Prinsen , The Netherlands Hydrological modeling Instrument (NHI) is the center point of a framework of models, to coherently model the hydrological system and the multitude of functions it supports. Dutch hydrological institutes Deltares, Alterra, Netherlands Environmental Assessment Agency, RWS Waterdienst, STOWA and Vewin are cooperating in enhancing the NHI for adequate decision support. The instrument is used by three different ministries involved in national water policy matters, for instance the WFD, drought management, manure policy and climate change issues. The basis of the modeling instrument is a state-of-the-art on-line coupling of the groundwater system (MODFLOW), the unsaturated zone (metaSWAP) and the surface water system (MOZART-DM). It brings together hydro(geo)logical processes from the column to the basin scale, ranging from 250x250m plots to the river Rhine and includes salt water flow. The NHI is validated with an eight year run (1998-2006) with dry and wet periods. For this run different parts of the hydrology have been compared with measurements. For instance, water demands in dry periods (e.g. for irrigation), discharges at outlets, groundwater levels and evaporation. A validation alone is not enough to get support from stakeholders. Involvement from stakeholders in the modeling process is needed. There fore to gain sufficient support and trust in the instrument on different (policy) levels a couple of actions have been taken: 1. a transparent evaluation of modeling-results has been set up 2. an extensive program is running to cooperate with regional waterboards and suppliers of drinking water in improving the NHI 3. sharing (hydrological) data via newly setup Modeling Database for local and national models 4. Enhancing the NHI with "local" information. The NHI is and has been used for many

  6. Developments in analytical instrumentation

    Science.gov (United States)

    Petrie, G.

    The situation regarding photogrammetric instrumentation has changed quite dramatically over the last 2 or 3 years with the withdrawal of most analogue stereo-plotting machines from the market place and their replacement by analytically based instrumentation. While there have been few new developments in the field of comparators, there has been an explosive development in the area of small, relatively inexpensive analytical stereo-plotters based on the use of microcomputers. In particular, a number of new instruments have been introduced by manufacturers who mostly have not been associated previously with photogrammetry. Several innovative concepts have been introduced in these small but capable instruments, many of which are aimed at specialised applications, e.g. in close-range photogrammetry (using small-format cameras); for thematic mapping (by organisations engaged in environmental monitoring or resources exploitation); for map revision, etc. Another innovative and possibly significant development has been the production of conversion kits to convert suitable analogue stereo-plotting machines such as the Topocart, PG-2 and B-8 into fully fledged analytical plotters. The larger and more sophisticated analytical stereo-plotters are mostly being produced by the traditional mainstream photogrammetric systems suppliers with several new instruments and developments being introduced at the top end of the market. These include the use of enlarged photo stages to handle images up to 25 × 50 cm format; the complete integration of graphics workstations into the analytical plotter design; the introduction of graphics superimposition and stereo-superimposition; the addition of correlators for the automatic measurement of height, etc. The software associated with this new analytical instrumentation is now undergoing extensive re-development with the need to supply photogrammetric data as input to the more sophisticated G.I.S. systems now being installed by clients, instead

  7. Data acquisition instruments: Psychopharmacology

    Energy Technology Data Exchange (ETDEWEB)

    Hartley, D.S. III

    1998-01-01

    This report contains the results of a Direct Assistance Project performed by Lockheed Martin Energy Systems, Inc., for Dr. K. O. Jobson. The purpose of the project was to perform preliminary analysis of the data acquisition instruments used in the field of psychiatry, with the goal of identifying commonalities of data and strategies for handling and using the data in the most advantageous fashion. Data acquisition instruments from 12 sources were provided by Dr. Jobson. Several commonalities were identified and a potentially useful data strategy is reported here. Analysis of the information collected for utility in performing diagnoses is recommended. In addition, further work is recommended to refine the commonalities into a directly useful computer systems structure.

  8. Social Responsibility Instruments

    Directory of Open Access Journals (Sweden)

    Katarzyna Mizera

    2008-09-01

    Full Text Available Responsible business notion is more and more present in Polish economy, however the results of the research carried out in Polish business still shows a low level of CRS idea knowledge, especially in small and medium companies. Although responsible business notion is generally known, its details, ways of preparing strategy, instruments and what is more its benefits are still narrowly spread. Many business people face the lack of knowledge and information, which on one hand make it easier to spread and deepen wrong stereotypes connected with this notion and on the other hand make business people unwilling to implement CRS in their companies. The subjects of this article are examples of instruments which are responsible for realization of social responsibility strategy.

  9. Radon-Instrumentation

    International Nuclear Information System (INIS)

    Moreno y Moreno, A.

    2003-01-01

    The presentation of the active and passive methods for radon, their identification and measure, instrumentation and characteristics are the objectives of this work. Active detectors: Active Alpha Cam Continuous Air Monitor, Model 758 of Victoreen, Model CMR-510 Continuous Radon Monitor of the Signature Femto-Tech. Passive detectors: SSNTD track detectors in solids Measurement Using Charcoal Canisters, disk of activated coal deposited in a metallic box Electrets Methodology. (Author)

  10. Testing Aircraft Instruments.

    Science.gov (United States)

    1981-02-11

    1. Have test data been collected, recorded, and presented in accordance with this TOP? Yes No Comment : 2. Were the facilities, test equipment...instrumentation, and support accommodations adequate to accomplish the test objectives? Yes No Comment : 3. Have all data collected been reviewed for...correctness and completeness? Yes No Comment : 4. Were the test results compromised in any way due to insufficient test planning? Yes No Comment : 5. Were the

  11. Transgressive or Instrumental?

    DEFF Research Database (Denmark)

    Chemi, Tatiana

    2018-01-01

    Contemporary practices that connect the arts with learning are widespread at all level of educational systems and in organisations, but they include very diverse approaches, multiple methods and background values. Regardless of explicit learning benefits, the arts/learning partnerships bring about...... creativity and the other on practices of arts-integration. My final point rests on the belief that the opposition of transgression and instrumentality is a deceiving perspective on the arts, against the background of the aesthetic plurality and hybridity....

  12. Mandolin Family Instruments

    Science.gov (United States)

    Cohen, David J.; Rossing, Thomas D.

    The mandolin family of instruments consists of plucked chordophones, each having eight strings in four double courses. With the exception of the mandobass, the courses are tuned in intervals of fifths, as are the strings in violin family instruments. The soprano member of the family is the mandolin, tuned G3-D4-A4-E5. The alto member of the family is the mandola, tuned C3-G3-D4-A4. The mandola is usually referred to simply as the mandola in the USA, but is called the tenor mandola in Europe. The tenor member of the family is the octave mandolin, tuned G2-D3-A3-E4. It is referred to as the octave mandolin in the USA, and as the octave mandola in Europe. The baritone member of the family is the mandocello, or mandoloncello, tuned C2-G2-D3-A3. A variant of the mandocello not common in the USA is the five-course liuto moderno, or simply liuto, designed for solo repertoire. Its courses are tuned C2-G2-D3-A3-E4. A mandobass was also made by more than one manufacturer during the early twentieth century, though none are manufactured today. They were fretted instruments with single string courses tuned E1-A1-D2-G2. There are currently a few luthiers making piccolo mandolins, tuned C4-G4-D5-A5.

  13. Nuclear reactor instrumentation

    International Nuclear Information System (INIS)

    Duncombe, E.; McGonigal, G.

    1976-01-01

    Reference is made to the instrumentation of liquid metal cooled fast reactors. In order to ensure the safe operation of such reactors it is necessary to constantly monitor the coolant flowing through the fuel assemblies for temperature and rate of flow, requiring a large number of sensors. An improved and simplified arrangement is claimed in which the fuel assemblies feed a fraction of coolant to three instrument units arranged to sense the temperature and rate of flow of samples of coolant. Each instrument unit comprises a sleeve housing a sensing unit and has a number of inlet ducts arranged for receiving coolant from a fuel assembly together with a single outlet. The sensing unit has three thermocouple hot junctions connected in series, the hot junctions and inlet ducts being arranged in pairs. Electromagnetic windings around an inductive core are arranged to sense variation in flow of liquid metal by flux distortion. Fission product sensing means may also be provided. Full constructional details are given. (U.K.)

  14. Development of Multichannel Eddy Current Testing Instrument

    International Nuclear Information System (INIS)

    Lee, Hee Jong; Cho, Chan Hee; Nam, Min Woo; Yoon, Byung Sik; Yoo, Hyun Joo

    2010-01-01

    Four main techniques of electromagnetic testing are used for commercial applications: eddy current testing, alternating current field testing, magnetic flux leakage testing and remote field testing. Eddy current testing is a nondestructive evaluation method, which makes eddy current flow on a specimen by applying driving pulse to eddy current probe coil, by using eddy current testing device, and makes the change of eddy current which is dependently caused by flaws, material characteristics, testing condition, receiving through eddy current, and analyzes material properties, flaws, status on the specimen. Application of EC instrumentation varies widely in industry from the identification of metal heat treatment to the inspection of steam generator tubing in nuclear power plants. In this study, we have designed multichannel EC instrument which can be applicable to the NDE of the tube in heat exchanger for electric power facility, chemistry, and military industry, and finally confirmed the proper function of EC instrumentation

  15. Borehole instrument for scintillation gamma spectrometer

    International Nuclear Information System (INIS)

    Sinitsyn, A.Ya.; Gabitov, R.M.

    1979-01-01

    Described are a schematic diagram and main specifications of a borehole instrument with autostabilization of energy scale measure by gamma bench-mark of 137 Cs, intended for the application in a logging gamma spectrometer to determine separately the concentrations of nature radioactive elements. The instrument may be connected to the KOBDFM-2 cable of 600 m length. It contains a scintillation counter for gamma quanta consisting of 30x70 mm NaI(Tl) crystal and a FEU-85 photoamplifier, an input conforming stage, a diagram of threshold pulse formation and regulating high-voltage generator. The borehole instrument has been proved under laboratory and field conditions at 10-40 deg C

  16. First Experience with the LHC Cryogenic Instrumentation

    CERN Document Server

    Vauthier, N; Balle, Ch; Casas-Cubillos, J; Ciechanowski, M; Fernandez-Penacoba, G; Fortescue-Beck, E; Gomes, P; Jeanmonod, N; Lopez-Lorente, A; Suraci, A

    2008-01-01

    The LHC under commissioning at CERN will be the world's largest superconducting accelerator and therefore makes extensive use of cryogenic instruments. These instruments are installed in the tunnel and therefore have to withstand the LHC environment that imposes radiation-tolerant design and construction. Most of the instruments require individual calibration; some of them exhibit several variants as concerns measuring span; all relevant data are therefore stored in an Oracle® database. Those data are used for the various quality assurance procedures defined for installation and commissioning, as well as for generating tables used by the control system to configure automatically the input/output channels. This paper describes the commissioning of the sensors and the corresponding electronics, the first measurement results during the cool-down of one machine sector; it discusses the different encountered problems and their corresponding solutions.

  17. Advances in instrumentation for nuclear astrophysics

    Directory of Open Access Journals (Sweden)

    S. D. Pain

    2014-04-01

    Full Text Available The study of the nuclear physics properties which govern energy generation and nucleosynthesis in the astrophysical phenomena we observe in the universe is crucial to understanding how these objects behave and how the chemical history of the universe evolved to its present state. The low cross sections and short nuclear lifetimes involved in many of these reactions make their experimental determination challenging, requiring developments in beams and instrumentation. A selection of developments in nuclear astrophysics instrumentation is discussed, using as examples projects involving the nuclear astrophysics group at Oak Ridge National Laboratory. These developments will be key to the instrumentation necessary to fully exploit nuclear astrophysics opportunities at the Facility for Rare Isotope Beams which is currently under construction.

  18. Instrumentation, Control, and Intelligent Systems

    Energy Technology Data Exchange (ETDEWEB)

    2005-09-01

    Abundant and affordable energy is required for U.S. economic stability and national security. Advanced nuclear power plants offer the best near-term potential to generate abundant, affordable, and sustainable electricity and hydrogen without appreciable generation of greenhouse gases. To that end, Idaho National Laboratory (INL) has been charged with leading the revitalization of nuclear power in the U.S. The INL vision is to become the preeminent nuclear energy laboratory with synergistic, world-class, multi-program capabilities and partnerships by 2015. The vision focuses on four essential destinations: (1) Be the preeminent internationally-recognized nuclear energy research, development, and demonstration laboratory; (2) Be a major center for national security technology development and demonstration; (3) Be a multi-program national laboratory with world-class capabilities; (4) Foster academic, industry, government, and international collaborations to produce the needed investment, programs, and expertise. Crucial to that effort is the inclusion of research in advanced instrumentation, control, and intelligent systems (ICIS) for use in current and advanced power and energy security systems to enable increased performance, reliability, security, and safety. For nuclear energy plants, ICIS will extend the lifetime of power plant systems, increase performance and power output, and ensure reliable operation within the system's safety margin; for national security applications, ICIS will enable increased protection of our nation's critical infrastructure. In general, ICIS will cost-effectively increase performance for all energy security systems.

  19. Instrumentation, Control, and Intelligent Systems

    International Nuclear Information System (INIS)

    Not Available

    2005-01-01

    Abundant and affordable energy is required for U.S. economic stability and national security. Advanced nuclear power plants offer the best near-term potential to generate abundant, affordable, and sustainable electricity and hydrogen without appreciable generation of greenhouse gases. To that end, Idaho National Laboratory (INL) has been charged with leading the revitalization of nuclear power in the U.S. The INL vision is to become the preeminent nuclear energy laboratory with synergistic, world-class, multi-program capabilities and partnerships by 2015. The vision focuses on four essential destinations: (1) Be the preeminent internationally-recognized nuclear energy research, development, and demonstration laboratory; (2) Be a major center for national security technology development and demonstration; (3) Be a multi-program national laboratory with world-class capabilities; (4) Foster academic, industry, government, and international collaborations to produce the needed investment, programs, and expertise. Crucial to that effort is the inclusion of research in advanced instrumentation, control, and intelligent systems (ICIS) for use in current and advanced power and energy security systems to enable increased performance, reliability, security, and safety. For nuclear energy plants, ICIS will extend the lifetime of power plant systems, increase performance and power output, and ensure reliable operation within the system's safety margin; for national security applications, ICIS will enable increased protection of our nation's critical infrastructure. In general, ICIS will cost-effectively increase performance for all energy security systems

  20. Instrumentation for environmental monitoring: biomedical

    International Nuclear Information System (INIS)

    1979-05-01

    An update is presented to Volume four of the six-volume series devoted to a survey of instruments useful for measurements in biomedicine related to environmental research and monitoring. Results of the survey are given as descriptions of the physical and operating characteristics of available instruments, critical comparisons among instrumentation methods, and recommendations of promising methodology and development of new instrumentation. Methods of detection and analysis of gaseous organic pollutants and metals, including Ni and As are presented. Instrument techniques and notes are included on atomic spectrometry and uv and visible absorption instrumentation

  1. Payment Instrument Characteristics

    DEFF Research Database (Denmark)

    Holst, Jacques; Kjeldsen, Martin; Hedman, Jonas

    2015-01-01

    Over the last decade, we have witnessed payment innovations that fundamentally have changed the ways we pay. Payment innovations, such as mobile payments and on-line banking, include characteristics or features that are essential to understand if we want to know how and why payers choose among...... payment innovations. Using the Repertory Grid technique to explore 15 payers’ perception of six payment instruments, including coins, banknotes, debit cards, credit cards, mobile payments, and on-line banking, we identify 16 payment characteristics. The characteristics aggregate seventy-six unique...

  2. Operational Test Instrumentation Guide.

    Science.gov (United States)

    1981-11-01

    System. A topographic, transit-level measuring system, instrumented with altimeter, clinometers, compasses , and an alidade, plane table, and stadia rod...dual hangar 250 x 135 feet with two door openings, 80 feet each. There is no compass swing base, no electronic landing aids, ro aircraft wash or...month) of SDG &E) Haybarn Canyon 15,000 6,183,870 Lan Pulgas 1,500 433,890 Las Pulgas Well #41621 100 4,258 Las Pulgas Well #41611 150 7,548 Las Flores

  3. Beam Instrumentation and Diagnostics

    CERN Document Server

    Strehl, Peter

    2006-01-01

    This treatise covers all aspects of the design and the daily operations of a beam diagnostic system for a large particle accelerator. A very interdisciplinary field, it involves contributions from physicists, electrical and mechanical engineers and computer experts alike so as to satisfy the ever-increasing demands for beam parameter variability for a vast range of operation modi and particles. The author draws upon 40 years of research and work, most of them spent as the head of the beam diagnostics group at GSI. He has illustrated the more theoretical aspects with many real-life examples that will provide beam instrumentation designers with ideas and tools for their work.

  4. Instrumentation for tomograph positioning

    International Nuclear Information System (INIS)

    Frenkel, A.D.B.; Castello Branco, L.M.; Reznik, D.S.; Santos, C.A.C.; Borges, J.C.

    1986-01-01

    The COPPE's Nuclear Instrumentation Lab. has been developing researches directed towards the implementation of a Computer-Based Tomography System. Basically, the system reported in this paper can be divided into three major parts: the mechanical part, responsible for the physical movement (Stepper-Motors, table, etc.); the electronic part, which controls the mechanical part and handles the data-acquisition process (microcomputer, interfaces, etc.); and finally, the support of a software-oriented system, including control programs and information processing routines. (Author) [pt

  5. Easy instrumental analysis

    International Nuclear Information System (INIS)

    Ko, Myeong Su; Kim, Tae Hwa; Park, Gyu Hyeon; Yang, Jong Beom; Oh, Chang Hwan; Lee, Kyoung Hye

    2010-04-01

    This textbook describes instrument analysis in easy way with twelve chapters. The contents of the book are pH measurement on principle, pH meter, pH measurement, examples of the experiments, centrifugation, Absorptiometry, Fluorescent method, Atomic absorption analysis, Gas-chromatography, Gas chromatography-mass spectrometry, High performance liquid chromatography liquid chromatograph-mass spectrometry, Electrophoresis on practical case and analysis of the result and examples, PCR on principle, device, application and examples and Enzyme-linked immunosorbent assay with indirect ELISA, sandwich ELISA and ELISA reader.

  6. Maintenance of nuclear instruments

    International Nuclear Information System (INIS)

    Oliveira Rebelo, A.M. de; Santos, C.J.F. dos; Jesus, E.F.O. de; Silva, L.E.M.C.; Borges, J.C.

    1988-01-01

    A program to design and repairing of nuclear instruments for teaching and research was founded in the UFRJ to find solutions for technical support problem - The GEMD-RADIACOES. This group has assisted to several groups of the University in recuperation and conservation of devices like: Linear scanner, Cromatograph and system of radiation detection in general. Recuperation of these devices had required a study of theirs operations modes, to make it possible the setting up of a similar system. Recuperation also involves operation tests, calibration and technical for users, orienting them to get the best performance. (Author) [pt

  7. Easy instrumental analysis

    Energy Technology Data Exchange (ETDEWEB)

    Ko, Myeong Su; Kim, Tae Hwa; Park, Gyu Hyeon; Yang, Jong Beom; Oh, Chang Hwan; Lee, Kyoung Hye

    2010-04-15

    This textbook describes instrument analysis in easy way with twelve chapters. The contents of the book are pH measurement on principle, pH meter, pH measurement, examples of the experiments, centrifugation, Absorptiometry, Fluorescent method, Atomic absorption analysis, Gas-chromatography, Gas chromatography-mass spectrometry, High performance liquid chromatography liquid chromatograph-mass spectrometry, Electrophoresis on practical case and analysis of the result and examples, PCR on principle, device, application and examples and Enzyme-linked immunosorbent assay with indirect ELISA, sandwich ELISA and ELISA reader.

  8. Instruments of Transformative Governance

    DEFF Research Database (Denmark)

    Borrás, Susana

    production and distribution channels. PDPs aim at overcoming current market and government failures by pooling resources in the attempt to solve this global social challenge. Thus, PDPs are a case of instruments of transformative research and innovation, operating in a transnational governance context....... They exhibit three novelties: they address strategic long-term problems in a holistic manner, set substantive output-oriented goals, and are implemented through new organizational structures. After characterizing the different types of current PDPs and the context in which they emerged, the paper examines...

  9. Diamonds for beam instrumentation

    International Nuclear Information System (INIS)

    Griesmayer, Erich

    2013-01-01

    Diamond is perhaps the most versatile, efficient and radiation tolerant material available for use in beam detectors with a correspondingly wide range of applications in beam instrumentation. Numerous practical applications have demonstrated and exploited the sensitivity of diamond to charged particles, photons and neutrons. In this paper, a brief description of a generic diamond detector is given and the interaction of the CVD diamond detector material with protons, electrons, photons and neutrons is presented. Latest results of the interaction of sCVD diamond with 14 MeV mono-energetic neutrons are shown.

  10. Pesticide reducing instruments

    DEFF Research Database (Denmark)

    Jacobsen, Lars-Bo; Jensen, Jørgen Dejgård; Andersen, Martin

    2005-01-01

    -mentioned models and tools. All three scenarios are constructed such that they result in the same welfare implication (measured by national consumption in the CGE model). The scenarios are: 1) pesticide taxes resulting in a 25 percent overall reduction; 2) use of unsprayed field margins, resulting in the same...... for improving bio-diversity and securing drinking water. That is, combining economic modeling with physical biological modeling and geological evaluation allows us to select unsprayed field margins as the most effective instrument. Sensitivity analysis conducted on bio-diversity suggest that this result...

  11. Programming for a nuclear reactor instrument simulation

    International Nuclear Information System (INIS)

    Cohn, C.

    1988-01-01

    This note discusses 8086/8087 machine-language programming for simulation of nuclear reactor instrument current inputs by means of a digital-analog converter (DAC) feeding a bank of series input resistors. It also shows FORTRAN programming for generating the parameter tales used in the simulation. These techniques would be generally useful for high-speed simulation of quantities varying over many orders of magnitude

  12. Calibration of radiation monitoring instruments

    International Nuclear Information System (INIS)

    1973-01-01

    Radiation protection is dependent on good radiation monitoring, and properly calibrated instruments are essential for this work. Simple procedures for periodically checking and recalibrating different kinds of radiation monitoring instruments are shown in this training film

  13. Calibration of "Babyline" RP instruments

    CERN Multimedia

    2015-01-01

      If you have old RP instrumentation of the “Babyline” type, as shown in the photo, please contact the Radiation Protection Group (Joffrey Germa, 73171) to have the instrument checked and calibrated. Thank you. Radiation Protection Group

  14. Calibration of radiation monitoring instruments

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1974-12-31

    Radiation protection is dependent on good radiation monitoring, and properly calibrated instruments are essential for this work. Simple procedures for periodically checking and recalibrating different kinds of radiation monitoring instruments are shown in this training film

  15. Instruments for Water Quality Monitoring

    Science.gov (United States)

    Ballinger, Dwight G.

    1972-01-01

    Presents information regarding available instruments for industries and agencies who must monitor numerous aquatic parameters. Charts denote examples of parameters sampled, testing methods, range and accuracy of test methods, cost analysis, and reliability of instruments. (BL)

  16. MC and A instrumentation catalog

    International Nuclear Information System (INIS)

    Neymotin, L.; Sviridova, V.

    1998-01-01

    In 1981 and 1985, two editions of a catalog of non-destructive nuclear measurement instrumentation, and material control and surveillance equipment, were published by Brookhaven National Laboratory (BNL). The last edition of the catalog included one hundred and twenty-five entries covering a wide range of devices developed in the US and abroad. More than ten years have elapsed since the publication of the more recent Catalog. Devices described in it have undergone significant modifications, and new devices have been developed. Therefore, in order to assist specialists in the field of Material Control and Accounting (MC and A), a new catalog has been created. Work on this instrumentation catalog started in 1997 as a cooperative effort of Brookhaven National Laboratory (BNL), operated by Brookhaven Science Associates under contract to the US Department of Energy, and the All-Russian Research Institute of Automatics (VNIIA), subordinate institute of the Atomic Energy Ministry of the Russian Federation, within the collaborative US-Russia Material Protection, Control, and Accounting (MPC and A) Program. Most of the equipment included in the Catalog are non-destructive assay (NDA) measurement devices employed for purposes of accounting, confirmation, and verification of nuclear materials. Other devices also included in the Catalog are employed in the detection and deterrence of unauthorized access to or removal of nuclear materials (material control: containment and surveillance). Equipment found in the Catalog comprises either: (1) complete devices or systems that can be used for MC and A applications; or (2) parts or components of complete systems, such as multi-channel analyzers, detectors, neutron generators, and software. All devices are categorized by their status of development--from prototype to serial production

  17. MC and A instrumentation catalog

    Energy Technology Data Exchange (ETDEWEB)

    Neymotin, L. [ed.] [Brookhaven National Lab., Upton, NY (United States); Sviridova, V. [ed.] [All-Russian Research Inst. of Automatics, Moscow (Russian Federation)

    1998-06-01

    In 1981 and 1985, two editions of a catalog of non-destructive nuclear measurement instrumentation, and material control and surveillance equipment, were published by Brookhaven National Laboratory (BNL). The last edition of the catalog included one hundred and twenty-five entries covering a wide range of devices developed in the US and abroad. More than ten years have elapsed since the publication of the more recent Catalog. Devices described in it have undergone significant modifications, and new devices have been developed. Therefore, in order to assist specialists in the field of Material Control and Accounting (MC and A), a new catalog has been created. Work on this instrumentation catalog started in 1997 as a cooperative effort of Brookhaven National Laboratory (BNL), operated by Brookhaven Science Associates under contract to the US Department of Energy, and the All-Russian Research Institute of Automatics (VNIIA), subordinate institute of the Atomic Energy Ministry of the Russian Federation, within the collaborative US-Russia Material Protection, Control, and Accounting (MPC and A) Program. Most of the equipment included in the Catalog are non-destructive assay (NDA) measurement devices employed for purposes of accounting, confirmation, and verification of nuclear materials. Other devices also included in the Catalog are employed in the detection and deterrence of unauthorized access to or removal of nuclear materials (material control: containment and surveillance). Equipment found in the Catalog comprises either: (1) complete devices or systems that can be used for MC and A applications; or (2) parts or components of complete systems, such as multi-channel analyzers, detectors, neutron generators, and software. All devices are categorized by their status of development--from prototype to serial production.

  18. Nuclear instrumentation for research reactors

    International Nuclear Information System (INIS)

    Hofer, Carlos G.; Pita, Antonio; Verrastro, Claudio A.; Maino, Eduardo J.

    1997-01-01

    The nuclear instrumentation for research reactors in Argentina was developed in 70'. A gradual modernization of all the nuclear instrumentation is planned. It includes start-up and power range instrumentation, as well as field monitors, clamp, scram and rod movement control logic. The new instrumentation is linked to a computer network, based on real time operating system for data acquisition, display and logging. This paper describes the modules and whole system aspects. (author). 2 refs

  19. The QUIET Instrument

    Energy Technology Data Exchange (ETDEWEB)

    Bischoff, C.; et al.

    2012-07-01

    The Q/U Imaging ExperimenT (QUIET) is designed to measure polarization in the Cosmic Microwave Background, targeting the imprint of inflationary gravitational waves at large angular scales ({approx}1{sup o}). Between 2008 October and 2010 December, two independent receiver arrays were deployed sequentially on a 1.4m side-fed Dragonian telescope. The polarimeters which form the focal planes use a highly compact design based on High Electron Mobility Transistors (HEMTs) that provides simultaneous measurements of the Stokes parameters Q, U, and I in a single module. The 17-element Q-band polarimeter array, with a central frequency of 43.1 GHz, has the best sensitivity (69 {mu}Ks{sup 1/2}) and the lowest instrumental systematic errors ever achieved in this band, contributing to the tensor-to-scalar ratio at r < 0:1. The 84-element W-band polarimeter array has a sensitivity of 87 {mu}Ks{sup 1/2} at a central frequency of 94.5 GHz. It has the lowest systematic errors to date, contributing at r < 0:01. The two arrays together cover multipoles in the range {ell} {approx} 25 -- 975. These are the largest HEMT-based arrays deployed to date. This article describes the design, calibration, performance of, and sources of systematic error for the instrument.

  20. Nuclear electronic instrumentation

    International Nuclear Information System (INIS)

    Ramirez J, F. J.

    2010-01-01

    The activities carried out in the Instituto Nacional de Investigaciones Nucleares (ININ) in the field of the nuclear electronic instrumentation included those activities corresponding to the design and production of nuclear instruments in a first stage, as well as the internal activities of design, repair and maintenance that have supported to other projects of the institution during many years. It is mentioned of the presence and constant collaboration of the ININ with the IAEA in different projects and programs. Also, it is mentioned on the establishment of the Radiation Detectors Laboratory, which for their characteristics and repair capacities of radiation detectors of cooled semiconductor, it is only in their specialty. It is emphasized the investigation and the development in the field of new radiation detectors and applications, as well as the important contribution in this field, in institutions like: Mexican Petroleum, National Commission of Nuclear Safety and Safeguards and Federal Commission of Electricity. Finally a position of the future of these activities is made, considering the speed of the advances of the electronic and nuclear technology. (Author)

  1. Neutron instrumentation system

    International Nuclear Information System (INIS)

    Akiyama, Takao; Arita, Setsuo; Yuchi, Hiroyuki

    1989-01-01

    The neutron instrumentation system of this invention can greatly reduce the possibility that the shutdown flux is increased greater than a predetermiend value to cause scram due to vibrations caused by earthquakes or shocks in the neutron instrumentation system without injuring the reactor safety. That is, a sensor having a zero sensitivity to a neutron flux which is an object to be detected by the sensor (dummy sensor) is used together with a conventional sensor (a sensor having predetermined sensitivity to a neutron flux as an object to be measured ----- true sensor). Further, identical signal transmission cables, connector and the signal processing circuits are used for both of true sensor and the dummy sensor. The signal from the dummy sensor is subtracted from the signal from the true sensor at the output of the signal processing circuit. Since the output of the dummy sensor is zero during normal operation, the subtracted value is the same as the value from the true sensor. If the true sensor causes an output with the reason other than the neutron flux, this is outputted also from the dummy sensor but does not appear in the subtracted value. (I.S.)

  2. Incore instrument device

    International Nuclear Information System (INIS)

    Sakima, Naoki

    1996-01-01

    An incore instrument device has an integrally disposed touch panel having a function of displaying an operation indication method such as for setting of conditions for incore measurement and information processing and results of the incore measurement and a function capable of conducting operation indication such as for setting conditions and information processing for incore measurement relative to a control section upon touching an information position on a displayed information. In addition, an information processing section comprising a man-machine function program formed so as to recognize the content of the operation indication for the incore measurement by touching and let the control section to conduct it is disposed to the outside by way of a communication interface. In addition, a programming device is disposed for forming and rewriting the program of the man-machine function relative to the information processing section. Then, when various indication operations are conducted upon performing incore measurement, a view point can be concentrated to one predetermined point thereby enabling to improve the operationability without danger. In addition, the programming of the man-machine function does not apply unnecessary load to the control section in the incore instrumentation device. (N.H.)

  3. Balances instruments, manufacturers, history

    CERN Document Server

    Robens, Erich; Kiefer, Susanne

    2014-01-01

    The book deals mainly with direct mass determination by means of a conventional balances. It covers the history of the balance from the beginnings in Egypt earlier than 3000 BC to recent developments. All balance types are described with emphasis on scientific balances. Methods of indirect mass determination, which are applied to very light objects like molecules and the basic particles of matter and celestial bodies, are included.  As additional guidance, today’s manufacturers are listed and the profile of important companies is reviewed. Several hundred photographs, reproductions and drawings show instruments and their uses. This book includes commercial weighing instruments for merchandise and raw materials in workshops as well as symbolic weighing in the ancient Egyptian’s ceremony of ‘Weighing of the Heart’, the Greek fate balance, the Roman  Justitia, Juno Moneta and Middle Ages scenes of the Last Judgement with Jesus or St. Michael and of modern balances. The photographs are selected from the...

  4. Advancements in Actuated Musical Instruments

    DEFF Research Database (Denmark)

    Overholt, Daniel; Berdahl, Edgar; Hamilton, Robert

    2011-01-01

    are physical instruments that have been endowed with virtual qualities controlled by a computer in real-time but which are nevertheless tangible. These instruments provide intuitive and engaging new forms of interaction. They are different from traditional (acoustic) and fully automated (robotic) instruments...

  5. Rio de Janeiro: Instrumentation school

    International Nuclear Information System (INIS)

    Anon.

    1990-01-01

    Students from Latin America were able to get hands-on experience in state-of-the-art physics instrumentation in this year's School on Instrumentation for High Energy Physics organized by the active Instrumentation Panel of ICFA (the International Committee for Future Accelerators) at the Centro Brasileiro de Pesquicas Fisicas (CBPF), Rio de Janeiro, in July

  6. Instrument Remote Control via the Astronomical Instrument Markup Language

    Science.gov (United States)

    Sall, Ken; Ames, Troy; Warsaw, Craig; Koons, Lisa; Shafer, Richard

    1998-01-01

    The Instrument Remote Control (IRC) project ongoing at NASA's Goddard Space Flight Center's (GSFC) Information Systems Center (ISC) supports NASA's mission by defining an adaptive intranet-based framework that provides robust interactive and distributed control and monitoring of remote instruments. An astronomical IRC architecture that combines the platform-independent processing capabilities of Java with the power of Extensible Markup Language (XML) to express hierarchical data in an equally platform-independent, as well as human readable manner, has been developed. This architecture is implemented using a variety of XML support tools and Application Programming Interfaces (API) written in Java. IRC will enable trusted astronomers from around the world to easily access infrared instruments (e.g., telescopes, cameras, and spectrometers) located in remote, inhospitable environments, such as the South Pole, a high Chilean mountaintop, or an airborne observatory aboard a Boeing 747. Using IRC's frameworks, an astronomer or other scientist can easily define the type of onboard instrument, control the instrument remotely, and return monitoring data all through the intranet. The Astronomical Instrument Markup Language (AIML) is the first implementation of the more general Instrument Markup Language (IML). The key aspects of our approach to instrument description and control applies to many domains, from medical instruments to machine assembly lines. The concepts behind AIML apply equally well to the description and control of instruments in general. IRC enables us to apply our techniques to several instruments, preferably from different observatories.

  7. Nanosecond electron beam generation and instrumentation at SLAC

    International Nuclear Information System (INIS)

    Koontz, R.F.; Miller, R.H.

    1975-01-01

    The present SLAC injector system, including the latest beam chopping equipment, is discussed, and an updated diagram is given. The present equipment can produce almost any mix of chopped and single bunch beams for experimenters with a high degree of multiple beam compatibility. Topics covered include the grid pulsers, the pulse isolation transformers, the resonant choppers, the nonresonant chopper, the synchronization system, and the fast beam monitors. (PMA)

  8. Architectures and assessment of next-generation CMB polarization instruments

    Data.gov (United States)

    National Aeronautics and Space Administration — Cosmological inflation predicts a background of gravitational waves that imprint a characteristic polarized pattern on the CMB. This signal is degraded by...

  9. Optical technology: a new generation of instrument transformer

    Energy Technology Data Exchange (ETDEWEB)

    Klimek, A.

    2003-07-01

    The advantages of optical sensors to measure current and voltage are discussed. They combine the typical benefits of high accuracy, wide dynamic range, high bandwidth, reduced weight and size, safety and low maintenance, with the environmental benefits derived from not using SF{sub 6} or oil paper insulation. Fibre-optic based current and voltage sensors such as the NxtPhase NXVCT voltage and current sensor, are an increasingly vital part of measurement and control systems installed by utilities throughout North America. With an inherently digital signal, optical sensors are capable of being utilized in ways that are not possible with analog signals; they make possible an all-encompassing digital substation with digital communication between voltage and current sensors, relays, SCADA functions, breakers and switches.

  10. Next Generation UV Coronagraph Instrumentation for Solar Cycle ...

    Indian Academy of Sciences (India)

    ultraviolet coronagraph observations provide the constraints needed to test ... and suprathermal seed particle populations needed for CME shock acceleration ... region magnetic loops, is it ambient coronal gas compressed by a shock, or is it a.

  11. Focal plane for the next generation of earth observation instruments

    Science.gov (United States)

    Pranyies, P.; Toubhans, I.; Badoil, B.; Tanguy, F.; Descours, Francis

    2017-09-01

    Sodern is the French focal plane provider for Earth Observation (EO) satellites. Since the 1980's, Sodern has played an active role first in the SPOT program. Within the two-spacecraft constellation Pleiades 1A/1B over the next years, Sodern introduced advanced technologies as Silicon Carbide (SiC) focal plane structure and multispectral strip filters dedicated to multiple-lines detectors.

  12. Embedded instrumentation architecture

    Science.gov (United States)

    Boyd, Gerald M.; Farrow, Jeffrey

    2015-09-29

    The various technologies presented herein relate to generating copies of an incoming signal, wherein each copy of the signal can undergo different processing to facilitate control of bandwidth demands during communication of one or more signals relating to the incoming signal. A signal sharing component can be utilized to share copies of the incoming signal between a plurality of circuits/components which can include a first A/D converter, a second A/D converter, and a comparator component. The first A/D converter can operate at a low sampling rate and accordingly generates, and continuously transmits, a signal having a low bandwidth requirement. The second A/D converter can operate at a high sampling rate and hence generates a signal having a high bandwidth requirement. Transmission of a signal from the second A/D converter can be controlled by a signaling event (e.g., a signal pulse) being determined to have occurred by the comparator component.

  13. Control of training instrument

    International Nuclear Information System (INIS)

    Seo, K. W.; Joo, Y. C.; Park, J. C.; Hong, C. S.; Choi, I. K.; Cho, B. J.; Lee, H. Y.; Seo, I. S.; Park, N. K.

    1996-01-01

    This report describes the annual results on control of training instrument. The scope and contents are the following: 1. Control of Compact Nuclear Simulator 2. Control of Radiation/Radioactivity Measurement 3. Control of Non-Destructive Testing Equipment 4. Control of Chemical Equipment 5. Control of Personal Computer 6. Other related Lecture Aid Equipment. Efforts were employed to upgrade the training environment through retrofitting experimental facilities, compiling teaching materials and reforcing audio-visual aids. The Nuclear Training Center executed the open-door training courses for 2,496 engineers/scientists from the nuclear regulatory, nuclear industries, research institutes and other related organizations by means of offering 45 training courses during the fiscal year 1995. (author). 15 tabs., 7 figs., 13 refs

  14. Portable musical instrument amplifier

    Science.gov (United States)

    Christian, David E.

    1990-07-24

    The present invention relates to a musical instrument amplifier which is particularly useful for electric guitars. The amplifier has a rigid body for housing both the electronic system for amplifying and processing signals from the guitar and the system's power supply. An input plug connected to and projecting from the body is electrically coupled to the signal amplifying and processing system. When the plug is inserted into an output jack for an electric guitar, the body is rigidly carried by the guitar, and the guitar is operatively connected to the electrical amplifying and signal processing system without use of a loose interconnection cable. The amplifier is provided with an output jack, into which headphones are plugged to receive amplified signals from the guitar. By eliminating the conventional interconnection cable, the amplifier of the present invention can be used by musicians with increased flexibility and greater freedom of movement.

  15. Instrument design and automation

    International Nuclear Information System (INIS)

    Wernlund, R.F.

    1984-01-01

    The ion mobility spectrometer-mass spectrometer (IMS-MS) is described and consists of two separate instruments coupled in tandem: an ion mobility spectrometer coupled to a quadrupole mass spectrometer. The two insturments operate at different pressures in a synergistic manner, supplying both drift time and mass information about ions which are formed at atmospheric pressure in the ion mobility spectrometer tube. Two types of ion intensity signals are presented to the data processor. The IMS produces an analog voltage with major components from dc to 5 KHz. The mass spectrometer signal output resides in the pulse count rate derived from a series of TTL level pulses where each pulse represents the arrival of a single ion. The hardware, software, interfacing capabilities and basic data acquisition program are described in detail

  16. FMIT diagnostic instrumentation

    International Nuclear Information System (INIS)

    Gilpatrick, J.D.; Chamberlin, D.D.

    1985-01-01

    The Fusion Materials Irradiation Test facility (FMIT) cw prototype accelerator has noninterceptive beamline instrumentation to measure beam parameters. The transverse emittances and beam profiles are measured with an array of photodiode sensors viewing light emitted from the beam region. Tomographic reconstructions of both spatial-density distributions and of transverse-emittance distributions are performed throughout a quadrupole focusing section. Beam bunches passing through capacitive probes produce bipolar waveforms whose zero crossing corresponds to the bunch's longitudinal centroid. By measuring the time required for a bunch to travel the known distance between two probes, velocity and energy are determined. A toroidal transformer measures the average ac beam current. Beam spill is measured by a set of movable jaws that intercept the beam edges. Each jaw contains a water flow channel whose flow rate and differential temperature are measured to derive a transverse power distribution. Beam centroid position is measured by a four-lobe, magnetic-loop pickup. 5 refs., 6 figs

  17. Instrumented Pipeline Initiative

    Energy Technology Data Exchange (ETDEWEB)

    Thomas Piro; Michael Ream

    2010-07-31

    This report summarizes technical progress achieved during the cooperative agreement between Concurrent Technologies Corporation (CTC) and U.S. Department of Energy to address the need for a for low-cost monitoring and inspection sensor system as identified in the Department of Energy (DOE) National Gas Infrastructure Research & Development (R&D) Delivery Reliability Program Roadmap.. The Instrumented Pipeline Initiative (IPI) achieved the objective by researching technologies for the monitoring of pipeline delivery integrity, through a ubiquitous network of sensors and controllers to detect and diagnose incipient defects, leaks, and failures. This report is organized by tasks as detailed in the Statement of Project Objectives (SOPO). The sections all state the objective and approach before detailing results of work.

  18. BOMBAY: Instrumentation school

    International Nuclear Information System (INIS)

    Anon.

    1993-01-01

    Full text: Promising students had a foretaste of the latest laboratory techniques at the ICFA 1993 India School on Instrumentation in High Energy Physics held from February 15-26 and hosted by the Tata Institute of Fundamental Research (TIFR), Bombay. The scientific programme was put together by the ICFA Panel for Future Instrumentation, Innovation and Development, chaired by Tord Ekelof (Uppsala). The programme included lectures and topical seminars covering a wide range of detector subjects. In small groups, students got acquainted with modern detector technologies in the laboratory sessions, using experimental setups assembled in various institutes world-wide and shipped to Bombay for the School. The techniques covered included multiwire proportional chambers for detection of particles and photons, gaseous detectors for UV photons and X-ray imaging, the study of charge drift in silicon detectors, measurement of the muon lifetime using liquid scintillators, tracking using scintillating fibres, and electronics for sensitive detectors. The India School was attended by around 80 students from 20 countries; 34 came from Indian universities. It was the fifth in this series, previous Schools having been at Trieste (1987, 1989 and 1991) organized by the ICFA Panel and hosted and sponsored by the International Centre for Theoretical Physics, and in 1990, organized at Rio de Janeiro in collaboration with the Centro Brasileiro de Pesquisas Fisicas. The School was jointly directed by Suresh Tonwar (TIFR), Fabio Sauli (CERN) and Marleigh Sheaff (University of Wisconsin), and sponsored by TIFR and DAE (India), CERN (Switzerland), ICTP and INFN (Italy), British Council and RAL (UK), NSF and DOE (USA), KEK (Japan), IPP (Canada) and DESY (Germany)

  19. Ideology as instrument.

    Science.gov (United States)

    Glassman, Michael; Karno, Donna

    2007-12-01

    Comments on the article by J. T. Jost, which argued that the end-of-ideology claims that emerged in the aftermath of World War II were both incorrect and detrimental to the field of political psychology. M. Glassman and D. Karno make three critical points. First, Jost objectified ideology as a grand strategy implemented at the individual level, rather than as an instrument used for a specific purpose in activity. In doing so, he set ideology up as an "object" that guides human behavior rather than as a rational part of human experience. Second, they take issue with the idea that, because somebody acts in a manner that can be categorized as ideological, there actually is such a thing as ideology separate from that event and/or political experience and that psychologists ought to understand the meaning of ideology in order to understand future human activities as outside observers. Third, Jost seems to see this objective ideology as a unidirectional, causal mechanism for activity, a mechanism that assumes individuals act according to ideology, which eclipses the possibility that immediate ideological positions are the residue of purposeful activity. Glassman and Karno suggest that it may be better to take a pluralistic view of ideology in human action. Where ideology does exist, it is as a purposeful instrument--part of a logically based action to meet some ends-in-view--a mixture of immediate goals tied to secondary belief systems (which have been integrated to serve the material purposes of the purveyors of these ideologies). So if we are to understand ideology, we can only understand it through its use in human activity. (Copyright) 2007 APA.

  20. Next-Generation Sequencing Platforms

    Science.gov (United States)

    Mardis, Elaine R.

    2013-06-01

    Automated DNA sequencing instruments embody an elegant interplay among chemistry, engineering, software, and molecular biology and have built upon Sanger's founding discovery of dideoxynucleotide sequencing to perform once-unfathomable tasks. Combined with innovative physical mapping approaches that helped to establish long-range relationships between cloned stretches of genomic DNA, fluorescent DNA sequencers produced reference genome sequences for model organisms and for the reference human genome. New types of sequencing instruments that permit amazing acceleration of data-collection rates for DNA sequencing have been developed. The ability to generate genome-scale data sets is now transforming the nature of biological inquiry. Here, I provide an historical perspective of the field, focusing on the fundamental developments that predated the advent of next-generation sequencing instruments and providing information about how these instruments work, their application to biological research, and the newest types of sequencers that can extract data from single DNA molecules.

  1. Dicty_cDB: VHE361 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nsnnnqptnfnsstsspilsgnnnnnnnnnnnnn nninnnnnnnsnnnnnmntsnptnqqssviisddmddvqtnxnppnpqyplspnsvnrgn npsnismsgaqrsapliisp...nqptnfnsstsspilsgnnnnnnnnnnnnn nninnnnnnnsnnnnnmntsnptnqqssviisddmddvqtnxnppnpqyplspnsvnrgn npsnismsgaqrsapliisp

  2. VHE gamma-rays from radio pulsars and cataclysmic variables

    International Nuclear Information System (INIS)

    De Jager, O.C.; Brink, C.; Meintjies, P.J.; Nel, H.I.; North, A.R.; Raubenheimer, B.C.; Van der Walt, D.J.

    1990-01-01

    We present the results of observations (above 1 TeV) of radio pulsars and cataclysmic variables with the Potchefstroom air Cerenkov facility. We were able to confirm our previous detection of PSR 1509-58 and the final significance is 1.7x10 -5 . A DC enhancement at the 10 -3 significance level was seen from the L 4 Lagrange position in the PSR 1957+20 system. This result was confirmed by COS-B data. We were also able to detect the 5.4 ms pulsar PSR 1855+09 at a marginal significance level of 5%. However, the best and longest observation indicates non-uniformity at the 0.005 significance level. The TeV light curve resembles the radio light curve. The latter is also reminiscent of other millisecond pulsar observed above 1 TeV. The intermediate polar AEAQR (P = 33.08s) shows a period shift which is consistent with recent model predictions. However, the present significance of this results does not allow an unambiguous claim. (orig.)

  3. Dicty_cDB: VHE211 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available F143854.1 Sinantherina socialis 82 kD heat shock protein (hsp82) gene, partial cd...Naegleria gruberi strain ATCC 30224 heat shock protein 90 (HSP-90) gene, partial cds. 86 3e-46 7 AF143854 |A

  4. Dicty_cDB: VHE632 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KKIFXFFFXKKK--- ---YKKLFINNIYIQWVTEHSKHTTVTT*aldtitsrpttvitiitltsisktteaklx* epiavntfqlvtinkftshttytvtnqxst*...tshttytvtnqxst*ntttvkxqskvittxtylltvtvmsxxpi ttiimlxskntsykqinkxkkk Homology vs CSM-cDNA Score E Sequences p

  5. Dicty_cDB: VHE841 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available niaqfvviq*kmkekkkil*llanivinqftix aikil*itlkmsxsfinvxivlvtsx*nxvgiigvveektpkkslgkrkkk Frame C: ---*n*merklym...l*xlffkrf**kikilpnl*sfnkr*rrrrrfynylpils*issrsl rskyyr*x*k*afhl*msxly**xanktx*e*l

  6. Dicty_cDB: VHE875 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 16 3 EL476245 |EL476245.1 CHUL4181.b1_J14.ab1 CHU(LMS) puzzle sunflower Helianthus paradoxus cDNA clone CHUL...4181, mRNA sequence. 72 1e-16 3 EL513430 |EL513430.1 CHUX465.b1_A21.ab1 CHU(XYZ) puzzle

  7. Dicty_cDB: VHE489 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) Value N EL477374 |EL477374.1 CHUL5577.b1_A04.ab1 CHU(LMS) puzzle sunflower Helianthus paradoxuscDNA clone ...CHUL5577, mRNA sequence. 52 0.015 1 EL474819 |EL474819.1 CHUL2764.b1_G19.ab1 CHU(LMS) puzzle

  8. Dicty_cDB: VHE642 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NA clone GR__Ea43H12 3', mRNA sequence. 58 6e-17 4 EL513430 |EL513430.1 CHUX465.b1_A21.ab1 CHU(XYZ) puzzle s...unflower Helianthus paradoxus cDNA clone CHUX465, mRNA sequence. 72 2e-16 4 EL476245 |EL476245.1 CHUL4181.b1_J14.ab1 CHU(LMS) puzzle

  9. Dicty_cDB: VHE271 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available -21 (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL157766 |pid:none) 105 3e-21 BC171956_1( BC171956 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 103 1e-20 BC138482_1( BC138482 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 103 1e-20 (Q9JLC8) RecName: Full=Sacsin; 103 1e-20 AB006708_10( AB006

  10. Dicty_cDB: VHE123 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nificant alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL157766 |pid:none) 105 4e-21 ...none) Micromonas sp. RCC299 chromosome... 103 1e-20 BC138482_1( BC138482 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 103 1e-20 (Q9JLC8) RecName: Full=Sacsin; 103 1e-20 BC171956_1( BC17...1956 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 103 1e-20 AB006708_10( AB006708 |pid:none) Arabidopsis

  11. Dicty_cDB: VHE487 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CNMS7844.b1_H17.ab1 CNM(LMS) spotted knapweed Centaurea maculosacDNA clone CNMS7844, mRNA sequence. 38 0.016... 2 EH740364 |EH740364.1 CNMS13648.b1_O04.ab1 CNM(LMS) spotted knapweed Centaurea maculosa cDNA clone CNMS136

  12. Dicty_cDB: VHE245 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4e-11 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 71 4e-11 AY892312_1( AY892312 |p... reading fra... 70 8e-11 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 70 8e-11 prot

  13. Dicty_cDB: VHE759 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 5 CX072513 |CX072513.1 UCRCS08_28E10_g Parent Washington Navel Orange Callus cDNA Library UCRCS08-2 Citrus s...72512.1 UCRCS08_28E10_b Parent Washington Navel Orange Callus cDNA Library UCRCS08-2 Citrus sinensis cDNA cl...inensis cDNA clone UCRCS08-28E10-J20-1-4.g, mRNA sequence. 46 1.5 1 CX072512 |CX0

  14. Dicty_cDB: VHE244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vliyfvehg*rpdlticqltm*hlmnlfnw**k*rdlil*fcdlfkgkh*pnnqnkk *vl*licnsd*yhdtcylha*lvdpasshmlvskikpcms... Frame A: vgkvliyfvehg*rpdlticqltm*hlmnlfnw**k*rdlil*fcdlfkgkh*pnnqnkk *vl*licnsd*yhdtcylha*lvdpasshmlvskikpcms

  15. Generating Units

    Data.gov (United States)

    Department of Homeland Security — Generating Units are any combination of physically connected generators, reactors, boilers, combustion turbines, and other prime movers operated together to produce...

  16. Field instrumentation for hydrofracturing stress measurements

    International Nuclear Information System (INIS)

    Bjarnason, Bjarni; Torikka, Arne.

    1989-08-01

    A recently developed system for rock stress measurements by the hydraulic fracturing method is documented in detail. The new equipment is intended for measurement in vertical or nearvertical boreholes, down to a maximum depth of 1000 m. The minimum borehole, diameter required is 56 mm. Downhole instrumentation comprises a straddle packer assembly for borehole fracturing, equipment for determination of fracture orientations and a pressure transducer. The downhole tools are operated by means of a multihose system, containing high pressure hydraulic tubings, signal cable and carrying wire into one hose unit. The surface components of the equipment include a system for generation and control of water pressures up to approximately 75 MPa, an hydraulically operated drum for the multihose and a data acquisition system. All surface instrumentation is permanently mounted on a truck, which also serves as power source for the instrumentation. In addition to the description of instrumentation, the theoretical fundament and the testing procedures associated with the hydraulic fracturing method are briefly outlined

  17. The XGS instrument on-board THESEUS

    International Nuclear Information System (INIS)

    Fuschino, F.; Baldazzi, G.; Rignanese, L. P.; Campana, R.; Labanti, C.; Marisaldi, M.; Amati, L.; Frontera, F.; Fiorini, M.; Uslenghi, M.; Evangelista, Y.; Feroci, M.; Elmi, I.; Rachevski, A.; Zampa, G.; Zampa, N.; Vacchi, A.; Rashevskaya, I.; Bellutti, P.; Piemonte, C.

    2016-01-01

    Consolidated techniques used for space-borne X-ray and gamma-ray instruments are based on the use of scintillators coupled to Silicon photo-detectors. This technology associated with modern very low noise read-out electronics allows the design of innovative architectures able to reduce drastically the system complexity and power consumption, also with a moderate-to-high number of channels. These detector architectures can be exploited in the design of space instrumentation for gamma-spectroscopy with the benefit of possible smart background rejection strategies. We describe a detector prototype with 3D imaging capabilities to be employed in future gamma-ray and particle space missions in the 0.002-100 MeV energy range. The instrument is based on a stack of scintillating bars read out by Silicon Drift Detectors (SDDs) at both ends. The spatial segmentation and the crystal double-side readout allow a 3D position reconstruction with ∼3 mm accuracy within the full active volume, using a 2D readout along the two external faces of the detector. Furthermore, one of the side of SDDs can be used simultaneously to detect X-rays in the 2-30 keV energy range. The characteristics of this instrument make it suitable in next generation gamma-ray and particle space missions for Earth or outer space observations, and it will be briefly illustrated. (paper)

  18. The XGS instrument on-board THESEUS

    Science.gov (United States)

    Fuschino, F.; Campana, R.; Labanti, C.; Marisaldi, M.; Amati, L.; Fiorini, M.; Uslenghi, M.; Baldazzi, G.; Evangelista, Y.; Elmi, I.; Feroci, M.; Frontera, F.; Rachevski, A.; Rignanese, L. P.; Vacchi, A.; Zampa, G.; Zampa, N.; Rashevskaya, I.; Bellutti, P.; Piemonte, C.

    2016-10-01

    Consolidated techniques used for space-borne X-ray and gamma-ray instruments are based on the use of scintillators coupled to Silicon photo-detectors. This technology associated with modern very low noise read-out electronics allows the design of innovative architectures able to reduce drastically the system complexity and power consumption, also with a moderate-to-high number of channels. These detector architectures can be exploited in the design of space instrumentation for gamma-spectroscopy with the benefit of possible smart background rejection strategies. We describe a detector prototype with 3D imaging capabilities to be employed in future gamma-ray and particle space missions in the 0.002-100 MeV energy range. The instrument is based on a stack of scintillating bars read out by Silicon Drift Detectors (SDDs) at both ends. The spatial segmentation and the crystal double-side readout allow a 3D position reconstruction with ∼3 mm accuracy within the full active volume, using a 2D readout along the two external faces of the detector. Furthermore, one of the side of SDDs can be used simultaneously to detect X-rays in the 2-30 keV energy range. The characteristics of this instrument make it suitable in next generation gamma-ray and particle space missions for Earth or outer space observations, and it will be briefly illustrated.

  19. Pancreatitis Quality of Life Instrument: Development of a new instrument

    Directory of Open Access Journals (Sweden)

    Wahid Wassef

    2014-02-01

    Full Text Available Objectives: The goal of this project was to develop the first disease-specific instrument for the evaluation of quality of life in chronic pancreatitis. Methods: Focus groups and interview sessions were conducted, with chronic pancreatitis patients, to identify items felt to impact quality of life which were subsequently formatted into a paper-and-pencil instrument. This instrument was used to conduct an online survey by an expert panel of pancreatologists to evaluate its content validity. Finally, the modified instrument was presented to patients during precognitive testing interviews to evaluate its clarity and appropriateness. Results: In total, 10 patients were enrolled in the focus groups and interview sessions where they identified 50 items. Once redundant items were removed, the 40 remaining items were made into a paper-and-pencil instrument referred to as the Pancreatitis Quality of Life Instrument. Through the processes of content validation and precognitive testing, the number of items in the instrument was reduced to 24. Conclusions: This marks the development of the first disease-specific instrument to evaluate quality of life in chronic pancreatitis. It includes unique features not found in generic instruments (economic factors, stigma, and spiritual factors. Although this marks a giant step forward, psychometric evaluation is still needed prior to its clinical use.

  20. Generational diversity.

    Science.gov (United States)

    Kramer, Linda W

    2010-01-01

    Generational diversity has proven challenges for nurse leaders, and generational values may influence ideas about work and career planning. This article discusses generational gaps, influencing factors and support, and the various generational groups present in today's workplace as well as the consequences of need addressing these issues. The article ends with a discussion of possible solutions.

  1. Industrial instrumentation principles and design

    CERN Document Server

    Padmanabhan, Tattamangalam R

    2000-01-01

    Pneumatic, hydraulic and allied instrumentation schemes have given way to electronic schemes in recent years thanks to the rapid strides in electronics and allied areas. Principles, design and applications of such state-of-the-art instrumentation schemes form the subject matter of this book. Through representative examples, the basic building blocks of instrumentation schemes are identified and each of these building blocks discussed in terms of its design and interface characteristics. The common generic schemes synthesized with such building blocks are dealt with subsequently. This forms the scope of Part I. The focus in Part II is on application. Displacement and allied instrumentation, force and allied instrumentation and process instrumentation in terms of temperature, flow, pressure level and other common process variables are dealt with separately and exhaustively. Despite the diversity in the sensor principles and characteristics and the variety in the applications and their environments, it is possib...

  2. Impact Disdrometers Instrument Handbook

    Energy Technology Data Exchange (ETDEWEB)

    Bartholomew, Mary Jane [Brookhaven National Lab. (BNL), Upton, NY (United States)

    2016-03-01

    To improve the quantitative description of precipitation processes in climate models, the U.S. Department of Energy’s Atmospheric Radiation Measurement (ARM) Climate Research Facility has been collecting observations of the drop size spectra of rain events since early in 2006. Impact disdrometers were the initial choice due to their reliability, ease of maintenance, and relatively low cost. Each of the two units deployed was accompanied by a nearby tipping bucket. In 2010, the tipping buckets were replaced by weighing buckets rain gauges. Five video disdrometers were subsequently purchased and are described in ARM’s VDIS Handbook.1 As of April 2011, three of the weighing bucket instruments were deployed, one was to travel with the second ARM Mobile Facility, and the fifth was a spare. Two of the video disdrometers were deployed, a third was to be deployed later in the spring of 2011, one was to travel with the second ARM Mobile Facility, and the last was a spare. Detailed descriptions of impact disdrometers and their datastreams are provided in this document.

  3. TFTR CAMAC instrumentation system

    International Nuclear Information System (INIS)

    Del Gatto, H.J.; Bradish, C.J.

    1983-01-01

    The TFTR Central Instrumentation Control and Data Acquisition (CICADA) system makes extensive use of CAMAC equipment. The system consists of eight CAMAC highways operating from eight Gould 75/32 computers. Links up to 3.5 miles in length with more than fifty CAMAC crates have been implemented and are currently in use. Data transfer along the highway is implemented in bit serial format. The link speed is run at 5MHz. The length and complexity of the link requires the reformatting of the NRZ input/output format of the L-2 crate controller. U-Port adapter modules are used to interface the modified serial highway to the L-2 controllers. The modified serial highway uses a transmission technique that requires the distribution of both Bi-Phase encoded data and a 5MHz clock. The Serial Driver interfaces to the GOULD computer through use of a High Speed Data (HSD) interface board which attaches to the computers internal bus. All transfers to and from the computer are accomplished by direct memory access (DMA). In addition to the standard CAMAC link the system also includes a Block Transfer (BT) system. This system provides an alternate path for transferring data between the computers and the CAMAC modules. The BT system is interfaced to the host computers through HSD boards and to the CAMAC crates through use of an auxiliary crate controllers

  4. Measurement, instrumentation, and sensors handbook

    CERN Document Server

    Eren, Halit

    2014-01-01

    The Second Edition of the bestselling Measurement, Instrumentation, and Sensors Handbook brings together all aspects of the design and implementation of measurement, instrumentation, and sensors. Reflecting the current state of the art, it describes the use of instruments and techniques for performing practical measurements in engineering, physics, chemistry, and the life sciences and discusses processing systems, automatic data acquisition, reduction and analysis, operation characteristics, accuracy, errors, calibrations, and the incorporation of standards for control purposes. Organized acco

  5. Experimenting with string musical instruments

    Science.gov (United States)

    LoPresto, Michael C.

    2012-03-01

    What follows are several investigations involving string musical instruments developed for and used in a Science of Sound & Light course. The experiments make use of a guitar, orchestral string instruments and data collection and graphing software. They are designed to provide students with concrete examples of how mathematical formulae, when used in physics, represent reality that can actually be observed, in this case, the operation of string musical instruments.

  6. Evaluating the Relational Coordination instrument

    DEFF Research Database (Denmark)

    Edwards, Kasper; Lundstrøm, Sanne Lykke

    2014-01-01

    consistency, interrater agreement and reliability, structural validity, content validity. However as relational coordination is being used as a diagnostics tool it is important to examine further if the instrument can measure changes. Indeed we need to know how precise and sensitive the instrument is when....... We distinguish between statistical and clinical significance. Statistical significance is calculated using T-test. Clinical significance is the minimal amount of change in relational coordination score that is not considered noise. Sensitivity of the instrument i.e. the ability of the instrument...

  7. Multipotenciostat System Based on Virtual Instrumentation

    Directory of Open Access Journals (Sweden)

    Arrieta-Almario Álvaro Angel

    2014-07-01

    Full Text Available To carry out this project an electronic multichannel system of electrochemical measurement or multipotenciostat was developed. It is based on the cyclic voltammetry measurement technique, controlled by a computer that monitors, by means of an electronic circuit, both the voltage generated from the Pc and supplied to an electrolytic cell, and the current that flows through the electrodes of it. To design the application software and the user interface, Virtual Instrumentation was used. On the other hand, to perform the communication between the multipotenciostat circuit and the designed software, the National Instruments NI9263 and NI9203 acquisition modules were used. The system was tested on a substance with a known REDOX property, as well as to discriminate and classify some samples of coffee.

  8. IAEA instrumentation programme keeping pace with technology

    International Nuclear Information System (INIS)

    Fortakov, V.; Rundquist, D.E.

    1995-01-01

    Nuclear components, nuclear practices and nuclear facilities have all improved with the maturing of the industry. These improvements have been driven by forces, which are beyond the normal evolutionary pressures, such as increased safety, as low as possible radiation exposure for the workers as well as for the public and the increasing competiveness of alternative forms of energy generation. International nuclear safeguards has had to keep pace with these technological and administrative changes. Moreover, the political climate has changed since the initial implementation of safeguards under the Non-Proliferation Treaty. Implementation of safeguards agreements has accommodated to these changes as well as to the technical innovations. One important component of safeguards implementation, namely the instruments deployed by inspectors, has matured with the help of Member States. Continued efforts in the development and deployment of appropriate instruments are needed to maintain an acceptable level of efficiency and credibility. (orig.)

  9. CMOS Electrochemical Instrumentation for Biosensor Microsystems: A Review

    Directory of Open Access Journals (Sweden)

    Haitao Li

    2016-12-01

    Full Text Available Modern biosensors play a critical role in healthcare and have a quickly growing commercial market. Compared to traditional optical-based sensing, electrochemical biosensors are attractive due to superior performance in response time, cost, complexity and potential for miniaturization. To address the shortcomings of traditional benchtop electrochemical instruments, in recent years, many complementary metal oxide semiconductor (CMOS instrumentation circuits have been reported for electrochemical biosensors. This paper provides a review and analysis of CMOS electrochemical instrumentation circuits. First, important concepts in electrochemical sensing are presented from an instrumentation point of view. Then, electrochemical instrumentation circuits are organized into functional classes, and reported CMOS circuits are reviewed and analyzed to illuminate design options and performance tradeoffs. Finally, recent trends and challenges toward on-CMOS sensor integration that could enable highly miniaturized electrochemical biosensor microsystems are discussed. The information in the paper can guide next generation electrochemical sensor design.

  10. Radioisotope relay instrument

    International Nuclear Information System (INIS)

    Pozdnyakov, V.N.; Sazonov, O.L.; Taksar, I.M.; Tesnavs, Eh.R.; Yanushkovskij, V.A.

    1974-01-01

    The paper describes a radioisotope relay device containing a radiation source, a detector, an electronic relay block with a comparative threshold mechanism. The device differs from previously known ones in that, for the purpose of increasing stability and speed of action, the electronic relay block is a separate unit and contains two threshold pulse generators which are joined up, across series-connected ''and'' and ''or'' elements, with one of the inputs of the comparative threshold mechanism, whose second input is connected with a detector and whose outputs are connected with a relay element connected by feedback with the above-mentioned ''and'' elements. (author)

  11. Endoscopic Instruments and Electrosurgical Unit for Colonoscopic Polypectomy

    OpenAIRE

    Park, Hong Jun

    2016-01-01

    Colorectal polypectomy is an effective method for prevention of colorectal cancer. Many endoscopic instruments have been used for colorectal polypectomy, such as snares, forceps, endoscopic clips, a Coagrasper, retrieval net, injector, and electrosurgery generator unit (ESU). Understanding the characteristics of endoscopic instruments and their proper use according to morphology and size of the colorectal polyp will enable endoscopists to perform effective polypectomy. I reviewed the characte...

  12. Are developing countries ready for first world waste policy instruments?

    CSIR Research Space (South Africa)

    Godfrey, Linda K

    2007-10-01

    Full Text Available behavior Sardinia 2007, Eleventh International Waste Management and Landfill Symposium 2.2 Economic instruments In contrast with command-and-control approaches, which mandate specific behaviours, economic instruments (EIs) (such as taxes, subsidies..., and marketable permits) aim to change behaviour indirectly by changing the prices (and hence incentives) that individuals and businesses face. For example, taxes per unit of waste collected or disposed of, create incentives to reduce waste generation...

  13. University of Houston Undergraduate Student Instrumentation Projects

    Science.gov (United States)

    Bering, E. A., III; Talbot, R. W.; Hampton, D. L.; Molders, N.; Millan, R. M.; Halford, A. J.; Dunbar, B.; Morris, G. A.; Prince, J.; Gamblin, R.; Ehteshami, A.; Lehnen, J. N.; Greer, M.; Porat, I.; Alozie, M.; Behrend, C. C.; Bias, C.; Fenton, A.; Gunawan, B.; Harrison, W.; Martinez, A.; Mathur, S.; Medillin, M.; Nguyen, T.; Nguyen, T. V.; Nowling, M.; Perez, D.; Pham, M.; Pina, M.; Thomas, G.; Velasquez, B.; Victor, L.

    2017-12-01

    The Undergraduate Student Instrumentation Project (USIP) is a NASA program to engage undergraduate students in rigorous scientific research, for the purposes of innovation and developing the next generation of professionals for an array of fields. The program is student led and executed from initial ideation to research to the design and deployment of scientific payloads. The University of Houston has been selected twice to participate in the USIP programs. The first program (USIP_UH I) ran from 2013 to 2016. USIP_UH II started in January of 2016, with funding starting at the end of May. USIP_UH I (USIP_UH II) at the University of Houston was (is) composed of eight (seven) research teams developing six (seven), distinct, balloon-based scientific instruments. These instruments will contribute to a broad range of geophysical sciences from Very Low Frequency recording and Total Electron Content to exobiology and ozone profiling. USIP_UH I had 12 successful launches with 9 recoveries from Fairbanks, AK in March 2015, and 4 piggyback flights with BARREL 3 from Esrange, Kiruna, Sweden in August, 2015. USIP_UH II had 8 successful launches with 5 recoveries from Fairbanks, AK in March 2017, 3 piggyback flights with BARREL 4 from Esrange, Kiruna, Sweden in August, 2016, and 1 flight each from CSBF and UH. The great opportunity of this program is capitalizing on the proliferation of electronics miniaturization to create new generations of scientific instruments that are smaller and lighter than ever before. This situation allows experiments to be done more cheaply which ultimately allows many more experiments to be done.

  14. Image reconstruction design of industrial CT instrument for teaching

    International Nuclear Information System (INIS)

    Zou Yongning; Cai Yufang

    2009-01-01

    Industrial CT instrument for teaching is applied to teaching and study in field of physics and radiology major, image reconstruction is an important part of software on CT instrument. The paper expatiate on CT physical theory and first generation CT reconstruction algorithm, describe scan process of industrial CT instrument for teaching; analyze image artifact as result of displacement of rotation center, implement method of center displacement correcting, design and complete image reconstruction software, application shows that reconstructed image is very clear and qualitatively high. (authors)

  15. Trials, tribulations, and pitfalls using commercial instruments for data acquisition

    International Nuclear Information System (INIS)

    Lee, R.C.; Olsen, R.H.; Unger, K.L.

    2009-01-01

    Brookhaven National Laboratory's Relativistic Heavy Ion Collider (RHIC) uses many commercially available instruments - for example spectrum analyzers, oscilloscopes, digital volt meters, signal generators - as integral parts of instrumentation and control systems. Typically these systems are remotely controlled. Using commercial instruments has many benefits. Manufactures have the skill, knowledge, and experience to produce high quality products. The price performance ratio is hard to duplicate. There are also disadvantages. Proprietary interfaces, single platform drivers, and reliable operation provide challenges for implementation and unattended operation. Several of the systems used at RHIC will be described. Their issues and solutions will be presented.

  16. Instruments to assess integrated care

    DEFF Research Database (Denmark)

    Lyngsø, Anne Marie; Godtfredsen, Nina Skavlan; Høst, Dorte

    2014-01-01

    INTRODUCTION: Although several measurement instruments have been developed to measure the level of integrated health care delivery, no standardised, validated instrument exists covering all aspects of integrated care. The purpose of this review is to identify the instruments concerning how to mea...... was prevalent. It is uncertain whether development of a single 'all-inclusive' model for assessing integrated care is desirable. We emphasise the continuing need for validated instruments embedded in theoretical contexts.......INTRODUCTION: Although several measurement instruments have been developed to measure the level of integrated health care delivery, no standardised, validated instrument exists covering all aspects of integrated care. The purpose of this review is to identify the instruments concerning how...... to measure the level of integration across health-care sectors and to assess and evaluate the organisational elements within the instruments identified. METHODS: An extensive, systematic literature review in PubMed, CINAHL, PsycINFO, Cochrane Library, Web of Science for the years 1980-2011. Selected...

  17. Atomic absorption instrument functional description

    International Nuclear Information System (INIS)

    Bystroff, R.I.; Boyle, W.G. Jr.; Barton, G.W. Jr.

    1976-01-01

    This report describes a proposed system for automating atomic absorption analysis. The system consists of two atomic absorption instruments and an automatic sampler that can be attached to either instrument. A computer program controls the sampling and gathers data. The program then uses the data to perform bookkeeping, data processing, and report writing

  18. Nuclear instrumentation evaluation and analysis

    International Nuclear Information System (INIS)

    Park, Suk Jun; Han, Sang Joon; Chung, Chong Eun; Han, Kwang Soo; Kim, Dong Hwa; Park, Byung Hae; Moon, Je Sun; Lee, Chel Kwon; Song, Ki Sang; Choi, Myung Jin; Kim, Seung Bok; Kim, Jung Bok

    1986-12-01

    This project provides the program for improving instrumentation reliability as well as developing a cost-effective preventive maintenance activity through evaluation and analysis of nuclear instrumentation concerning pilot plants, large-scale test facilities and various laboratories on KAERI site. In addition, it discusses the program for enhancing safe operations and improving facility availability through establishment of maintenance technology. (Author)

  19. A Database Management Assessment Instrument

    Science.gov (United States)

    Landry, Jeffrey P.; Pardue, J. Harold; Daigle, Roy; Longenecker, Herbert E., Jr.

    2013-01-01

    This paper describes an instrument designed for assessing learning outcomes in data management. In addition to assessment of student learning and ABET outcomes, we have also found the instrument to be effective for determining database placement of incoming information systems (IS) graduate students. Each of these three uses is discussed in this…

  20. Experimenting with String Musical Instruments

    Science.gov (United States)

    LoPresto, Michael C.

    2012-01-01

    What follows are several investigations involving string musical instruments developed for and used in a "Science of Sound & Light" course. The experiments make use of a guitar, orchestral string instruments and data collection and graphing software. They are designed to provide students with concrete examples of how mathematical formulae, when…

  1. Developing a workplace resilience instrument.

    Science.gov (United States)

    Mallak, Larry A; Yildiz, Mustafa

    2016-05-27

    Resilience benefits from the use of protective factors, as opposed to risk factors, which are associated with vulnerability. Considerable research and instrument development has been conducted in clinical settings for patients. The need existed for an instrument to be developed in a workplace setting to measure resilience of employees. This study developed and tested a resilience instrument for employees in the workplace. The research instrument was distributed to executives and nurses working in the United States in hospital settings. Five-hundred-forty completed and usable responses were obtained. The instrument contained an inventory of workplace resilience, a job stress questionnaire, and relevant demographics. The resilience items were written based on previous work by the lead author and inspired by Weick's [1] sense-making theory. A four-factor model yielded an instrument having psychometric properties showing good model fit. Twenty items were retained for the resulting Workplace Resilience Instrument (WRI). Parallel analysis was conducted with successive iterations of exploratory and confirmatory factor analyses. Respondents were classified based on their employment with either a rural or an urban hospital. Executives had significantly higher WRI scores than nurses, controlling for gender. WRI scores were positively and significantly correlated with years of experience and the Brief Job Stress Questionnaire. An instrument to measure individual resilience in the workplace (WRI) was developed. The WRI's four factors identify dimensions of workplace resilience for use in subsequent investigations: Active Problem-Solving, Team Efficacy, Confident Sense-Making, and Bricolage.

  2. Smart antennas for nuclear instruments

    International Nuclear Information System (INIS)

    Jain, Ranjan Bala; Singhi, B.M.

    2005-01-01

    The advances in the field of computer and communications are leading to the development of smart embedded nuclear instruments. These instruments have highly sophisticated signal-processing algorithms based on FPGA and ASICS, provisions of present day connectivity and user interfaces. The developments in the connectivity, standards and bus technologies have made possible to access these instruments on LAN and WAN with suitable reliability and security. To get rid of wires i.e. in order to access these instruments, without wires at any place, wireless technology has evolved and become integral part of day-to-day activities. The environment monitoring can be done remotely, if smart antennas are incorporated on these instruments

  3. Isotope generator

    International Nuclear Information System (INIS)

    1979-01-01

    The patent describes an isotope generator incorporating the possibility of stopping elution before the elution vessel is completely full. Sterile ventilation of the whole system can then occur, including of both generator reservoir and elution vessel. A sterile, and therefore pharmaceutically acceptable, elution fluid is thus obtained and the interior of the generator is not polluted with non-sterile air. (T.P.)

  4. Instant Generation

    Science.gov (United States)

    Loveland, Elaina

    2017-01-01

    Generation Z students (born between 1995-2010) have replaced millennials on college campuses. Generation Z students are entrepreneurial, desire practical skills with their education, and are concerned about the cost of college. This article presents what need to be known about this new generation of students.

  5. Optimising generators

    Energy Technology Data Exchange (ETDEWEB)

    Guerra, E.J.; Garcia, A.O.; Graffigna, F.M.; Verdu, C.A. (IMPSA (Argentina). Generators Div.)

    1994-11-01

    A new computer tool, the ARGEN program, has been developed for dimensioning large hydroelectric generators. This results in better designs, and reduces calculation time for engineers. ARGEN performs dimensional tailoring of salient pole synchronous machines in generators, synchronous condensers, and generator-motors. The operation and uses of ARGEN are explained and its advantages are listed in this article. (UK)

  6. Evolution of the VLT instrument control system toward industry standards

    Science.gov (United States)

    Kiekebusch, Mario J.; Chiozzi, Gianluca; Knudstrup, Jens; Popovic, Dan; Zins, Gerard

    2010-07-01

    The VLT control system is a large distributed system consisting of Linux Workstations providing the high level coordination and interfaces to the users, and VME-based Local Control Units (LCU's) running the VxWorks real-time operating system with commercial and proprietary boards acting as the interface to the instrument functions. After more than 10 years of VLT operations, some of the applied technologies used by the astronomical instruments are being discontinued making it difficult to find adequate hardware for future projects. In order to deal with this obsolescence, the VLT Instrumentation Framework is being extended to adopt well established Commercial Off The Shelf (COTS) components connected through industry standard fieldbuses. This ensures a flexible state of the art hardware configuration for the next generation VLT instruments allowing the access to instrument devices via more compact and simpler control units like PC-based Programmable Logical Controllers (PLC's). It also makes it possible to control devices directly from the Instrument Workstation through a normal Ethernet connection. This paper outlines the requirements that motivated this work, as well as the architecture and the design of the framework extension. In addition, it describes the preliminary results on a use case which is a VLTI visitor instrument used as a pilot project to validate the concepts and the suitability of some COTS products like a PC-based PLCs, EtherCAT8 and OPC UA6 as solutions for instrument control.

  7. How discriminating are discriminative instruments?

    Science.gov (United States)

    Hankins, Matthew

    2008-05-27

    The McMaster framework introduced by Kirshner & Guyatt is the dominant paradigm for the development of measures of health status and health-related quality of life (HRQL). The framework defines the functions of such instruments as evaluative, predictive or discriminative. Evaluative instruments are required to be sensitive to change (responsiveness), but there is no corresponding index of the degree to which discriminative instruments are sensitive to cross-sectional differences. This paper argues that indices of validity and reliability are not sufficient to demonstrate that a discriminative instrument performs its function of discriminating between individuals, and that the McMaster framework would be augmented by the addition of a separate index of discrimination. The coefficient proposed by Ferguson (Delta) is easily adapted to HRQL instruments and is a direct, non-parametric index of the degree to which an instrument distinguishes between individuals. While Delta should prove useful in the development and evaluation of discriminative instruments, further research is required to elucidate the relationship between the measurement properties of discrimination, reliability and responsiveness.

  8. How discriminating are discriminative instruments?

    Directory of Open Access Journals (Sweden)

    Hankins Matthew

    2008-05-01

    Full Text Available Abstract The McMaster framework introduced by Kirshner & Guyatt is the dominant paradigm for the development of measures of health status and health-related quality of life (HRQL. The framework defines the functions of such instruments as evaluative, predictive or discriminative. Evaluative instruments are required to be sensitive to change (responsiveness, but there is no corresponding index of the degree to which discriminative instruments are sensitive to cross-sectional differences. This paper argues that indices of validity and reliability are not sufficient to demonstrate that a discriminative instrument performs its function of discriminating between individuals, and that the McMaster framework would be augmented by the addition of a separate index of discrimination. The coefficient proposed by Ferguson (Delta is easily adapted to HRQL instruments and is a direct, non-parametric index of the degree to which an instrument distinguishes between individuals. While Delta should prove useful in the development and evaluation of discriminative instruments, further research is required to elucidate the relationship between the measurement properties of discrimination, reliability and responsiveness.

  9. Intercomparison of aerosol instruments: number concentration

    International Nuclear Information System (INIS)

    Knutson, E.O.; Sinclair, D.; Tu, K.W.; Hinchliffe, L.; Franklin, H.

    1982-05-01

    An intercomparison of aerosol instruments conducted February 23-27, 1981, at the Environmental Measurements Laboratory (EML) focused on five instruments: the Pollak and TSI condensation nucleus counters; the Active Scattering Aerosol Spectrometer (ASAS-X); and two aerosol electrometers. Test aerosols of sodium chloride and ammonium fluorescein generated by nebulization/electrostatic classification were used to obtain 195 lines of comparison data. Concentrations measured by the ASAS-X and the TSI aerosol electrometer averaged respectively 1.388 and 1.581 times that measured by the Pollak. These ratios were very stable during the week and there was little effect of particle size or material. Most other comparisons were equally stable. However, a review of past work at EML and elsewhere led to the disturbing conclusion that these ratios may change from year to year, or from season to season. A filter sample was taken from microscopy, concurrent with readings from the ASAS-X and the TSI condensation nucleus counters. In this sample, the two instruments differed by 20%. Within its 20% uncertainty, the filter result matched both the TSI and ASAS-X readings

  10. New type of radiation instrumentation system

    International Nuclear Information System (INIS)

    Matsuo, Keichi; Takaoka, Akira; Uranaka, Yasuo

    2000-01-01

    The Mitsubishi Electric Co., Ltd. developed a radiation instrumentation system introduced some recent techniques such as computation technique, network technique and so on into conventional radiation detection aiming at general market except power generation company. In a conventional system, a detector and an operation processing board was placed at a field and center, respectively, and a feeble pulse signal from the detector was transferred to the operation processing board. Then, on establishment of cables, detectors and operation processing board, it is essential to carry out engineering planning and field engineering conceiving on noise countermeasure. Noise resistance of the new type of radiation instrumentation system, not by adding operation processing function and network interface function into a detector unit in a field to transfer feeble signal, but by transferring testing result as a digital signal. And, noise removing function capable of selectively passing only signal pulse waveform from the detector to judge its signal waveform was also added to a detector unit in the field, to carry out a thoroughly removing noise. In addition, by connecting between each apparatus placed at the field with a network a system capable of reducing some cable engineering could be executed. Here were introduced on abstract of this new type of radiation instrumentation system and on noise removing function of its characteristics. (G.K.)

  11. Advances in constant-velocity Moessbauer instrumentation

    International Nuclear Information System (INIS)

    Veiga, A.; Martinez, N.; Zelis, P. Mendoza; Pasquevich, G. A.; Sanchez, F. H.

    2006-01-01

    A prototype of a programmable constant-velocity scaler is presented. This instrument allows the acquisition of partial Moessbauer spectra in selected energy regions using standard drivers and transducers. It can be fully operated by a remote application, thus data acquisition can be automated. The instrument consists of a programmable counter and a constant-velocity reference. The reference waveform generator is amplitude modulated with 13-bit resolution, and is programmable in a wide range of frequencies and waveforms in order to optimize the performance of the transducer. The counter is compatible with most standard SCA, and is configured as a rate-meter that provides counts per selectable time slice at the programmed velocity. As a demonstration of the instrument applications, a partial Moessbauer spectrum of a natural iron foil was taken. Only positive energies were studied in 512 channels, accumulating 20 s per channel. A line width of 0.20 mm/s was achieved, performing with an efficiency of 80%.

  12. The modern trends in space electromagnetic instrumentation

    Science.gov (United States)

    Korepanov, V. E.

    The future trends of the experimental plasma physics development in outer space demand more and more exact and sophisticated scientific instrumentation. Moreover, the situation is complicated by constant reduction of financial support of scientific research, even in leading countries. This resulted in the development of mini; micro and nanosatellites with low price and short preparation time. Consequently, it provoked the creation of new generation of scientific instruments with reduced weight and power consumption but increased level of metrological parameters. The recent state of the development of electromagnetic (EM) sensors for microsatellites is reported. For flux-gate magnetometers (FGM) the reduction of weight as well as power consumption was achieved not only due to the use of new electronic components but also because of the new operation mode development. The scientific and technological study allowed to decrease FGM noise and now the typical noise figure is about 10 picotesla rms at 1 Hz and the record one is below 1 picotesla. The super-light version of search-coil magnetometers (SCM) was created as the result of intensive research. These new SCMs can have about six decades of operational frequency band with upper limit ˜ 1 MHz and noise level of few femtotesla with total weight about 75 grams, including electronics. A new instrument.- wave probe (WP) - which combines three independent sensors in one body - SCM, split Langmuir probe and electric potential sensor - was created. The developed theory confirms that WP can directly measure the wave vector components in space plasmas.

  13. 'Green' preferences as regulatory policy instrument

    International Nuclear Information System (INIS)

    Brennan, Timothy J.

    2006-01-01

    We examine here the suggestion that if consumers in sufficient numbers are willing to pay the premium to have power generated using low-emission technologies, tax or permit policies become less necessary or stringent. While there are implementation difficulties with this proposal, our purpose is more fundamental: Can economics make sense of using preferences as a regulatory instrument? If 'green' preferences are exogenously given, to what extent can or should they be regarded as a substitute for other policies? Even with 'green' preferences, production and consumption of polluting goods continue to impose social costs not borne in the market. Moreover, if green preferences are regarded as a policy instrument, the 'no policy' baseline would require a problematic specification of counterfactual 'non-green' preferences. Viewing green preferences as a regulatory policy instrument is conceptually sensible if the benchmark for optimal emissions is based on value judgments apart from the preferences consumers happen to have. If so, optimal environmental protection would be defined by reference to ethical theory, or, even less favorably, by prescriptions from policy advocates who give their own preferences great weight while giving those of the public at large (and the costs they bear) very little consideration. (author)

  14. Adjustable extender for instrument module

    International Nuclear Information System (INIS)

    Sevec, J.B.; Stein, A.D.

    1975-01-01

    A blank extender module used to mount an instrument module in front of its console for repair or test purposes has been equipped with a rotatable mount and means for locking the mount at various angles of rotation for easy accessibility. The rotatable mount includes a horizontal conduit supported by bearings within the blank module. The conduit is spring-biased in a retracted position within the blank module and in this position a small gear mounted on the conduit periphery is locked by a fixed pawl. The conduit and instrument mount can be pulled into an extended position with the gear clearing the pawl to permit rotation and adjustment of the instrument

  15. Traceability of radiation protection instruments

    Science.gov (United States)

    Hino, Y.; Kurosawa, T.

    2007-08-01

    Radiation protection instruments are used in daily measurement of dose and activities in workplaces and environments for safety management. The requirements for calibration certificates with traceability are increasing for these instruments to ensure the consistency and reliabilities of the measurement results. The present traceability scheme of radiation protection instruments for dose and activity measurements is described with related IEC/ISO requirements. Some examples of desirable future calibration systems with recent new technologies are also discussed to establish the traceability with reasonable costs and reliabilities.

  16. Commissioning Instrument for the GTC

    Science.gov (United States)

    Cuevas, S.; Sánchez, B.; Bringas, V.; Espejo, C.; Flores, R.; Chapa, O.; Lara, G.; Chavolla, A.; Anguiano, G.; Arciniega, S.; Dorantes, A.; González, J. L.; Montoya, J. M.; Toral, R.; Hernández, H.; Nava, R.; Devaney, N.; Castro, J.; Cavaller-Marqués, L.

    2005-12-01

    During the GTC integration phase, the Commissioning Instrument (CI) will be a diagnostic tool for performance verification. The CI features four operation modes: imaging, pupil imaging, Curvature WFS, and high resolution Shack-Hartmann WFS. This instrument was built by the Instituto de Astronomía UNAM and the Centro de Ingeniería y Desarrollo Industrial (CIDESI) under GRANTECAN contract after a public bid. In this paper we made a general instrument overview and we show some of the performance final results obtained when the Factory Acceptance tests previous to its transport to La Palma.

  17. Recent developments in radiation detectors and instruments

    International Nuclear Information System (INIS)

    Das, Debashis

    2016-01-01

    Radiation detector is the key component in precise and accurate measurement of the nuclear radiations. The detectors deployed for radiation measurements in broadly classified sectors of Energy, Security, Discovery Science and Health and Environments are in general specific to their applications. The nuclear reactors as well as the fuel processing including waste management in energy sector require wide range/variety of detectors and the instruments for safe and precise generation of power. The security sector has gained importance in radiation monitoring in the present security perspective and there are many challenges in development of detector technology. The Discovery Science or the mega science projects viz CERN, Fermilab, GANIL, INO, MACE telescope, ITER etc have continuously generated new demand on detector related technologies that have been also found to be useful in other applications. Similarly, the health and environment monitoring have been also evolving with new technologies and techniques to address the requirement's arising in projects of new nuclear programs

  18. Wind Generators

    Science.gov (United States)

    1989-01-01

    When Enerpro, Inc. president, Frank J. Bourbeau, attempted to file a patent on a system for synchronizing a wind generator to the electric utility grid, he discovered Marshall Space Flight Center's Frank Nola's power factor controller. Bourbeau advanced the technology and received a NASA license and a patent for his Auto Synchronous Controller (ASC). The ASC reduces generator "inrush current," which occurs when large generators are abruptly brought on line. It controls voltage so the generator is smoothly connected to the utility grid when it reaches its synchronous speed, protecting the components from inrush current damage. Generator efficiency is also increased in light winds by applying lower than rated voltage. Wind energy is utilized to drive turbines to generate electricity for utility companies.

  19. Instrumentation for Air Pollution Monitoring

    Science.gov (United States)

    Hollowell, Craig D.; McLaughlin, Ralph D.

    1973-01-01

    Describes the techniques which form the basis of current commercial instrumentation for monitoring five major gaseous atmospheric pollutants (sulfur dioxide, oxides of nitrogen, oxidants, carbon monoxide, and hydrocarbons). (JR)

  20. Survey of instruments for micrometeorology

    National Research Council Canada - National Science Library

    Monteith, John Lennox

    1972-01-01

    ... have been developed for micrometeorological measurements. Many of these instruments can be used by ecologists to measure and define the environment of plants and animals and to explore the ways in which organisms modify the environment they are exposed...

  1. Digital instrumentation for retrofit applications

    International Nuclear Information System (INIS)

    Dennis, U.E.

    1986-01-01

    There can be many reasons for applying retrofit designs to existing power plants. Whatever the reasons, care in planning and instrument design will be required in order to derive the full benefits afforded by today's technology. Specifically, the availability of microprocessors and their related integrated circuits make possible capabilities, accuracies, reliabilities, maintainability and user interfaces not achievable when original equipment was designed. Some of the motives for the replacement of current instrumentation are examined and the various benefits and pitfalls of applying present day microprocessor technology to new designs are discussed. From this, a set of design objectives can be formulated that can best take advantage of modern technology. General Electric's design solution, a family of instruments called NUMAC (Nuclear Measurement, Analysis and Control) is described, followed by descriptions of instruments currently in production and those contemplated for design in the near future

  2. Economic instruments for environmental mitigation

    International Nuclear Information System (INIS)

    Wilkinson, A.

    1995-01-01

    A joint International Chamber of Commerce (ICC)/World Energy Council (WEC) Working Group has been studying a range of policy instruments which are being used or considered for use to address the question of ever increasing energy demand versus environmental protection, and pollution reduction. Economic instruments for such environmental protection include direct regulation, market-based instruments, and voluntary approaches. No single policy or device was likely to suffice in addressing the diversity of environmental problems currently faced. Altering energy prices must be seen in a social context, but some direct regulation may also be inevitable. Generally economic instruments of change were preferred as these were viewed as more flexible and cost-effective. (UK)

  3. PEP instrumentation and control system

    Energy Technology Data Exchange (ETDEWEB)

    Melen, R.

    1980-06-01

    This paper describes the operating characteristics of the primary components that form the PEP Instrumentation and Control System. Descriptions are provided for the computer control system, beam monitors, and other support systems.

  4. Technical Training seminar: Texas Instruments

    CERN Multimedia

    2006-01-01

    Monday 6 November TECHNICAL TRAINING SEMINAR 14:00 to 17:30 - Training Centre Auditorium (bldg. 593) Texas Instruments Technical Seminar Michael Scholtholt, Field Application Engineer / TEXAS INSTRUMENTS (US, D, CH) POWER - A short approach to Texas Instruments power products Voltage mode vs. current mode control Differentiating DC/DC converters by analyzing control and compensation schemes: line / load regulation, transient response, BOM, board space, ease-of-use Introduction to the SWIFT software FPGA + CPLD power solutions WIRELESS / CHIPCON Decision criteria when choosing a RF platform Introduction to Texas Instruments wireless products: standardized platforms proprietary platforms ( 2.4 GHz / sub 1 GHz) development tools Antenna design: example for 2.4 GHz questions, discussion Industrial partners: Robert Medioni, François Caloz / Spoerle Electronic, CH-1440 Montagny (VD), Switzerland Phone: +41 24 447 0137, email: RMedioni@spoerle.com, http://www.spoerle.com Language: English. Free s...

  5. PEP instrumentation and control system

    International Nuclear Information System (INIS)

    Melen, R.

    1980-06-01

    This paper describes the operating characteristics of the primary components that form the PEP Instrumentation and Control System. Descriptions are provided for the computer control system, beam monitors, and other support systems

  6. Intelligent instrumentation principles and applications

    CERN Document Server

    Bhuyan, Manabendra

    2011-01-01

    With the advent of microprocessors and digital-processing technologies as catalyst, classical sensors capable of simple signal conditioning operations have evolved rapidly to take on higher and more specialized functions including validation, compensation, and classification. This new category of sensor expands the scope of incorporating intelligence into instrumentation systems, yet with such rapid changes, there has developed no universal standard for design, definition, or requirement with which to unify intelligent instrumentation. Explaining the underlying design methodologies of intelligent instrumentation, Intelligent Instrumentation: Principles and Applications provides a comprehensive and authoritative resource on the scientific foundations from which to coordinate and advance the field. Employing a textbook-like language, this book translates methodologies to more than 80 numerical examples, and provides applications in 14 case studies for a complete and working understanding of the material. Beginn...

  7. A Finescale Lagrangian Instrument System

    National Research Council Canada - National Science Library

    Toole, John

    2003-01-01

    ... from conventional, bottom-anchored moorings. An initial trial of the concept targeting the upper ocean was carried out off Bermuda in November 2001 with an instrument profiling between 12 and 28O-m depth...

  8. Instrumental development and data processing

    International Nuclear Information System (INIS)

    Franzen, J.

    1978-01-01

    A review of recent developments in mass spectrometry instrumentation is presented under the following headings: introduction (scope of mass spectrometry compared with neighbouring fields); ion sources and ionization techniques; spectrometers (instrumental developments); measuring procedures; coupling techniques; data systems; conclusions (that mass spectrometry should have a broader basis and that there would be mutual profit from a better penetration of mass spectrometry into fields of routine application). (U.K.)

  9. MITS instrumentation error analysis report

    International Nuclear Information System (INIS)

    Nelson, D.W.; Hillon, D.D.

    1980-01-01

    The MITS (Machine Interface Test System) installation consists of three types of process monitoring and control instrumentation: flow, pressure, and temperature. An effort has been made to assess the various instruments used and assign a value to the accuracy that can be expected. Efforts were also made to analyze the calibration and installation procedures to be used and determine how these might effect the system accuracy

  10. Notes on instrumentation and control

    CERN Document Server

    Roy, G J

    2013-01-01

    Notes on Instrumentation and Control presents topics on pressure (i.e., U-tube manometers and elastic type gauges), temperature (i.e. glass thermometer, bi-metallic strip thermometer, filled system thermometer, vapor pressure thermometer), level, and flow measuring devices. The book describes other miscellaneous instruments, signal transmitting devices, supply and control systems, and monitoring systems. The theory of automatic control and semi-conductor devices are also considered. Marine engineers will find the book useful.

  11. Nucleonic instruments from VUPJT Tesla

    International Nuclear Information System (INIS)

    Smola, J.

    1986-01-01

    The instruments currently produced by Tesla Premysleni are listed and briefly characterized. They include a low level alpha-beta counter, an automatic low level alpha-beta counter, detection units for environmental sample counting, instruments for measuring specific activity of liquids and radon concentration in water, a radioactive aerosol meter, dose ratemeters, portable alpha-beta indicators for surface contamintion monitoring, neutron monitors, single-, two- and three-channel spectrometric units. (M.D.)

  12. Sulfur Dioxide Analyzer Instrument Handbook

    Energy Technology Data Exchange (ETDEWEB)

    Springston, Stephen R. [Brookhaven National Lab. (BNL), Upton, NY (United States)

    2016-05-01

    The Sulfur Dioxide Analyzer measures sulfur dioxide based on absorbance of UV light at one wavelength by SO2 molecules which then decay to a lower energy state by emitting UV light at a longer wavelength. Specifically, SO2 + hυ1 →SO2 *→SO2 + hυ2 The emitted light is proportional to the concentration of SO2 in the optical cell. External communication with the analyzer is available through an Ethernet port configured through the instrument network of the AOS systems. The Model 43i-TLE is part of the i-series of Thermo Scientific instruments. The i-series instruments are designed to interface with external computers through the proprietary Thermo Scientific iPort Software. However, this software is somewhat cumbersome and inflexible. Brookhaven National Laboratory (BNL) has written an interface program in National Instruments LabView that both controls the Model 43i-TLE Analyzer AND queries the unit for all measurement and housekeeping data. The LabView vi (the software program written by BNL) ingests all raw data from the instrument and outputs raw data files in a uniform data format similar to other instruments in the AOS and described more fully in Section 6.0 below.

  13. Isotope-equipped measuring instruments

    International Nuclear Information System (INIS)

    Miyagawa, Kazuo; Amano, Hiroshi

    1980-01-01

    In the steel industry, though the investment in isotope-equipped measuring instruments is small as compared with that in machinery, they play important role in the moisture measurement in sintering and blast furnaces, the thickness measurement in rolling process and others in automatic control systems. The economic aspect of the isotope-equipped measuring instruments is described on the basis of the practices in Kimitsu Works of Nippon Steel Corporation: distribution of such instruments, evaluation of economic effects, usefulness evaluation in view of raising the accuracy, and usefulness evaluation viewed from the failure of the isotope instruments. The evaluation of economic effects was made under the premise that the isotope-equipped measuring instruments are not employed. Then, the effects of raising the accuracy are evaluated for a γ-ray plate thickness gauge and a neutron moisture gauge for coke in a blast furnace. Finally, the usefulness was evaluated, assuming possible failure of the isotope-equipped measuring instruments. (J.P.N.)

  14. Transuranic waste assay instrumentation: new developments and directions at the Los Alamos Scientific Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Close, D.A.; Umbarger, C.J.; West, L.; Smith, W.J.; Cates, M.R.; Noel, B.W.; Honey, F.J.; Franks, L.A.; Pigg, J.L.; Trundle, A.S.

    1978-01-01

    The Los Alamos Scientific Laboratory is developing assay instrumentation for the quantitative analysis of transuranic materials found in bulk solid wastes generated by Department of Energy facilities and by the commercial nuclear power industry. This also includes wastes generated in the decontamination and decommissioning of facilities and wastes generated during burial ground exhumation. The assay instrumentation will have a detection capability for the transuranics of less than 10 nCi of activity per gram of waste whenever practicable.

  15. Transuranic waste assay instrumentation: new developments and directions at the Los Alamos Scientific Laboratory

    International Nuclear Information System (INIS)

    Close, D.A.; Umbarger, C.J.; West, L.; Smith, W.J.; Cates, M.R.; Noel, B.W.; Honey, F.J.; Franks, L.A.; Pigg, J.L.; Trundle, A.S.

    1978-01-01

    The Los Alamos Scientific Laboratory is developing assay instrumentation for the quantitative analysis of transuranic materials found in bulk solid wastes generated by Department of Energy facilities and by the commercial nuclear power industry. This also includes wastes generated in the decontamination and decommissioning of facilities and wastes generated during burial ground exhumation. The assay instrumentation will have a detection capability for the transuranics of less than 10 nCi of activity per gram of waste whenever practicable

  16. Generation and analysis of chemical compound libraries

    Science.gov (United States)

    Gregoire, John M.; Jin, Jian; Kan, Kevin S.; Marcin, Martin R.; Mitrovic, Slobodan; Newhouse, Paul F.; Suram, Santosh K.; Xiang, Chengxiang; Zhou, Lan

    2017-10-03

    Various samples are generated on a substrate. The samples each includes or consists of one or more analytes. In some instances, the samples are generated through the use of gels or through vapor deposition techniques. The samples are used in an instrument for screening large numbers of analytes by locating the samples between a working electrode and a counter electrode assembly. The instrument also includes one or more light sources for illuminating each of the samples. The instrument is configured to measure the photocurrent formed through a sample as a result of the illumination of the sample.

  17. Remote and Virtual Instrumentation Platform for Distance Learning

    Directory of Open Access Journals (Sweden)

    Tom Eppes

    2010-08-01

    Full Text Available This journal presents distance learning using the National Instruments ELVIS II and how Multisim can be combined with ELVIS II for distance learning. National Instrument’s ELVIS II is a new version that can easily be used for e-learning. It features 12 of the commonly used instruments in engineering and science laboratories, including an oscilloscope, a function generator, a variable power supply, and an isolated digital multi-meter in a low-cost and easy-to-use platform and completes integration with Multisim software for SPICE simulation, which simplifies the teaching of circuit design. As NI ELVIS II is based on LabView, designers can easily customize the 12 instruments or can create their own using the provided source code for the instruments.

  18. Robotic thin layer chromatography instrument for synthetic chemistry

    International Nuclear Information System (INIS)

    Corkan, L.A.; Haynes, E.; Kline, S.; Lindsey, J.S.

    1991-01-01

    We have constructed a second generation instrument for performing automated thin layer chromatography (TLC), The TLC instrument Consists of four dedicated stations for (1) plate dispensing, (2) sample application, (3) plate development, and (4) densitometry. A robot is used to move TLC plates among stations. The TLC instrument functions either as a stand-alone unit or as one analytical module in a robotic workstation for synthetic chemistry. An integrated hardware and software architecture enables automatic TLC analysis of samples produced concurrently from synthetic reactions in progress on the workstation. The combination of fixed automation and robotics gives a throughput of 12 TLC samples per hour. From these results a blueprint has emerged for an advanced automated TLC instrument with far greater throughput and analytical capabilities

  19. Generative Semantics.

    Science.gov (United States)

    King, Margaret

    The first section of this paper deals with the attempts within the framework of transformational grammar to make semantics a systematic part of linguistic description, and outlines the characteristics of the generative semantics position. The second section takes a critical look at generative semantics in its later manifestations, and makes a case…

  20. Generative Semantics

    Science.gov (United States)

    Bagha, Karim Nazari

    2011-01-01

    Generative semantics is (or perhaps was) a research program within linguistics, initiated by the work of George Lakoff, John R. Ross, Paul Postal and later McCawley. The approach developed out of transformational generative grammar in the mid 1960s, but stood largely in opposition to work by Noam Chomsky and his students. The nature and genesis of…

  1. Sound generator

    NARCIS (Netherlands)

    Berkhoff, Arthur P.

    2008-01-01

    A sound generator, particularly a loudspeaker, configured to emit sound, comprising a rigid element (2) enclosing a plurality of air compartments (3), wherein the rigid element (2) has a back side (B) comprising apertures (4), and a front side (F) that is closed, wherein the generator is provided

  2. Sound generator

    NARCIS (Netherlands)

    Berkhoff, Arthur P.

    2010-01-01

    A sound generator, particularly a loudspeaker, configured to emit sound, comprising a rigid element (2) enclosing a plurality of air compartments (3), wherein the rigid element (2) has a back side (B) comprising apertures (4), and a front side (F) that is closed, wherein the generator is provided

  3. Pulse Generator

    Science.gov (United States)

    Greer, Lawrence (Inventor)

    2017-01-01

    An apparatus and a computer-implemented method for generating pulses synchronized to a rising edge of a tachometer signal from rotating machinery are disclosed. For example, in one embodiment, a pulse state machine may be configured to generate a plurality of pulses, and a period state machine may be configured to determine a period for each of the plurality of pulses.

  4. Sound generator

    NARCIS (Netherlands)

    Berkhoff, Arthur P.

    2007-01-01

    A sound generator, particularly a loudspeaker, configured to emit sound, comprising a rigid element (2) enclosing a plurality of air compartments (3), wherein the rigid element (2) has a back side (B) comprising apertures (4), and a front side (F) that is closed, wherein the generator is provided

  5. Steam generator

    International Nuclear Information System (INIS)

    Fenet, J.-C.

    1980-01-01

    Steam generator particularly intended for use in the coolant system of a pressurized water reactor for vaporizing a secondary liquid, generally water, by the primary cooling liquid of the reactor and comprising special arrangements for drying the steam before it leaves the generator [fr

  6. Instrumentation, controls and automation in the power industry

    International Nuclear Information System (INIS)

    Anon.

    1991-01-01

    The year 1991 will be remembered as the year EPRI joined with the ISA Power Division to present an outstanding group to technical papers at the First Annual ISA/EPRI Joint Controls and Automation Conference. All papers met the theme for the conference namely Innovative Instrumentation, Controls, and Automation Techniques for the Power Generation Industry and cover a myriad of application ranging from nuclear to conventional fossil to co-generation plants involving nuclear, conventional BTG, and combined cycle equipment applications

  7. An Instrument for the Systematic Study of Advertising Creative Appeals.

    Science.gov (United States)

    Secrist, Mark

    Although the generation of creative appeals is the heart and soul of advertising, there has been little methodology developed for the classification and study of the appeals themselves. The paper recommends the use of an instrument which provides a technique that will enable the advertising researcher to develop descriptive studies of ad appeals.…

  8. Second harmonic generation imaging

    CERN Document Server

    2013-01-01

    Second-harmonic generation (SHG) microscopy has shown great promise for imaging live cells and tissues, with applications in basic science, medical research, and tissue engineering. Second Harmonic Generation Imaging offers a complete guide to this optical modality, from basic principles, instrumentation, methods, and image analysis to biomedical applications. The book features contributions by experts in second-harmonic imaging, including many pioneering researchers in the field. Written for researchers at all levels, it takes an in-depth look at the current state of the art and possibilities of SHG microscopy. Organized into three sections, the book: Provides an introduction to the physics of the process, step-by-step instructions on how to build an SHG microscope, and comparisons with related imaging techniques Gives an overview of the capabilities of SHG microscopy for imaging tissues and cells—including cell membranes, muscle, collagen in tissues, and microtubules in live cells—by summarizing experi...

  9. On Representative Spaceflight Instrument and Associated Instrument Sensor Web Framework

    Science.gov (United States)

    Kizhner, Semion; Patel, Umeshkumar; Vootukuru, Meg

    2007-01-01

    Sensor Web-based adaptation and sharing of space flight mission resources, including those of the Space-Ground and Control-User communication segment, could greatly benefit from utilization of heritage Internet Protocols and devices applied for Spaceflight (SpaceIP). This had been successfully demonstrated by a few recent spaceflight experiments. However, while terrestrial applications of Internet protocols are well developed and understood (mostly due to billions of dollars in investments by the military and industry), the spaceflight application of Internet protocols is still in its infancy. Progress in the developments of SpaceIP-enabled instrument components will largely determine the SpaceIP utilization of those investments and acceptance in years to come. Likewise SpaceIP, the development of commercial real-time and instrument colocated computational resources, data compression and storage, can be enabled on-board a spacecraft and, in turn, support a powerful application to Sensor Web-based design of a spaceflight instrument. Sensor Web-enabled reconfiguration and adaptation of structures for hardware resources and information systems will commence application of Field Programmable Arrays (FPGA) and other aerospace programmable logic devices for what this technology was intended. These are a few obvious potential benefits of Sensor Web technologies for spaceflight applications. However, they are still waiting to be explored. This is because there is a need for a new approach to spaceflight instrumentation in order to make these mature sensor web technologies applicable for spaceflight. In this paper we present an approach in developing related and enabling spaceflight instrument-level technologies based on the new concept of a representative spaceflight Instrument Sensor Web (ISW).

  10. Technical testing of portable isotope identification instruments

    International Nuclear Information System (INIS)

    Smith, D.E.

    2001-01-01

    . First generation portable isotope identifiers were identified and evaluated by U.S. Customs. Instruments from five vendors were put through a battery of tests according to delineated test procedures. The tests fell into five categories: Basic operation verification; Medical isotope identification; Individual isotope identification; Isotope pair identification; Dose rate calculation. The tests can be summarized as an initial verification of correct instrument operation (including whatever calibration procedure was specified by the vendor), followed by three different isotope identification tests designed to verify the instrument's ability to correctly identify 19 isotopes specified by U.S. Customs. The final test determined each instrument's ability to correctly display the dose rate from a wide energy range of gamma emitters. The individual isotope identification test and the isotope pair identification test were performed with three types of intervening shielding. The first of these three types used the minimum packaging needed for safe source handling and was, in general, thin plastic. This type of shielding is virtually identical to a bare radiation source. The second type of shielding used 2.7 mm of steel to simulate the wall of a typical transportainer (or sea-tainer). The third type of shielding used 6.94 mm of lead to simulate typical industrial packaging or, perhaps, an attempt by the shipper to conceal the source without unduly increasing the weight of the shipment. The isotopes tested were broadly categorized as: Special nuclear material (SNM), Medical, and Industrial. These included 17 gamma emitters, 1 beta emitter, and 1 neutron emitter. Each instrument was subjected to the following testing regimen: First, each instrument was calibrated according to vendor's procedures. Instrument size and weight were recorded. Next, the instrument's response to medical isotopes in their usual shipping containers was measured. This represents the most commonly occurring

  11. Musical Sound, Instruments, and Equipment

    Science.gov (United States)

    Photinos, Panos

    2017-12-01

    'Musical Sound, Instruments, and Equipment' offers a basic understanding of sound, musical instruments and music equipment, geared towards a general audience and non-science majors. The book begins with an introduction of the fundamental properties of sound waves, and the perception of the characteristics of sound. The relation between intensity and loudness, and the relation between frequency and pitch are discussed. The basics of propagation of sound waves, and the interaction of sound waves with objects and structures of various sizes are introduced. Standing waves, harmonics and resonance are explained in simple terms, using graphics that provide a visual understanding. The development is focused on musical instruments and acoustics. The construction of musical scales and the frequency relations are reviewed and applied in the description of musical instruments. The frequency spectrum of selected instruments is explored using freely available sound analysis software. Sound amplification and sound recording, including analog and digital approaches, are discussed in two separate chapters. The book concludes with a chapter on acoustics, the physical factors that affect the quality of the music experience, and practical ways to improve the acoustics at home or small recording studios. A brief technical section is provided at the end of each chapter, where the interested reader can find the relevant physics and sample calculations. These quantitative sections can be skipped without affecting the comprehension of the basic material. Questions are provided to test the reader's understanding of the material. Answers are given in the appendix.

  12. Apical instrumentation in endodontic therapy

    Directory of Open Access Journals (Sweden)

    Kurniasri Darliana

    2007-07-01

    Full Text Available Cleaning and shaping of the root canal as the foundation for successful endodontic therapy. Cleaning of the root canal as the removal of all the contents of the root canal systems before and during shaping. Mechanical cleaning as the most important part of the root canal therapy. Instrumentation of the apical region has long been considered to be an essential component in the cleaning and shaping process. The apical area as the critical zone for instrumentation. The apical portion of the root canal system can retain microorganisms that could potentially cause periradicular inflammation. The nickel-titanium rotary instrumentation system to facilitate the cleaning and shaping process. Larger instrumentation sizes not only allow proper irrigation but also significantly decrease remaining bacteria in the canal system. How the larger apical sizes preparation must be achieved to clinical success. This paper will describe the major factors impacting the selection of final apical size, the factors are the anatomy of the apical constriction, root canal diameter, apical instrumentation, and bacteria in dentin tubuli.

  13. Upgrade of Dhruva fuel channel flow instrumentation

    International Nuclear Information System (INIS)

    Gadgil, Kaustubh; Awale, P.K.; Sengupta, C.; Sumanth, P.; Roy, Kallol

    2014-01-01

    Dhruva, a 100 MW Heavy Water moderated and cooled, vertical tank-type Research Reactor, using metallic natural Uranium fuel has flow instrumentation for all the 144 fuel channels, consisting of venturi and triplicate DP gauges for each fuel channel. These gauges provide contacts for generation of reactor trip on low flow through fuel channel. These DP gauges were facing numerous generic and ageing related failures over the years and was also difficult to maintain owing to obsolescence. While considering an upgrade for these DP gauges, it was also planned to replace the existing Coolant Low Flow Trip (CLFT) system with a computer based Reactor Trip Logic System (RTLS). Being a retrofit job, the existing panels for mounting the gauges, cable layout, impulse tubing layout, etc. were retained, thereby simplifying the site execution, reducing reactor down time and also reducing person-milli-Sievert consumption. A customized Electronic DP Indicating Switch (EDPIS) was conceptualized for achieving these objectives. Such a design, utilizing a standard DP transmitter with customized electronic circuitry, was developed, evaluated and finalized after a series of factory trials, field trials and prototyping. The instrument design included contact input for existing CLFT system and also provision for 4-20 mA current output for the proposed computer based RTLS. The display and form factor of the instrument remained identical to older one and ensures familiarity of O and M personnel. Since EDPIS is classified as Safety Class IA, stringent type tests, hardware FMEA and V and V of the micro-controller software were carried out as per the requirements laid down by relevant standards for qualification of these instruments. Being a customized instrument, the manufacturing process was closely monitored and was followed by stringent QA plan and acceptance tests. A total of 396 gauges were replaced in a phased manner during scheduled fuelling outages and thereby did not affect reactor

  14. Instrument development continues in Oak Ridge

    International Nuclear Information System (INIS)

    Ekkebus, Allen E.

    2012-01-01

    Peer review panels composed of 80 external scientists recently visited Oak Ridge National Laboratory (ORNL) to review almost 700 proposals for experiments on 23 instruments at the Spallation Neutron Source (SNS) and High Flux Isotope Reactor (HFIR). These were proposed for the time period from January-June 2012. About 40% of the proposals were approved for beam time and 20% were placed on an alternate list if time becomes available. The Hybrid Spectrometer HYSPEC at SNS began its commissioning in September 2011. HYSPEC is otpimized for studying low energy dynamics in single-crystal samples using a broad variety of sample environments, and is equipped with a polarization analysis capability. It is expected to be available for users on a limited basis in the second half of 2012. The detector tank of CORELLI has been installed on beamline 9 at SNS. Now that the tank is in place, banks of neutron detectors and boron carbide shielding will be installed around the interior. CORELLI is optimized to probe complex disorder in crystalline materials through diffuse scattering from single-crystal samples. It will begin commissioning in 2014. CORELLI is one of four instruments being developed under the SING II (SNS Instruments Next Generation II) project. The others are the Macromolecular Neutron Diffractometer (MANDI), the Vibrational Spectrometer (VISION, scheduled to begin commissioning in 2012), and the Time of Flight Ultra Small Angle Neutron Scattering Instrument (TOF-USANS). The single crystal neutron diffractometer IMAGINE, was deliverd to HFIR in October 2011. Preliminary testing has been carried out. IMAGINE will provide atomic resolution information on chemical, organic, metallo-organic and protein single crystals that will enable their chemical, physical and biological structure and function to be understood. This instrument will benefit scientists with interests in pharmaceuticals, minerals and other inorganic crystals, small molecules, molecular organo

  15. 31 CFR 596.307 - Monetary instruments.

    Science.gov (United States)

    2010-07-01

    ... FOREIGN ASSETS CONTROL, DEPARTMENT OF THE TREASURY TERRORISM LIST GOVERNMENTS SANCTIONS REGULATIONS General Definitions § 596.307 Monetary instruments. The term monetary instruments shall have the meaning...

  16. Energy generation

    CSIR Research Space (South Africa)

    Osburn, L

    2009-02-01

    Full Text Available Current perceptions conjure images of photovoltaic panels and wind turbines when green building or sustainable development is discussed. How energy is used and how it is generated are core components of both green building and sustainable...

  17. Refabricated and instrumented fuel rods

    International Nuclear Information System (INIS)

    Silberstein, K.

    2005-01-01

    Nuclear Fuel for power reactors capabilities evaluation is strongly based on the intimate knowledge of its behaviour under irradiation. This knowledge can be acquired from refabricated and instrumented fuel rods irradiated at different levels in commercial reactors. This paper presents the development and qualification of a new technique called RECTO related to a double-instrumented rod re-fabrication process developed by CEA/LECA hot laboratory facility at CADARACHE. The technique development includes manufacturing of the properly dimensioned cavity in the fuel pellet stack to house the thermocouple and the use of a newly designed pressure transducer. An analytic irradiation of such a double-instrumented fuel rod will be performed in OSIRIS test reactor starting October 2004. (Author)

  18. Seismic Instrumentation Placement Recommendations Report

    International Nuclear Information System (INIS)

    Kennedy, W.N.

    1998-01-01

    DOE Order 420.1, ''Facility Safety'', requires that facilities or sites with hazardous materials be provided with instrumentation or other means to detect and record the occurrences and severity of seismic events. These requirements assure that necessary records are available after an earthquake for evaluation purposes and to supplement other data to justify a facility restart or curtailing plant operations after an earthquake. This report documents the basis for the selection of Savannah River Site areas and existing facilities to be instrumented. The need to install instrumentation in new facilities such as the Actinide Packaging and Storage Facility, Commercial Light Water Reactor Tritium Extraction Facility and the Accelerator Production of Tritium Facility will be assessed separately

  19. Introduction to instrumentation and measurements

    CERN Document Server

    Northrop, Robert B

    2014-01-01

    Weighing in on the growth of innovative technologies, the adoption of new standards, and the lack of educational development as it relates to current and emerging applications, the third edition of Introduction to Instrumentation and Measurements uses the authors' 40 years of teaching experience to expound on the theory, science, and art of modern instrumentation and measurements (I&M). What's New in This Edition: This edition includes material on modern integrated circuit (IC) and photonic sensors, micro-electro-mechanical (MEM) and nano-electro-mechanical (NEM) sensors, chemical and radiation sensors, signal conditioning, noise, data interfaces, and basic digital signal processing (DSP), and upgrades every chapter with the latest advancements. It contains new material on the designs of micro-electro-mechanical (MEMS) sensors, adds two new chapters on wireless instrumentation and microsensors, and incorporates extensive biomedical examples and problems. Containing 13 chapters, this third edition: Describ...

  20. Safeguards instrumentation: past, present, future

    International Nuclear Information System (INIS)

    Higinbotham, W.A.

    1982-01-01

    Instruments are essential for accounting, for surveillance and for protection of nuclear materials. The development and application of such instrumentation is reviewed, with special attention to international safeguards applications. Active and passive nondestructive assay techniques are some 25 years of age. The important advances have been in learning how to use them effectively for specific applications, accompanied by major advances in radiation detectors, electronics, and, more recently, in mini-computers. The progress in seals has been disappointingly slow. Surveillance cameras have been widely used for many applications other than safeguards. The revolution in TV technology will have important implications. More sophisticated containment/surveillance equipment is being developed but has yet to be exploited. On the basis of this history, some expectations for instrumentation in the near future are presented

  1. Solution assay instrument operations manual

    International Nuclear Information System (INIS)

    Li, T.K.; Marks, T.; Parker, J.L.

    1983-09-01

    An at-line solution assay instrument (SAI) has been developed and installed in a plutonium purification and americium recovery process area in the Los Alamos Plutonium Processing Facility. The instrument was designed for accurate, timely, and simultaneous nondestructive analysis of plutonium and americium in process solutions that have a wide range of concentrations and americium/plutonium ratios and for routine operation by process technicians who lack instrumentation background. The SAI, based on transmission-corrected, high-resolution gamma-ray spectroscopy, has two measurement stations attached to a single multichannel analyzer/computer system. To ensure the quality of assay results, the SAI has an internal measurement control program, which requires daily and weekly check runs and monitors key aspects of all assay runs. For a 25-ml sample, the assay precision is 5 g/l within a 2000-s count time

  2. Radionuclide generators

    International Nuclear Information System (INIS)

    Lambrecht, R.M.; Wollongong Univ.; Tomiyoshi, K.; Sekine, T.

    1997-01-01

    The present status and future directions of research and development on radionuclide generator technology are reported. The recent interest to develop double-neutron capture reactions for production of in vivo generators; neutron rich nuclides for radio-immunotherapeutic pharmaceuticals: and advances with ultra-short lived generators is highlighted. Emphasis is focused on: production of the parent radionuclide; the selection and the evaluation of support materials and eluents with respect to the resultant radiochemical yield of the daughter, and the breakthrough of the radionuclide parent: and, the uses of radionuclide generators in radiopharmaceutical chemistry, biomedical and industrial applications. The 62 Zn → 62 Cu, 66 Ni → 66 Cu, 103m Rh → 103 Rh, 188 W → 188 Re and the 225 Ac → 221 Fr → 213 Bi generators are predicted to be emphasized for future development. Coverage of the 99 Mo → 99m Tc generator was excluded, as it the subject of another review. The literature search ended June, 1996. (orig.)

  3. Recent developments in nuclear instruments

    International Nuclear Information System (INIS)

    Vaidya, P.P.

    2004-01-01

    Full text : Nuclear Instrumentation is a field of vital importance for DAE. It has important applications in many areas of interest such as Reactor Monitoring and control, Accelerator based research, Laser and nuclear physics experiments, Health and environmental monitoring, Astrophysics experiments etc. It is a specialized field involving expertise in detection of radioactivity down to the level of few events per minute as well as processing and analysis of signals which can be as small as few hundred micro volts embedded in noise. Some applications involve digitizing and processing these signals with 0.001% accuracy and timing accuracies of a fraction of nano sec. Rapid developments in semiconductor related technologies have influenced the field of nuclear instrumentation. Development of FPGA's and ASIC's have made it possible to develop miniaturized smart and portable instruments for field applications. Advancements in field of computers, communications and various field buses have been successfully utilized for smart, portable and DSP based instrumentation. Smart sensor with detector and front-end electronics on a single silicon chip is now a reality. These instruments are also made intelligent by addition of fuzzy logic, artificial neural networks and expert systems. Electronics Division of BARC has made significant contribution to the field of nuclear instrumentation to achieve self-reliance in this area. This has also led to development of several new methods, which have been published in international journals and appreciated worldwide. As a step towards achieving complete self-reliance a programme for development of FPGA's, HMC's and ASIC's has been undertaken and is being followed with special emphasis. This also includes development of detector and front- end electronics on a single chip. This talk brings out details of these developments and describes the 'state of art' work done in India

  4. Instrumentation for tropospheric aerosol characterization

    Energy Technology Data Exchange (ETDEWEB)

    Shi, Z.; Young, S.E.; Becker, C.H.; Coggiola, M.J. [SRI International, Menlo Park, CA (United States); Wollnik, H. [Giessen Univ. (Germany)

    1997-12-31

    A new instrument has been developed that determines the abundance, size distribution, and chemical composition of tropospheric and lower stratospheric aerosols with diameters down to 0.2 {mu}m. In addition to aerosol characterization, the instrument also monitors the chemical composition of the ambient gas. More than 25.000 aerosol particle mass spectra were recorded during the NASA-sponsored Subsonic Aircraft: Contrail and Cloud Effects Special Study (SUCCESS) field program using NASA`s DC-8 research aircraft. (author) 7 refs.

  5. Instrumentation for tropospheric aerosol characterization

    Energy Technology Data Exchange (ETDEWEB)

    Shi, Z; Young, S E; Becker, C H; Coggiola, M J [SRI International, Menlo Park, CA (United States); Wollnik, H [Giessen Univ. (Germany)

    1998-12-31

    A new instrument has been developed that determines the abundance, size distribution, and chemical composition of tropospheric and lower stratospheric aerosols with diameters down to 0.2 {mu}m. In addition to aerosol characterization, the instrument also monitors the chemical composition of the ambient gas. More than 25.000 aerosol particle mass spectra were recorded during the NASA-sponsored Subsonic Aircraft: Contrail and Cloud Effects Special Study (SUCCESS) field program using NASA`s DC-8 research aircraft. (author) 7 refs.

  6. Neutron-multiplication measurement instrument

    Energy Technology Data Exchange (ETDEWEB)

    Nixon, K.V.; Dowdy, E.J.; France, S.W.; Millegan, D.R.; Robba, A.A.

    1982-01-01

    The Advanced Nuclear Technology Group of the Los Alamos National Laboratory is now using intelligent data-acquisition and analysis instrumentation for determining the multiplication of nuclear material. Earlier instrumentation, such as the large NIM-crate systems, depended on house power and required additional computation to determine multiplication or to estimate error. The portable, battery-powered multiplication measurement unit, with advanced computational power, acquires data, calculates multiplication, and completes error analysis automatically. Thus, the multiplication is determined easily and an available error estimate enables the user to judge the significance of results.

  7. Neutron-multiplication measurement instrument

    International Nuclear Information System (INIS)

    Nixon, K.V.; Dowdy, E.J.; France, S.W.; Millegan, D.R.; Robba, A.A.

    1982-01-01

    The Advanced Nuclear Technology Group of the Los Alamos National Laboratory is now using intelligent data-acquisition and analysis instrumentation for determining the multiplication of nuclear material. Earlier instrumentation, such as the large NIM-crate systems, depended on house power and required additional computation to determine multiplication or to estimate error. The portable, battery-powered multiplication measurement unit, with advanced computational power, acquires data, calculates multiplication, and completes error analysis automatically. Thus, the multiplication is determined easily and an available error estimate enables the user to judge the significance of results

  8. Practical course on reactor instrumentation

    International Nuclear Information System (INIS)

    Boeck, H.; Villa, M.

    2004-06-01

    This course is based on the description of the instrumentation of the TRIGA-reactor Vienna, which is used for training research and isotope production. It comprises the following chapters: 1. instrumentation, 2. calibration of the nuclear channels, 3. rod drop time of the control rods, 4. neutron flux density measurements using compensated ionization, 5. neutron flux density measurement with fission chambers (FC), 6. neutron flux density measurement with self-powered neutron detectors (SPND), 7. pressurized water reactor simulator, 8. verification of the radiation level during reactor operation. There is one appendix about neutron-sensitive thermocouples. (nevyjel)

  9. Formation Flying and Deformable Instruments

    International Nuclear Information System (INIS)

    Rio, Yvon

    2009-01-01

    Astronomers have always attempted to build very stable instruments. They fight all that can cause mechanical deformation or image motion. This has led to well established technologies (autoguide, active optics, thermal control, tip/tilt correction), as well as observing methods based on the use of controlled motion (scanning, micro scanning, shift and add, chopping and nodding). Formation flying disturbs this practice. It is neither possible to reduce the relative motion to very small amplitudes, nor to control it at will. Some impacts on Simbol-X instrument design, and operation are presented.

  10. Formation Flying and Deformable Instruments

    Science.gov (United States)

    Rio, Yvon

    2009-05-01

    Astronomers have always attempted to build very stable instruments. They fight all that can cause mechanical deformation or image motion. This has led to well established technologies (autoguide, active optics, thermal control, tip/tilt correction), as well as observing methods based on the use of controlled motion (scanning, micro scanning, shift and add, chopping and nodding). Formation flying disturbs this practice. It is neither possible to reduce the relative motion to very small amplitudes, nor to control it at will. Some impacts on Simbol-X instrument design, and operation are presented.

  11. Neutron beam instruments at Harwell

    International Nuclear Information System (INIS)

    Baston, A.H.; Harris, D.H.C.

    1978-11-01

    A list and brief descriptions are given of the neutron beam facilities for U.K. scientists at Harwell and in academic institutions, available under an agreement between the Science Research Council and AERE (Harwell). The list falls under the following headings: reactor instruments (single crystal diffractometers, powder diffractometers, triple axis spectrometers, time-of-flight cold neutron twin rotor spectrometer, beryllium filter spectrometer, MARX spectrometer, Harwell small-angle scattering spectrometer); LINAC instruments (total scattering spectrometer, back scattering spectrometer, active sample spectrometer, inelastic rotor spectrometer, constant Q spectrometer); ancillary equipment (cryostats, superconducting magnets, electromagnets, furnaces). (U.K.)

  12. An introduction to biomedical instrumentation

    CERN Document Server

    Dewhurst, D J

    1976-01-01

    An Introduction to Biomedical Instrumentation presents a course of study and applications covering the basic principles of medical and biological instrumentation, as well as the typical features of its design and construction. The book aims to aid not only the cognitive domain of the readers, but also their psychomotor domain as well. Aside from the seminar topics provided, which are divided into 27 chapters, the book complements these topics with practical applications of the discussions. Figures and mathematical formulas are also given. Major topics discussed include the construction, handli

  13. New instruments for radiation protection

    International Nuclear Information System (INIS)

    Bartos, D.; Ciobanu, M.; Constantin, F.; Petcu, M.; Plostinaru, V.D.; Rusu, Al.; Lupu, A.C.; Lupu, F.

    2003-01-01

    Though a century old, the radiation protection is actual by its purpose: a dose as low as reasonable achievable is to be received either by involved professionals or population. This threshold is dependent on the technical progress. Some major developments like surface mounted device technology, consumer almost ideal operational amplifiers, microcontrollers and the news signal digital processing techniques, offer the opportunity to design improved instruments for radioprotection. To put in a light portable instrument both the whole measuring system and the 'intelligence' - a microcontroller and the associated software - are the main ideas applied by the authors. The result is presented: a family of eight members, at least, based on two parents. (authors)

  14. Advances in control and instrumentation

    International Nuclear Information System (INIS)

    Surendar, Ch.

    1994-01-01

    Control and instrumentation systems have seen significant changes from pneumatic to electronic with the advent of transistors and integrated circuits. Miniaturization was realised. With the introduction of microprocessors there has been a revolutionary change in the approach in instrumentation and control systems in the areas of sensors, data acquisition/transmission, processing for control, and presentation of the information to the operator. An effort is made to give some insight into these areas, with some idea of the advantages to which these systems are being put to use in the nuclear facilities, particularly nuclear power reactors. (author)

  15. Effect of Instrumentation Length and Instrumentation Systems: Hand Versus Rotary Files on Apical Crack Formation - An In vitro Study.

    Science.gov (United States)

    Devale, Madhuri R; Mahesh, M C; Bhandary, Shreetha

    2017-01-01

    Stresses generated during root canal instrumentation have been reported to cause apical cracks. The smaller, less pronounced defects like cracks can later propagate into vertical root fracture, when the tooth is subjected to repeated stresses from endodontic or restorative procedures. This study evaluated occurrence of apical cracks with stainless steel hand files, rotary NiTi RaCe and K3 files at two different instrumentation lengths. In the present in vitro study, 60 mandibular premolars were mounted in resin blocks with simulated periodontal ligament. Apical 3 mm of the root surfaces were exposed and stained using India ink. Preoperative images of root apices were obtained at 100x using stereomicroscope. The teeth were divided into six groups of 10 each. First two groups were instrumented with stainless steel files, next two groups with rotary NiTi RaCe files and the last two groups with rotary NiTi K3 files. The instrumentation was carried out till the apical foramen (Working Length-WL) and 1 mm short of the apical foramen (WL-1) with each file system. After root canal instrumentation, postoperative images of root apices were obtained. Preoperative and postoperative images were compared and the occurrence of cracks was recorded. Descriptive statistical analysis and Chi-square tests were used to analyze the results. Apical root cracks were seen in 30%, 35% and 20% of teeth instrumented with K-files, RaCe files and K3 files respectively. There was no statistical significance among three instrumentation systems in the formation of apical cracks (p=0.563). Apical cracks were seen in 40% and 20% of teeth instrumented with K-files; 60% and 10% of teeth with RaCe files and 40% and 0% of teeth with K3 files at WL and WL-1 respectively. For groups instrumented with hand files there was no statistical significance in number of cracks at WL and WL-1 (p=0.628). But for teeth instrumented with RaCe files and K3 files significantly more number of cracks were seen at WL than

  16. Effect of Instrumentation Length and Instrumentation Systems: Hand Versus Rotary Files on Apical Crack Formation – An In vitro Study

    Science.gov (United States)

    Mahesh, MC; Bhandary, Shreetha

    2017-01-01

    Introduction Stresses generated during root canal instrumentation have been reported to cause apical cracks. The smaller, less pronounced defects like cracks can later propagate into vertical root fracture, when the tooth is subjected to repeated stresses from endodontic or restorative procedures. Aim This study evaluated occurrence of apical cracks with stainless steel hand files, rotary NiTi RaCe and K3 files at two different instrumentation lengths. Materials and Methods In the present in vitro study, 60 mandibular premolars were mounted in resin blocks with simulated periodontal ligament. Apical 3 mm of the root surfaces were exposed and stained using India ink. Preoperative images of root apices were obtained at 100x using stereomicroscope. The teeth were divided into six groups of 10 each. First two groups were instrumented with stainless steel files, next two groups with rotary NiTi RaCe files and the last two groups with rotary NiTi K3 files. The instrumentation was carried out till the apical foramen (Working Length-WL) and 1 mm short of the apical foramen (WL-1) with each file system. After root canal instrumentation, postoperative images of root apices were obtained. Preoperative and postoperative images were compared and the occurrence of cracks was recorded. Descriptive statistical analysis and Chi-square tests were used to analyze the results. Results Apical root cracks were seen in 30%, 35% and 20% of teeth instrumented with K-files, RaCe files and K3 files respectively. There was no statistical significance among three instrumentation systems in the formation of apical cracks (p=0.563). Apical cracks were seen in 40% and 20% of teeth instrumented with K-files; 60% and 10% of teeth with RaCe files and 40% and 0% of teeth with K3 files at WL and WL-1 respectively. For groups instrumented with hand files there was no statistical significance in number of cracks at WL and WL-1 (p=0.628). But for teeth instrumented with RaCe files and K3 files

  17. An instrument to perform automated quality assurance and patient dosimetry in diagnostic radiology

    International Nuclear Information System (INIS)

    Chapple, C.-L.; Faulkner, K.

    1992-01-01

    A computerised method of automatically monitoring tube and generator parameters to perform on-line quality assurance and patient dosimetry has been developed. A microcomputer has been interfaced to a microprocessor controlled X ray generator and dose-area product meter. The instrument prompts the operator to enter details of the examination and projection before an examination is made. The field size and dose-area product are monitored by the instrument. These data, together with information on the tube potential are used to deduce the patient entrance dose and energy imparted. Organ doses are estimated using normalised organ dose data. The accuracy and reproducibility of the instrument were investigated. Doses measured in a Rando phantom were compared with calculations made by the instrument. The instrument will compare various measured quality assurance parameters against their nominal values. The implications of this instrument for both patient dosimetry studies and effective continuous quality assurance are discussed. (author)

  18. Steam generator leak detection using acoustic method

    International Nuclear Information System (INIS)

    Goluchko, V.V.; Sokolov, B.M.; Bulanov, A.N.

    1982-05-01

    The main requirements to meet by a device for leak detection in sodium - water steam generators are determined. The potentialities of instrumentation designed based on the developed requirements have been tested using a model of a 550 kw steam generator [fr

  19. Instrumentation of dynamic gas pulse loading system

    Energy Technology Data Exchange (ETDEWEB)

    Mohaupt, H.

    1992-04-14

    The overall goal of this work is to further develop and field test a system of stimulating oil and gas wells, which increases the effective radius of the well bore so that more oil can flow into it, by recording pressure during the gas generation phase in real time so that fractures can be induced more predictably in the producing formation. Task 1: Complete the laboratory studies currently underway with the prototype model of the instrumentation currently being studied. Task 2: Perform field tests of the model in the Taft/Bakersfield area, utilizing operations closest to the engineers working on the project, and optimize the unit for various conditions encountered there. Task 3: Perform field test of the model in DGPL jobs which are scheduled in the mid-continent area, and optimize the unit for downhole conditions encountered there. Task 4: Analyze and summarize the results achieved during the complete test series, documenting the steps for usage of downhole instrumentation in the field, and compile data specifying use of the technology by others. Task 5: Prepare final report for DOE, and include also a report on the field tests completed. Describe and estimate the probability of the technology being commercialized and in what time span. The project has made substantial technical progress, though we are running about a month behind schedule. Expenditures are in line with the schedule. Increased widespread interest in the use of DGPL stimulation has kept us very busy. The computer modeling and test instrumentation developed under this program is already being applied to commercial operations.

  20. Real-time instrument-failure detection in the LOFT pressurizer using functional redundancy

    International Nuclear Information System (INIS)

    Tylee, J.L.

    1982-07-01

    The functional redundancy approach to detecting instrument failures in a pressurized water reactor (PWR) pressurizer is described and evaluated. This real-time method uses a bank of Kalman filters (one for each instrument) to generate optimal estimates of the pressurizer state. By performing consistency checks between the output of each filter, failed instruments can be identified. Simulation results and actual pressurizer data are used to demonstrate the capabilities of the technique

  1. Meteorological instrumentation for nuclear facilities

    International Nuclear Information System (INIS)

    Costa, A.C.L. da.

    1983-01-01

    The main requirements of regulatory agencies, concerning the meteorological instrumentation needed for the licensing of nuclear facilities are discussed. A description is made of the operational principles of sensors for the various meteorological parameters and associated electronic systems. An analysis of the problems associated with grounding of a typical meteorological station is presented. (Author) [pt

  2. Loyaliteitsprogramma's: zinvol CRM-instrument?

    NARCIS (Netherlands)

    Leenheer, J.

    2006-01-01

    Loyalty programs have been widely adopted by companies and their customers. A loyalty program is a relational marketing instrument that aims to enhance customer loyalty. However, skepticism exists about the implementation and effectiveness of loyalty programs. This paper studies for whom, when and

  3. Literature Review of Multicultural Instrumentation

    Science.gov (United States)

    Sarraj, Huda; Carter, Stacy; Burley, Hansel

    2015-01-01

    Demographic changes at the national level emphasize a critical need for multicultural education to be included as part of undergraduate education. This critical review of the literature examines 10 multicultural instruments that are suitable for use in K-12 or higher education institutions. This is a novel literature review in that it is the first…

  4. Meteorological instrumentation for nuclear installations

    International Nuclear Information System (INIS)

    Costa, A.C.L. da.

    1983-01-01

    The main requirements of regulatory agencies, concerning the meteorological instrumentation needed for the licensing of nuclear facilities are discussed. A description is made of the operational principles of sensors for the various meteorological parameters and associated electronic systems. Finally, it is presented an analysis of the problems associated with grounding of a typical meteorological station. (Author) [pt

  5. Mobile Instruments Measure Atmospheric Pollutants

    Science.gov (United States)

    2009-01-01

    As a part of NASA's active research of the Earth s atmosphere, which has included missions such as the Atmospheric Laboratory of Applications and Science (ATLAS, launched in 1992) and the Total Ozone Mapping Spectrometer (TOMS, launched on the Earth Probe satellite in 1996), the Agency also performs ground-based air pollution research. The ability to measure trace amounts of airborne pollutants precisely and quickly is important for determining natural patterns and human effects on global warming and air pollution, but until recent advances in field-grade spectroscopic instrumentation, this rapid, accurate data collection was limited and extremely difficult. In order to understand causes of climate change and airborne pollution, NASA has supported the development of compact, low power, rapid response instruments operating in the mid-infrared "molecular fingerprint" portion of the electromagnetic spectrum. These instruments, which measure atmospheric trace gases and airborne particles, can be deployed in mobile laboratories - customized ground vehicles, typically - to map distributions of pollutants in real time. The instruments must be rugged enough to operate rapidly and accurately, despite frequent jostling that can misalign, damage, or disconnect sensitive components. By measuring quickly while moving through an environment, a mobile laboratory can correlate data and geographic points, revealing patterns in the environment s pollutants. Rapid pollutant measurements also enable direct determination of pollutant sources and sinks (mechanisms that remove greenhouse gases and pollutants), providing information critical to understanding and managing atmospheric greenhouse gas and air pollutant concentrations.

  6. Market-based Economic Instruments

    DEFF Research Database (Denmark)

    Klemmensen, Børge

    2007-01-01

    Grundkategorien her er markedet som den optimale allokeringsmekanisme for de belastninger, som de økonomiske instrumenter / miljøskatterne påfører. Det mest omfattende og spektakulære eksempel på markedet som allokatorer af skatter er EU's børs for forureningstilladelser, dvs reelt CO-2 beskatnin...

  7. Alternative instruments for the CAP?

    NARCIS (Netherlands)

    Silvis, H.J.; Rijswick, van C.W.J.; Bont, de C.J.A.M.

    2001-01-01

    With parallel negotiations taking place on enlargement of the EU and a new WTO agreement, EU's Common Agricultural Policy is facing further reforms. This report addresses the issue of whether any alternatives can be found for the instruments of this policy, and looks at decoupled payments, a net

  8. Management system of instrument database

    International Nuclear Information System (INIS)

    Zhang Xin

    1997-01-01

    The author introduces a management system of instrument database. This system has been developed using with Foxpro on network. The system has some characters such as clear structure, easy operation, flexible and convenient query, as well as the data safety and reliability

  9. A portable luminescence dating instrument

    DEFF Research Database (Denmark)

    Kook, M.H.; Murray, A.S.; Lapp, Torben

    2011-01-01

    We describe a portable luminescence reader suitable for use in remote localities in the field. The instrument weighs about 8kg and is based around a 30mm bialkali photomultiplier detecting signals through a glass filter centered on 340nm. Stimulation is by 470nm blue LEDs (24W in total) operating...

  10. [Organising an instrumental elective abortion].

    Science.gov (United States)

    Brûlé, Annie

    2015-12-01

    Family planning centres are structures designed to receive and care for women requesting elective abortions. Here the specially trained, dedicated teams offer personalised care. The instrumental elective abortion is prepared in the same way as a surgical procedure and is subject to the same monitoring. Copyright © 2015 Elsevier Masson SAS. All rights reserved.

  11. Experimenting with Brass Musical Instruments.

    Science.gov (United States)

    LoPresto, Michael C.

    2003-01-01

    Describes experiments to address the properties of brass musical instruments that can be used to demonstrate sound in any level physics course. The experiments demonstrate in a quantitative fashion the effects of the mouthpiece and bell on the frequencies of sound waves and thus the musical pitches produced. (Author/NB)

  12. Instrumental activation analysis of molybdenites

    International Nuclear Information System (INIS)

    Geisler, M.; Schelhorn, H.

    1981-01-01

    Na, K, Sc, Cr, Fe, Co, Se, Rb, Ag, Cs, Ba, La, Ce, Eu, Yb, Hf, W, Re, and Th have been determined in 6 molybdenite samples by instrumental activation analysis. The samples were of different origin and showed K, Sc, W, and Re values with differences of more than two orders of magnitude, whereas Sc values were within one order of magnitude

  13. Scientific Instruments and Epistemology Engines

    Czech Academy of Sciences Publication Activity Database

    Dvořák, Tomáš

    2012-01-01

    Roč. 34, č. 4 (2012), s. 529-540 ISSN 1210-0250 R&D Projects: GA ČR(CZ) GAP401/11/2338 Institutional support: RVO:67985955 Keywords : material culture of science * scientific instruments * epistemology engines * experimental systems Subject RIV: AA - Philosophy ; Religion

  14. Instrumentation for PIXE and RBS

    International Nuclear Information System (INIS)

    2000-12-01

    The purpose of this document is to give an overview of instrumentation for PIXE and Rutherford backscattering analysis, including hardware and software needed to perform the analysis, including detectors, analyzers, data acquisition systems and data analysis software. It also provides some information on accelerators needed for these applications

  15. CAMAC-controlled calibration system for nuclear reactor instruments

    International Nuclear Information System (INIS)

    McDowell, W.P.; Cornella, R.J.

    1977-01-01

    The hardware and the software which have been developed to implement a nuclear instrument calibration system for the Argonne National Laboratory ZPR-VI and ZPR-IX reactor complex are described. The system is implemented using an SEL-840 computer with its associated CAMAC crates and a hardware interface to generate input parameters and measure the required outputs on the instrument under test. Both linear and logarithmic instruments can be calibrated by the system and output parameters can be measured at various automatically selected values of ac line voltage. A complete report on each instrument is printed as a result of the calibration and out-of-tolerance readings are flagged. Operator interface is provided by a CAMAC-controlled Hazeltine terminal. The terminal display leads the operator through the complete calibration procedure. This computer-controlled system is a significant improvement over previously used methods of calibrating nuclear instruments since it reduces reactor downtime and allows rapid detection of long-term changes in instrument calibration

  16. Development and evaluation of the Korean Health Literacy Instrument.

    Science.gov (United States)

    Kang, Soo Jin; Lee, Tae Wha; Paasche-Orlow, Michael K; Kim, Gwang Suk; Won, Hee Kwan

    2014-01-01

    The purpose of this study is to develop and validate the Korean Health Literacy Instrument, which measures the capacity to understand and use health-related information and make informed health decisions in Korean adults. In Phase 1, 33 initial items were generated to measure functional, interactive, and critical health literacy with prose, document, and numeracy tasks. These items included content from health promotion, disease management, and health navigation contexts. Content validity assessment was conducted by an expert panel, and 11 items were excluded. In Phase 2, the 22 remaining items were administered to a convenience sample of 292 adults from community and clinical settings. Exploratory factor and item difficulty and discrimination analyses were conducted and four items with low discrimination were deleted. In Phase 3, the remaining 18 items were administered to a convenience sample of 315 adults 40-64 years of age from community and clinical settings. A confirmatory factor analysis was performed to test the construct validity of the instrument. The Korean Health Literacy Instrument has a range of 0 to 18. The mean score in our validation study was 11.98. The instrument exhibited an internal consistency reliability coefficient of 0.82, and a test-retest reliability of 0.89. The instrument is suitable for screening individuals who have limited health literacy skills. Future studies are needed to further define the psychometric properties and predictive validity of the Korean Health Literacy Instrument.

  17. The GLAST LAT Instrument Science Operations Center

    International Nuclear Information System (INIS)

    Cameron, Robert A.; SLAC

    2007-01-01

    The Gamma-ray Large Area Space Telescope (GLAST) is scheduled for launch in late 2007. Operations support and science data processing for the Large Area Telescope (LAT) instrument on GLAST will be provided by the LAT Instrument Science Operations Center (ISOC) at the Stanford Linear Accelerator Center (SLAC). The ISOC supports GLAST mission operations in conjunction with other GLAST mission ground system elements and supports the research activities of the LAT scientific collaboration. The ISOC will be responsible for monitoring the health and safety of the LAT, preparing command loads for the LAT, maintaining embedded flight software which controls the LAT detector and data acquisition flight hardware, maintaining the operating configuration of the LAT and its calibration, and applying event reconstruction processing to down-linked LAT data to recover information about detected gamma-ray photons. The SLAC computer farm will be used to process LAT event data and generate science products, to be made available to the LAT collaboration through the ISOC and to the broader scientific community through the GLAST Science Support Center at NASA/GSFC. ISOC science operations will optimize the performance of the LAT and oversee automated science processing of LAT data to detect and monitor transient gamma-ray sources

  18. ATLAS Facility and Instrumentation Description Report

    International Nuclear Information System (INIS)

    Kang, Kyoung Ho; Moon, Sang Ki; Park, Hyun Sik

    2009-06-01

    A thermal-hydraulic integral effect test facility, ATLAS (Advanced Thermal-hydraulic Test Loop for Accident Simulation), has been constructed at KAERI (Korea Atomic Energy Research Institute). The ATLAS is a half-height and 1/288-volume scaled test facility with respect to the APR1400. The fluid system of the ATLAS consists of a primary system, a secondary system, a safety injection system, a break simulating system, a containment simulating system, and auxiliary systems. The primary system includes a reactor vessel, two hot legs, four cold legs, a pressurizer, four reactor coolant pumps, and two steam generators. The secondary system of the ATLAS is simplified to be of a circulating looptype. Most of the safety injection features of the APR1400 and the OPR1000 are incorporated into the safety injection system of the ATLAS. In the ATLAS test facility, about 1300 instrumentations are installed to precisely investigate the thermal-hydraulic behavior in simulation of the various test scenarios. This report describes the scaling methodology, the geometric data of the individual component, and the specification and the location of the instrumentations which are specific to the simulation of 50% DVI line break accident of the APR1400 for supporting the 50 th OECD/NEA International Standard Problem Exercise (ISP-50)

  19. Instrument for assessing coronary symptoms in women

    Directory of Open Access Journals (Sweden)

    Cándida Rosa Castañeda Valencia

    2015-09-01

    Full Text Available Objective: To design and validate an instrument for assessing the symptoms in women with coronary disease framed in the Theory of the Unpleasant Symptoms. Methodology: Methodological, psychometric study oriented by The symptoms, first concept of the Theory of Unpleasant Symptoms by Lenz et al. Theoretical critique of the construct chosen was performed proving usefulness in research and practice discipline. From the empirical, 260 evidences were weighted through methodological and empirical critique, applying the Integrative Review System articulated to the Empirical Conceptual Model by Fawcett Garity. Only 30 research pieces were obtained, used for the construction of the items. To the Lenz symptoms were added the reported psychosocial symptoms in women with coronary disease, generating a first design composed of 87 items. Results:The design was done by experts Content Validation with the Escobar and Cuervo Model 2008 (statistical analysis spss, 20 with Kendall Correlation Coefficient k = 0.682 (p ; 0.05 with good agreement between judges. Lawshe Model normalized by Tristán 2008 reported a Content Validity Ratio = 0.57 and Content Validity Index = 0.797, showing that items are units of essential analysis. Finally, Validation Facial made by means of the pilot test, conducted on 21 women who met the inclusion criteria, allowed the discrimination semiotics of items, obtaining an instrument consisting of 67 items.  Conclusions:This is a remnant of research that requires further validation to increase its psychometric capacity.

  20. Radionuclide generators

    International Nuclear Information System (INIS)

    Lambrecht, R.M.

    1983-01-01

    The status of radionuclide generators for chemical research and applications related to the life sciences and biomedical research are reviewed. Emphasis is placed upon convenient, efficient and rapid separation of short-lived daughter radionuclides in a chemical form suitable for use without further chemical manipulation. The focus is on the production of the parent, the radiochemistry associated with processing the parent and daughter, the selection and the characteristic separation methods, and yields. Quality control considerations are briefly noted. The scope of this review includes selected references to applications of radionuclide generators in radiopharmaceutical chemistry, and the life sciences, particularly in diagnostic and therapeutic medicine. The 99 Mo-sup(99m)Tc generator was excluded. 202 references are cited. (orig.)

  1. Method of decontaminating radioactive-contaminated instruments

    International Nuclear Information System (INIS)

    Urata, Megumu; Fujii, Masaaki; Kitaguchi, Hiroshi.

    1982-01-01

    Purpose: To enable safety processing of liquid wastes by recovering radioactive metal ions remaining in the electrolytes after the decontamination procedure thereby decreasing the radioactivity. Method: In a decontamination tank containing electrolytes consisting of diluted hydrochloric acid and diluted sulfuric acid, are provided a radioactive contaminated instrument connected to an anode and a collector electrode made of stainless steel connected to a cathode respectively. Upon applying electrical current, the portion of the mother material to be decontaminated is polished electrolytically into metal ions and they are deposited as metal on the collection electrode. After completion of the decontamination, an ultrasonic wave generator is operated to strip and remove the oxide films. Thereafter, the anode is replaced with the carbon electrode and electrical current is supplied continuously, whereby the remaining metal ions are deposited and recovered as the metal on the collection electrode. (Yoshino, Y.)

  2. Southern California Edison instrument setpoint program

    International Nuclear Information System (INIS)

    Bockhorst, R.M.; Quinn, E.L.

    1991-01-01

    In November of 1989, the US Nuclear Regulatory Commission (NRC) conducted an electrical safety system functional inspection (ESSFI) at the San Onofre nuclear generating station (SONGS), which was followed by an NRC audit on instrument setpoint methodology in January 1991. Units 2 and 3 at SONGS are 1100-MW(electric) Combustion Engineering (C-E) pressurized water reactors (PWRs) operated by Southern California Edison (SCE). The purpose of this paper is to summarize the results of the NRC audit and SCE's follow-up activities. The NRC team inspection reinforced the need to address several areas relative to the SCE setpoint program. The calculations withstood the intensive examination of four NRC inspectors for 2 weeks and only a few minor editorial-type problems were noted. Not one of the calculated plant protections system setpoints will change as a result of the audit. There were no questions raised relative to setpoint methodology

  3. Method of decontaminating radioactive-contaminated instruments

    Energy Technology Data Exchange (ETDEWEB)

    Urata, M; Fujii, M; Kitaguchi, H

    1982-03-29

    Purpose: To enable safety processing of liquid wastes by recovering radioactive metal ions remaining in the electrolytes after the decontamination procedure thereby decreasing the radioactivity. Method: In a decontamination tank containing electrolytes consisting of diluted hydrochloric acid and diluted sulfuric acid, are provided a radioactive contaminated instrument connected to an anode and a collector electrode made of stainless steel connected to a cathode respectively. Upon applying electrical current, the portion of the mother material to be decontaminated is polished electrolytically into metal ions and they are deposited as metal on the collection electrode. After completion of the decontamination, an ultrasonic wave generator is operated to strip and remove the oxide films. Thereafter, the anode is replaced with the carbon electrode and electrical current is supplied continuously, whereby the remaining metal ions are deposited and recovered as the metal on the collection electrode.

  4. Technological considerations in emergency instrument preparedness

    International Nuclear Information System (INIS)

    Selby, J.M.

    1975-01-01

    The types of emergency instrumentation systems necessary to characterize the severity and extent of radiation accidents and to aid in the protection of operating personnel and personnel living near the plant are discussed. These include instruments for direct measurement of the airborne radioactive material within the facility, fixed instrumentation for ambient dose rate monitoring or area monitoring, and portable instruments for environmental monitoring

  5. Pulsed neutron source and instruments at neutron facility

    Energy Technology Data Exchange (ETDEWEB)

    Teshigawara, Makoto; Aizawa, Kazuya; Suzuki, Jun-ichi; Morii, Yukio; Watanabe, Noboru [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    1997-11-01

    We report the results of design studies on the optimal target shape, target - moderator coupling, optimal layout of moderators, and neutron instruments for a next generation pulsed spallation source in JAERI. The source utilizes a projected high-intensity proton accelerator (linac: 1.5 GeV, {approx}8 MW in total beam power, compressor ring: {approx}5 MW). We discuss the target neutronics, moderators and their layout. The sources is designed to have at least 30 beam lines equipped with more than 40 instruments, which are selected tentatively to the present knowledge. (author)

  6. Instrumental biosensors: new perspectives for the analysis of biomolecular interactions.

    Science.gov (United States)

    Nice, E C; Catimel, B

    1999-04-01

    The use of instrumental biosensors in basic research to measure biomolecular interactions in real time is increasing exponentially. Applications include protein-protein, protein-peptide, DNA-protein, DNA-DNA, and lipid-protein interactions. Such techniques have been applied to, for example, antibody-antigen, receptor-ligand, signal transduction, and nuclear receptor studies. This review outlines the principles of two of the most commonly used instruments and highlights specific operating parameters that will assist in optimising experimental design, data generation, and analysis.

  7. GALAXI: Gallium anode low-angle x-ray instrument

    Directory of Open Access Journals (Sweden)

    Emmanuel Kentzinger

    2016-03-01

    Full Text Available The high brilliance laboratory small angle X-ray scattering instrument GALAXI, which is operated by JCNS, Forschungszentrum Jülich, permits the investigation of chemical correlations in bulk materials or of structures deposited on a surface at nanometre and mesoscopic length scales. The instrument is capable to perform GISAXS experiments in reflection at grazing incidence as well as SAXS experiments in transmission geometry. The X-ray flux on sample is comparable or higher than the one obtained at a comparable beamline at a second generation synchrotron radiation source.

  8. Providing nuclear reactor control information in the presence of instrument failures

    International Nuclear Information System (INIS)

    Tylee, J.L.; Purviance, J.E.

    1986-01-01

    A technique for using unfailed instrument outputs to generate optimal estimates of failed sensor outputs is presented and evaluated. The technique uses a bank of discrete, linear Kalman filters, each dedicated to one instrument, and a combinatory logic to perform the output estimation. The technique is tested using measurement data from a university research reactor

  9. Temperature documentation - instrument for quality assurance; Temperaturdokumentation - Instrument der Qualitaetssicherung

    Energy Technology Data Exchange (ETDEWEB)

    Hegglin, A [Wurm AG, Winterthur (Switzerland)

    2000-10-01

    Important inspection points of a HACCP concept are the temperatures. On the basis of the demands for a systematic temperature documentation, the application of control systems and instruments is described by several examples. (orig.) [German] Wichtige Kontrollpunkte eines HACCP-Konzepts sind die Temperaturen. Ausgehend von den Anforderungen, die an eine systematische Temperaturedokumentation gestellt werden, wird der Einsatz geeigneter Regel- und Ueberwachungsgeraete an mehreren Beispielen erlaeutert. (orig.)

  10. Instrumentation requirements for the ESF thermomechanical experiments

    International Nuclear Information System (INIS)

    Pott, J.; Brechtel, C.E.

    1992-01-01

    In situ thermomechanical experiments are planned as part of the Yucca Mountain Site Characterization Project that require instruments to measure stress and displacement at temperatures that exceed the typical specifications of existing geotechnical instruments. A high degree of instrument reliability will also be required to satisfy the objectives of the experiments, therefore a study was undertaken to identify areas where improvement in instrument performance was required. A preliminary list of instruments required for the experiments was developed, based on existing test planning and analysis. Projected temperature requirements were compared to specifications of existing instruments to identify instrumentation development needs. Different instrument technologies, not currently employed in geotechnical instrumentation, were reviewed to identify potential improvements of existing designs for the high temperature environment. Technologies with strong potentials to improve instrument performance with relatively high reliability include graphite fiber composite materials, fiber optics, and video imagery

  11. Analysis of instrumentation technology for SMART

    International Nuclear Information System (INIS)

    Hur, Seop; Koo, I. S.; Park, H. Y.; Lee, C. K.; Kim, D. H.; Suh, Y. S.; Seong, S. H.; Jang, G. S.

    1998-03-01

    It is necessary that development requirements, techniques to be developed, and development tasks and approach are established to develop the SMART instrumentation system. It is important to establish the development strategies for input for developing SMART instrumentation system. To meet above needs, the industry general and nuclear instrumentation techniques were analyzed and reviewed, respectively, based on the classification of instrumentation to analyze the industrial instrumentation techniques, and analysis results which described the inherent merits and demerits of each technique can be used for inputs to select the instruments for SMART. For the instrumentation techniques for nuclear environments, the major instrumentation techniques were reviewed, and the instrumentation system were established. The following development approaches were established based on the development requirements and the analysis results of research and development trends of industrial and nuclear instrumentation techniques. (author). 90 refs., 38 tabs., 33 figs

  12. The history of thoracic surgical instruments and instrumentation.

    Science.gov (United States)

    Hagopian, E J; Mann, C; Galibert, L A; Steichen, F M

    2000-02-01

    Thoracic surgical practice has evolved from the innovations of its pioneers. Beginning with the stethoscope discovered by Laënnec with his system of auscultation, to the tools we use in the dissection and control of the hilum of the lung for resection, our practice of thoracic surgery has been entwined with the development of instruments and instrumentation. The development of strategies to prevent death from the open pneumothorax began with manual control of the mediastinum and progressed through differential pressure to, finally, the technique of intubation and the methods of positive-pressure and insufflation anesthesia. The instruments we place in our hands are not enough to define our art. Entry into the chest would not be possible without the use of rib retractors, rib shears, and even periosteal elevators. Finally, to the present day of minimally invasive techniques and the application of thoracoscopy for therapeutic purposes, we find the efforts of our predecessors well developed. For the progression from the fear of the open pneumothorax to the present-day state of the ease of thoracotomy for lung resection we are indebted to those who gave so much of their time and, for some, their lives to death from tuberculosis, to allow the advancement of our practice of surgery. These great people should be remembered not only for their acceptance of novel ideas but also, more importantly, for their lack of fear of testing them.

  13. Generation Next

    Science.gov (United States)

    Hawkins, B. Denise

    2010-01-01

    There is a shortage of accounting professors with Ph.D.s who can prepare the next generation. To help reverse the faculty deficit, the American Institute of Certified Public Accountants (CPAs) has created the new Accounting Doctoral Scholars program by pooling more than $17 million and soliciting commitments from more than 70 of the nation's…

  14. Generative Contexts

    Science.gov (United States)

    Lyles, Dan Allen

    Educational research has identified how science, technology, engineering, and mathematics (STEM) practice and education have underperforming metrics in racial and gender diversity, despite decades of intervention. These disparities are part of the construction of a culture of science that is alienating to these populations. Recent studies in a social science framework described as "Generative Justice" have suggested that the context of social and scientific practice might be modified to bring about more just and equitable relations among the disenfranchised by circulating the value they and their non-human allies create back to them in unalienated forms. What is not known are the underlying principles of social and material space that makes a system more or less generative. I employ an autoethnographic method at four sites: a high school science class; a farm committed to "Black and Brown liberation"; a summer program geared towards youth environmental mapping; and a summer workshop for Harlem middle school students. My findings suggest that by identifying instances where material affinity, participatory voice, and creative solidarity are mutually reinforcing, it is possible to create educational contexts that generate unalienated value, and circulate it back to the producers themselves. This cycle of generation may help explain how to create systems of justice that strengthen and grow themselves through successive iterations. The problem of lack of diversity in STEM may be addressed not merely by recruiting the best and the brightest from underrepresented populations, but by changing the context of STEM education to provide tools for its own systematic restructuring.

  15. Steam generators

    International Nuclear Information System (INIS)

    Hayden, R.L.J.

    1979-01-01

    Steam generators for nuclear reactors are designed so that deposition of solids on the surface of the inlet side of the tubesheet or the inlet header with the consequent danger of corrosion and eventual tube failure is obviated or substantially reduced. (U.K.)

  16. Development of CAMAC and Fastbus instrumentation

    International Nuclear Information System (INIS)

    Venkateswaran, Aruna; Behere, Anita; Ghodgaonkar, M.D.; Bairi, B.R.

    1987-01-01

    This report describes the work being done towards the development of CAMAC and Fast Bus Instrumentation under the VII Five Year Plan Project 'Modernisation of Reactor Control Instrumentation and Development of CAMAC and FAST BUS Instrumentation'. The report summarises the goals, objectives, principles and concepts of CAMAC and Fast Bus Instrumentation. While emphasizing the motivation behind the development of CAMAC and Fast Bus Instrumentation, the report brings out the current status and future plans of this development program. (author)

  17. ACRF Instrumentation Status and Information September 2009

    Energy Technology Data Exchange (ETDEWEB)

    JW Voyles

    2009-10-01

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following five sections: (1) new instrumentation in the process of being acquired and deployed, (2) field campaigns, (3) existing instrumentation and progress on improvements or upgrades, (4) proposed future instrumentation, and (5) Small Business Innovation Research instrument development.

  18. ACRF Instrumentation Status and Information April 2009

    Energy Technology Data Exchange (ETDEWEB)

    Voyles, JW

    2009-05-07

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following five sections: (1) new instrumentation in the process of being acquired and deployed, (2) field campaigns, (3) existing instrumentation and progress on improvements or upgrades, (4) proposed future instrumentation, and (5) Small Business Innovation Research instrument development.

  19. ACRF Instrumentation Status and Information August 2009

    Energy Technology Data Exchange (ETDEWEB)

    JW Voyles

    2009-09-09

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following five sections: (1) new instrumentation in the process of being acquired and deployed, (2) field campaigns, (3) existing instrumentation and progress on improvements or upgrades, (4) proposed future instrumentation, and (5) Small Business Innovation Research instrument development.

  20. ACRF Instrumentation Status and Information July 2009

    Energy Technology Data Exchange (ETDEWEB)

    JW Voyles

    2009-08-13

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following five sections: (1) new instrumentation in the process of being acquired and deployed, (2) field campaigns, (3) existing instrumentation and progress on improvements or upgrades, (4) proposed future instrumentation, and (5) Small Business Innovation Research instrument development.

  1. ACRF Instrumentation Status and Information - June 2009

    Energy Technology Data Exchange (ETDEWEB)

    JW Voyles

    2009-06-01

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following five sections: (1) new instrumentation in the process of being acquired and deployed, (2) field campaigns, (3) existing instrumentation and progress on improvements or upgrades, (4) proposed future instrumentation, and (5) Small Business Innovation Research instrument development.

  2. ACRF Instrumentation Status and Information May 2009

    Energy Technology Data Exchange (ETDEWEB)

    JW Voyles

    2009-05-01

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following five sections: (1) new instrumentation in the process of being acquired and deployed, (2) field campaigns, (3) existing instrumentation and progress on improvements or upgrades, (4) proposed future instrumentation, and (5) Small Business Innovation Research instrument development.

  3. Advance on solar instrumentation in China

    Science.gov (United States)

    Yan, Yihua

    2015-08-01

    The solar observing facilities in China are introduced with the emphasis on the development in recent years and future plans for both ground and space-based solar instrumentations. The recent solar instruments are as follows: A new generation Chinese Spectral Radioreliograph (CSRH) has been constructed at Mingantu Observing Station in Zhengxiangbaiqi, inner Mongolia of China since 2013 and is in test observations now. CSRH has two arrays with 40 × 4.5 m and 60 × 2 m parabolic antennas covering 0.4-2 GHz and 2-15 GHz frequency range. CSRH is renamed as MUSER (Mingantu Ultrawide Spectral Radiheliograph) after its accomplishment. A new 1 m vacuum solar telescope (NVST) has been installed in 2010 at Fuxian lake, 60 km away from Kunming, Yunana. At present it is the best seeing place in China. A new telescope called ONSET (Optical and NIR Solar Eruption Tracer) has been established at the same site as NVST in 2011. ONSET has been put into operation since 2013. For future ground-based plans, Chinese Giant Solar Telescope (CGST) with spatial resolution equivalent to 8m and effective area of 5m full-aperture telescope has been proposed and was formally listed into the National Plans of Major Science & Technology Infrastructures in China. The pre-study and site survey for CGST have been pursued. A 1-meter mid-infrared telescope for precise measurement of the solar magnetic field has been funded by NSFC in 2014 as a national major scientific instrument development project. This project will develop the first mid-infrared solar magnetic observation instrument in the world aiming at increasing the precision of the transverse magnetic field measurement by one order of magnitude. For future ground-based plans, we promote the Deep-space Solar Observatory (DSO) with 1-m aperture telescope to be formally funded. The ASO-S (an Advanced Space-based Solar Observatory) has been supported in background phase by Space Science Program as a small mission. Other related space solar

  4. The Chemistry of Flammable Gas Generation

    International Nuclear Information System (INIS)

    ZACH, J.J.

    2000-01-01

    The document collects information from field instrumentation, laboratory tests, and analytical models to provide a single source of information on the chemistry of flammable gas generation at the Hanford Site. It considers the 3 mechanisms of formation: radiolysis, chemical reactions, and thermal generation. An assessment of the current models for gas generation is then performed. The results are that the various phenomena are reasonably understood and modeled compared to field data

  5. The Chemistry of Flammable Gas Generation

    Energy Technology Data Exchange (ETDEWEB)

    ZACH, J.J.

    2000-10-30

    The document collects information from field instrumentation, laboratory tests, and analytical models to provide a single source of information on the chemistry of flammable gas generation at the Hanford Site. It considers the 3 mechanisms of formation: radiolysis, chemical reactions, and thermal generation. An assessment of the current models for gas generation is then performed. The results are that the various phenomena are reasonably understood and modeled compared to field data.

  6. CERCA's fuel elements instrumentation manufacturing

    International Nuclear Information System (INIS)

    Harbonnier, G.; Jarousse, C.; Pin, T.; Febvre, M.; Colomb, P.

    2005-01-01

    When research and test reactors wish to further understand the Fuel Elements behavior when operating as well as mastering their irradiation conditions, operators carry out neutron and thermo hydraulic analysis. For thermal calculation, the codes used have to be preliminary validated, at least in the range of the reactor safety operational limits. When some further investigations are requested either by safety authorities or for its own reactor needs, instrumented tools are the ultimate solution for providing representative measurements. Such measurements can be conducted for validating thermal calculation codes, at nominal operating condition as well as during transients ones, or for providing numerous and useful data in the frame of a new products qualification program. CERCA, with many years of experience for implanting thermocouples in various products design, states in this poster his manufacturing background on instrumented elements, plates or targets. (author)

  7. Nuclear instrumentation for radiation measurement

    International Nuclear Information System (INIS)

    Madan, V.K.

    2012-01-01

    Nuclear radiation cannot be detected by human senses. Nuclear detectors and associated electronics facilitate detection and measurement of different types of radiation like alpha particles, beta particles, gamma radiation, and detection of neutrons. Nuclear instrumentation has evolved greatly since the discovery of radioactivity. There has been tremendous advancement in detector technology, electronics, computer technology, and development of efficient algorithms and methods for spectral processing to extract precisely qualitative and quantitative information of the radiation. Various types of detectors and nuclear instruments are presently available and are used for different applications. This paper describes nuclear radiation, its detection and measurement and associated electronics, spectral information extraction, and advances in these fields. The paper also describes challenges in this field

  8. Modernization of ILL instrument electronics

    International Nuclear Information System (INIS)

    Descamps, F.

    1999-01-01

    We have built new general purpose cards for data acquisition taking advantage of recent developments in electronics. At the end of the year, most scheduled instruments at the ILL will be running under UNIX with VME electronics front-end. As the VME electronics of the ILL was designed at the beginning of the eighties, the instrument control section (SCI) at ILL has prepared a renewal plan for two reasons: - first, all the processor cards of the Institute are based on MIZAR processor boards and MIZAR stopped the production of this card last year, as the market was shrinking; - in addition, processors and programmable electronics are now 10 times faster. The electronics services want to take full advantage of these new performances. (author)

  9. Instrumental Landing Using Audio Indication

    Science.gov (United States)

    Burlak, E. A.; Nabatchikov, A. M.; Korsun, O. N.

    2018-02-01

    The paper proposes an audio indication method for presenting to a pilot the information regarding the relative positions of an aircraft in the tasks of precision piloting. The implementation of the method is presented, the use of such parameters of audio signal as loudness, frequency and modulation are discussed. To confirm the operability of the audio indication channel the experiments using modern aircraft simulation facility were carried out. The simulated performed the instrument landing using the proposed audio method to indicate the aircraft deviations in relation to the slide path. The results proved compatible with the simulated instrumental landings using the traditional glidescope pointers. It inspires to develop the method in order to solve other precision piloting tasks.

  10. Nuclear instrumentation for uranium exploration

    International Nuclear Information System (INIS)

    Sarma, Ch. V.N.; Sarma, C.V.R.; Sreehari, R.

    1999-01-01

    Instrumentation required for uranium exploration may be broadly classified based on surface and sub-surface measurement of gamma-ray intensity. Surface measurement of gross and spectral gamma intensity are carried out by employing portable Geiger Mueller/scintillation counters and four-channel spectrometers. Measurement of thoron ( 220 Rn) and radon ( 222 Rn) in the soil gas is being carried out by closed circuit technique using radon measuring system. Radiometric mapping of trenches, pits and mine-faces are carried out using shielded probe with 2π source geometry, whereas logging sonde with instruments through the steel armoured cable are employed for point to 4π geometry. Spectral borehole logging system with built-in multi-channel analyser (MCA) has been developed for the uranium exploration programme for AMD. Note-book PC based high sensitivity air-borne gamma-ray spectrometric survey system has been designed, developed and test flown. (author)

  11. Epithermal neutron instrumentation at ISIS

    International Nuclear Information System (INIS)

    Gorini, G; Festa, G; Andreani, C

    2014-01-01

    The advent of pulsed neutron sources makes available high epithermal neutron fluxes (in the energy range between 500 meV and 100 eV). New dedicated instrumentation, such as Resonance Detectors, was developed at ISIS spallation neutron source in the last years to apply the specific properties of this kind of neutron beam to the study of condensed matter. New detection strategies like Filter Difference method and Foil Cycling Technique were also developed in parallel to the detector improvement at the VESUVIO beamline. Recently, epithermal neutron beams were also used at the INES beamline to study elemental and isotopic composition of materials, with special application to cultural heritage studies. In this paper we review a series of epithermal neutron instrumentation developed at ISIS, their evolution over time and main results obtained

  12. Holy Trinity of Instrumentation Development

    International Nuclear Information System (INIS)

    Ursic, Rok; Solar, Borut

    2004-01-01

    Being user friendly should be the main guidance, beside the self-understood high performance, in today's instrumentation development. Here we identify three components of the user-friendly policy: the all-in-one concept, customization, and connectivity. All-in-one is the concept of unification of various building blocks and thus various functionalities in one product. The customization is enabled by the product's reconfigurability that allows a product to grow and support new requirements and applications without changing hardware. The consequence of the two is the capacity of the single instrument to perform a variety of tasks that before were split among different devices. The last of the three is connectivity that improves the relationship between controls and beam diagnostics, brings out-of-the-crate freedom, and opens unforeseen possibilities for intra-accelerator cooperation and remote technical support

  13. Digital readout alpha survey instrument

    International Nuclear Information System (INIS)

    Jacobs, M.E.

    1976-01-01

    A prototype solid-state digital readout alpha particle survey instrument has been designed and constructed. The meter incorporates a Ludlum alpha scintillator as a detector, digital logic circuits for control and timing, and a Digilin counting module with reflective liquid crystal display. The device is used to monitor alpha radiation from a surface. Sample counts are totalized over 10-second intervals and displayed digitally in counts per minute up to 19,999. Tests over source samples with counts to 15,600 cpm have shown the device to be rapid, versatile and accurate. The instrument can be fabricated in one man-week and requires about $835 in material costs. A complete set of drawings is included

  14. Generational Reproduction of child abuse

    OpenAIRE

    García Ampudia, Lupe; Orellana M., Oswaldo; Pomalaya V., Ricardo; Yanac Reynoso, Elisa; Malaver S., Carmela; Herrera F., Edgar; Sotelo L., Noemi; Campos C., Lilia; Sotelo L., Lidia; Orellana García, Daphne; Velasquez M., Katherine

    2014-01-01

    The objective of this research is the study of the abuse rising in two generations, of parents and children and establishing the relationship between background child’s abuse with the potential abuse. The sample is comprised of 441 students and 303 parents who agreed to answer the Memories of Abuse Questionnaire. The used instruments were the Child History Questionnaire adapted for the purpose of this research, the Inventory of Potential Child Abuse (Milner, J. 1977), adapted by De Paul, Arru...

  15. High resolution tomographic instrument development

    International Nuclear Information System (INIS)

    1992-01-01

    Our recent work has concentrated on the development of high-resolution PET instrumentation reflecting in part the growing importance of PET in nuclear medicine imaging. We have developed a number of positron imaging instruments and have the distinction that every instrument has been placed in operation and has had an extensive history of application for basic research and clinical study. The present program is a logical continuation of these earlier successes. PCR-I, a single ring positron tomograph was the first demonstration of analog coding using BGO. It employed 4 mm detectors and is currently being used for a wide range of biological studies. These are of immense importance in guiding the direction for future instruments. In particular, PCR-II, a volume sensitive positron tomograph with 3 mm spatial resolution has benefited greatly from the studies using PCR-I. PCR-II is currently in the final stages of assembly and testing and will shortly be placed in operation for imaging phantoms, animals and ultimately humans. Perhaps the most important finding resulting from our previous study is that resolution and sensitivity must be carefully balanced to achieve a practical high resolution system. PCR-II has been designed to have the detection characteristics required to achieve 3 mm resolution in human brain under practical imaging situations. The development of algorithms by the group headed by Dr. Chesler is based on a long history of prior study including his joint work with Drs. Pelc and Reiderer and Stearns. This body of expertise will be applied to the processing of data from PCR-II when it becomes operational

  16. Mass Spectrometry Instrumentation in Proteomics

    DEFF Research Database (Denmark)

    Sprenger, Richard Remko; Roepstorff, Peter

    2012-01-01

    Mass spectrometry has evolved into a crucial technology for the field of proteomics, enabling the comprehensive study of proteins in biological systems. Innovative developments have yielded flexible and versatile mass spectrometric tools, including quadrupole time-of-flight, linear ion trap......, Orbitrap and ion mobility instruments. Together they offer various and complementary capabilities in terms of ionization, sensitivity, speed, resolution, mass accuracy, dynamic range and methods of fragmentation. Mass spectrometers can acquire qualitative and quantitative information on a large scale...

  17. Beam diagnostic instruments of TARN

    International Nuclear Information System (INIS)

    Watanabe, Shin-ichi.

    1987-09-01

    The paper summarizes the beam diagnostic instruments of the low energy ion accumulation ring; TARN. With these monitors, position, profiles, bunch structure, intensity, emittance and momentum spread were measured to evaluate the injection and stacking experiments. The monitors provide the sensitivity of a few μA for the nondestructive and a few nA for the destructive monitors. Discussions on monitor probe and electronics are presented on the basis of an achievement of the beam stacking experiments. (author)

  18. Peer Learning in Instrumental Practicing

    Science.gov (United States)

    Nielsen, Siw G.; Johansen, Guro G.; Jørgensen, Harald

    2018-01-01

    In higher music education (HME), the notion of “private teaching, private learning” has a long tradition, where the learning part rests on the student's individual practicing between instrumental lessons. However, recent research suggests that collaborative learning among peers is beneficial in several aspects, such as sense of belonging, motivation and self-efficacy. This is consistent with the concept of vicarious learning. In this study, we conducted a survey among bachelor music students in church music, performance or music education programs enrolled in a music academy (N = 96), where parts of the questionnaire addressed peer learning and peer's influence on the students's instrumental practicing, and the degree of satisfaction with their practicing. These issues were seen in relation to gender, musical genre and study program. Overall, the students reported engaging in peer learning related to their instrumental practicing, to various degrees. This involved discussing practicing matters with peers, and practicing together with peers. However, student's reports of their views on peer learning, show that they perceive it more beneficial than the amount of time reported doing it would indicate. No significant gender differences were found, but students within improvised music/jazz engaged the most in peer learning, and church music students the least. Neither the degree of engaging in peer learning nor reported influence from peers correlated significantly with the degree of satisfaction. We discuss whether a general dissatisfaction is caused by being in a competitive learning environment combined with a privatized culture for learning. Finally, we suggest that collaborative forums for instrumental practicing within HME institutions can function as constructive and supportive arenas to enhance students learning and inner motivation. PMID:29599738

  19. Nuclear instrumentation cable end seal

    International Nuclear Information System (INIS)

    Cannon, C.P.; Brown, D.P.

    1979-01-01

    An improved coaxial end seal for hermetically sealed nuclear instrumentation cable exhibiting an improved breakdown pulse noise characteristic under high voltage, high temperature conditions is described. A tubular insulator body has metallized interior and exterior surface portions which are braze sealed to a center conductor and an outer conductive sheath. The end surface of the insulator body which is directed toward the coaxial cable to which it is sealed has a recessed surface portion within which the braze seal material terminates

  20. Peer Learning in Instrumental Practicing.

    Science.gov (United States)

    Nielsen, Siw G; Johansen, Guro G; Jørgensen, Harald

    2018-01-01

    In higher music education (HME), the notion of "private teaching, private learning" has a long tradition, where the learning part rests on the student's individual practicing between instrumental lessons. However, recent research suggests that collaborative learning among peers is beneficial in several aspects, such as sense of belonging, motivation and self-efficacy. This is consistent with the concept of vicarious learning. In this study, we conducted a survey among bachelor music students in church music, performance or music education programs enrolled in a music academy ( N = 96), where parts of the questionnaire addressed peer learning and peer's influence on the students's instrumental practicing, and the degree of satisfaction with their practicing. These issues were seen in relation to gender, musical genre and study program. Overall, the students reported engaging in peer learning related to their instrumental practicing, to various degrees. This involved discussing practicing matters with peers, and practicing together with peers. However, student's reports of their views on peer learning, show that they perceive it more beneficial than the amount of time reported doing it would indicate. No significant gender differences were found, but students within improvised music/jazz engaged the most in peer learning, and church music students the least. Neither the degree of engaging in peer learning nor reported influence from peers correlated significantly with the degree of satisfaction. We discuss whether a general dissatisfaction is caused by being in a competitive learning environment combined with a privatized culture for learning. Finally, we suggest that collaborative forums for instrumental practicing within HME institutions can function as constructive and supportive arenas to enhance students learning and inner motivation.

  1. Virtual Instrumentation in Biomedical Equipment

    Directory of Open Access Journals (Sweden)

    Tiago Faustino Andrade

    2013-01-01

    Full Text Available Nowadays, the assessment of body composition by estimating the percentage of body fat has a great impact in many fields such as nutrition, health, sports, chronic diseases and others. The main purpose for this work is the development of a virtual instrument that permits more effective assessment of body fat, automatic data processing, recording results and storage in a database, with high potential to conduct new studies, http://lipotool.com.

  2. SMAP Instrument Mechanical System Engineering

    Science.gov (United States)

    Slimko, Eric; French, Richard; Riggs, Benjamin

    2013-01-01

    The Soil Moisture Active Passive (SMAP) mission, scheduled for launch by the end of 2014, is being developed to measure the soil moisture and soil freeze/thaw state on a global scale over a three-year period. The accuracy, resolution, and global coverage of SMAP measurements are invaluable across many science and applications disciplines including hydrology, climate, carbon cycle, and the meteorological, environment, and ecology applications communities. The SMAP observatory is composed of a despun bus and a spinning instrument platform that includes both a deployable 6 meter aperture low structural frequency Astromesh reflector and a spin control system. The instrument section has engendered challenging mechanical system issues associated with the antenna deployment, flexible antenna pointing in the context of a multitude of disturbances, spun section mass properties, spin control system development, and overall integration with the flight system on both mechanical and control system levels. Moreover, the multitude of organizations involved, including two major vendors providing the spin subsystem and reflector boom assembly plus the flight system mechanical and guidance, navigation, and control teams, has led to several unique system engineering challenges. Capturing the key physics associated with the function of the flight system has been challenging due to the many different domains that are applicable. Key interfaces and operational concepts have led to complex negotiations because of the large number of organizations that integrate with the instrument mechanical system. Additionally, the verification and validation concerns associated with the mechanical system have had required far-reaching involvement from both the flight system and other subsystems. The SMAP instrument mechanical systems engineering issues and their solutions are described in this paper.

  3. Soil analysis. Modern instrumental technique

    International Nuclear Information System (INIS)

    Smith, K.A.

    1993-01-01

    This book covers traditional methods of analysis and specialist monographs on individual instrumental techniques, which are usually not written with soil or plant analysis specifically in mind. The principles of the techniques are combined with discussions of sample preparation and matrix problems, and critical reviews of applications in soil science and related disciplines. Individual chapters are processed separately for inclusion in the appropriate data bases

  4. Peer Learning in Instrumental Practicing

    Directory of Open Access Journals (Sweden)

    Siw G. Nielsen

    2018-03-01

    Full Text Available In higher music education (HME, the notion of “private teaching, private learning” has a long tradition, where the learning part rests on the student's individual practicing between instrumental lessons. However, recent research suggests that collaborative learning among peers is beneficial in several aspects, such as sense of belonging, motivation and self-efficacy. This is consistent with the concept of vicarious learning. In this study, we conducted a survey among bachelor music students in church music, performance or music education programs enrolled in a music academy (N = 96, where parts of the questionnaire addressed peer learning and peer's influence on the students's instrumental practicing, and the degree of satisfaction with their practicing. These issues were seen in relation to gender, musical genre and study program. Overall, the students reported engaging in peer learning related to their instrumental practicing, to various degrees. This involved discussing practicing matters with peers, and practicing together with peers. However, student's reports of their views on peer learning, show that they perceive it more beneficial than the amount of time reported doing it would indicate. No significant gender differences were found, but students within improvised music/jazz engaged the most in peer learning, and church music students the least. Neither the degree of engaging in peer learning nor reported influence from peers correlated significantly with the degree of satisfaction. We discuss whether a general dissatisfaction is caused by being in a competitive learning environment combined with a privatized culture for learning. Finally, we suggest that collaborative forums for instrumental practicing within HME institutions can function as constructive and supportive arenas to enhance students learning and inner motivation.

  5. High resolution tomographic instrument development

    Energy Technology Data Exchange (ETDEWEB)

    1992-08-01

    Our recent work has concentrated on the development of high-resolution PET instrumentation reflecting in part the growing importance of PET in nuclear medicine imaging. We have developed a number of positron imaging instruments and have the distinction that every instrument has been placed in operation and has had an extensive history of application for basic research and clinical study. The present program is a logical continuation of these earlier successes. PCR-I, a single ring positron tomograph was the first demonstration of analog coding using BGO. It employed 4 mm detectors and is currently being used for a wide range of biological studies. These are of immense importance in guiding the direction for future instruments. In particular, PCR-II, a volume sensitive positron tomograph with 3 mm spatial resolution has benefited greatly from the studies using PCR-I. PCR-II is currently in the final stages of assembly and testing and will shortly be placed in operation for imaging phantoms, animals and ultimately humans. Perhaps the most important finding resulting from our previous study is that resolution and sensitivity must be carefully balanced to achieve a practical high resolution system. PCR-II has been designed to have the detection characteristics required to achieve 3 mm resolution in human brain under practical imaging situations. The development of algorithms by the group headed by Dr. Chesler is based on a long history of prior study including his joint work with Drs. Pelc and Reiderer and Stearns. This body of expertise will be applied to the processing of data from PCR-II when it becomes operational.

  6. High resolution tomographic instrument development

    Energy Technology Data Exchange (ETDEWEB)

    1992-01-01

    Our recent work has concentrated on the development of high-resolution PET instrumentation reflecting in part the growing importance of PET in nuclear medicine imaging. We have developed a number of positron imaging instruments and have the distinction that every instrument has been placed in operation and has had an extensive history of application for basic research and clinical study. The present program is a logical continuation of these earlier successes. PCR-I, a single ring positron tomograph was the first demonstration of analog coding using BGO. It employed 4 mm detectors and is currently being used for a wide range of biological studies. These are of immense importance in guiding the direction for future instruments. In particular, PCR-II, a volume sensitive positron tomograph with 3 mm spatial resolution has benefited greatly from the studies using PCR-I. PCR-II is currently in the final stages of assembly and testing and will shortly be placed in operation for imaging phantoms, animals and ultimately humans. Perhaps the most important finding resulting from our previous study is that resolution and sensitivity must be carefully balanced to achieve a practical high resolution system. PCR-II has been designed to have the detection characteristics required to achieve 3 mm resolution in human brain under practical imaging situations. The development of algorithms by the group headed by Dr. Chesler is based on a long history of prior study including his joint work with Drs. Pelc and Reiderer and Stearns. This body of expertise will be applied to the processing of data from PCR-II when it becomes operational.

  7. Thermoelectric generator

    International Nuclear Information System (INIS)

    Purdy, D.L.

    1978-01-01

    The main components of a thermoelectric generator are housed in an evacuated cylindrical vessel. In the middle of it there is the radioactive heat source, e.g. 90 Sr or 238 Pu, enclosed by a gamma radiation shield. This one is surrounded by a heat-insulating screen from getter material or indicidual sheets of titanium. In the bottom of the screen there are arranged several thermocouples on a circle. The thermocouples themselves are contained within casings sealed gas-tight and filled with an inert gas, e.g. argon. By separating the internal space of the generator vessel from the thermocouple casings, made of e.g. n- respectively p-doped lead telluride cylinders, for both the optimal gas state may be obtained. (DG) [de

  8. TECHNICAL TRAINING SEMINAR: National Instruments

    CERN Multimedia

    Monique Duval

    2004-01-01

    From 9:30 to 12:00 and from 13:00 to 16:00 hrs - Council Chamber, Salle B, Salle des Pas Perdus National Instruments (NI) on Tour 2004 Claudia Jüngel, Evrem Yarkin, Joel Clerc, Hervé Baour / NATIONAL INSTRUMENTS The special event NI on Tour 2004, run in Germany, Austria and Switzerland, will be at CERN on March 30. Technical seminars and free introductory courses will be offered all day long in the Council Chamber, Salle B, and Salle des Pas Perdus (buildings 61 and 503). Data acquisition systems on PCs, industrial measurement and control techniques, advanced LabVIEW software and PXI instrumentation, and system components for tests and automation will be presented. Walk-in courses will address DIAdem, LabVIEW and data acquisition. Language: English and French Free seminars and courses, no registration Organisers: Rolf Stampfli / IT-CO / 78102 & 160367 / Rolf.Stampfli@cern.ch Davide Vitè / HR-PMD-ATT / 75141 Davide.Vite@cern.ch For more information and the complete event programme, please visit the...

  9. Geotechnical instrumentation for repository shafts

    International Nuclear Information System (INIS)

    Lentell, R.L.; Byrne, J.

    1993-01-01

    The US Congress passed the Nuclear Waste Policy Act in 1980, which required that three distinctly different geologic media be investigated as potential candidate sites for the permanent disposal of high-level nuclear waste. The three media that were selected for study were basalt (WA), salt (TX, LA, MS, UT), and tuff (NV). Preliminary Exploratory Shaft Facilities (ESF) designs were prepared for seven candidate salt sites, including bedded and domal salt environments. A bedded-salt site was selected in Deaf Smith County, TX for detailed site characterization studies and ESF Final Design. Although Congress terminated the Salt Repository Program in 1988, Final Design for the Deaf Smith ESF was completed, and much of the design rationale can be applied to subsequent deep repository shafts. This paper presents the rationale for the geotechnical instrumentation that was designed for construction and operational performance monitoring of the deep shafts of the in-situ test facility. The instrumentation design described herein can be used as a general framework in designing subsequent instrumentation programs for future high-level nuclear waste repository shafts

  10. Measuring instruments of corporate reputation

    Directory of Open Access Journals (Sweden)

    Damir Grgić

    2008-12-01

    Full Text Available The subject of this paper is focused on the instruments for the measurement of corporate reputation. Recent research of the elements which influence the success of a company shows a growing interest in intangible values. Corporate reputation itself has been identified as one of the key intangible assets which create the company’s added value. Understanding of the importance of corporate reputation has been determined as a significant component of the company’s competitiveness, that is, of its competitive edge. Reputation is a normal part of our life and an integral part of our society. Our interest in the honesty and integrity of others is firmly established in all cultures and nowadays the focus of this interest is switching increasingly on companies. Corporate reputation can be acquired by means of strong, well-developed strategies, which are crucial for the opinion of stakeholders regarding future stability and competitive sustainability of the company. On the other hand, it should be emphasized that in order to manage it, corporate reputation has to be measured first. However, although the concept of corporate reputation is universally accepted and its significance has been recognized especially in the last two decades, the process of its measurement is still at an early stage and there is no universally accepted instrument for its measurement. Therefore, the author of this paper gives an overview of the instruments used for the measurement of corporate reputation which have gained a foothold through former practical usage.

  11. Cluster generator

    Science.gov (United States)

    Donchev, Todor I [Urbana, IL; Petrov, Ivan G [Champaign, IL

    2011-05-31

    Described herein is an apparatus and a method for producing atom clusters based on a gas discharge within a hollow cathode. The hollow cathode includes one or more walls. The one or more walls define a sputtering chamber within the hollow cathode and include a material to be sputtered. A hollow anode is positioned at an end of the sputtering chamber, and atom clusters are formed when a gas discharge is generated between the hollow anode and the hollow cathode.

  12. Photon generator

    Science.gov (United States)

    Srinivasan-Rao, Triveni

    2002-01-01

    A photon generator includes an electron gun for emitting an electron beam, a laser for emitting a laser beam, and an interaction ring wherein the laser beam repetitively collides with the electron beam for emitting a high energy photon beam therefrom in the exemplary form of x-rays. The interaction ring is a closed loop, sized and configured for circulating the electron beam with a period substantially equal to the period of the laser beam pulses for effecting repetitive collisions.

  13. Software quality assurance plan for void fraction instrument

    International Nuclear Information System (INIS)

    Gimera, M.

    1994-01-01

    Waste Tank SY-101 has been the focus of extensive characterization work over the past few years. The waste continually generates gases, most notably hydrogen, which are periodically released from the waste. Gas can be trapped in tank waste in three forms: as void gas (bubbles), dissolved gas, or absorbed gas. Void fraction is the volume percentage of a given sample that is comprised of void gas. The void fraction instrument (VFI) acquires the data necessary to calculate void fraction. This document covers the product, Void Fraction Data Acquisition Software. The void fraction software being developed will have the ability to control the void fraction instrument hardware and acquire data necessary to calculate the void fraction in samples. This document provides the software quality assurance plan, verification and validation plan, and configuration management plan for developing the software for the instrumentation that will be used to obtain void fraction data from Tank SY-101

  14. Instrumental analytical techniques in geochemistry: Requirements and applications

    International Nuclear Information System (INIS)

    Willis, J.P.

    1986-01-01

    Geochemists must analyse an extremely wide range of terrestrial and planetary materials. The instrumental techniques necessary to cope with this difficult task are considered. The most important analytical techniques in use by the geochemist today are AAS, ICP-OES, INAA, MSID and XRFS, and the electron microscope for in situ mineral analysis. Some applications of these techniques to solving major problems in geochemistry are discussed. The importance of certified reference materials and of high quality geochemical data are emphasized. It is concluded that the general quality of trace element data has improved over the past 25 years, as a direct result of the application of modern instrumental techniques. Surprisingly, the quality of data reported for certain major elements has deteriorated over that time, when compared with data obtainable by classical chemical methods. Predictions are made concerning the instrumentation needs of the next generation of geochemists. (orig.) [de

  15. RELEVANCE OF ECONOMIC INSTRUMENTS USED IN SUSTAINABLE DEVELOPMENT PROCESS

    Directory of Open Access Journals (Sweden)

    SORINA-GEANINA MĂRGĂRIT (STĂNESCU

    2011-01-01

    Full Text Available The interaction between environmental, economic and social factors influences the ecological balance and generates the change of living conditions and those of socio-economic development. One of the essential conditions for building a sustainable economic development is the identification and implementation of active or voluntary instruments to influence economic and social activity towards ensuring their sustainability. In this paper, we intend to introduce the tools used in the process of sustainable development, which have a key role in adopting an environmentally responsible behavior. The results of this study are represented by the drafting of the advantages and disadvantages of using these economic and financial instruments. The purpose of this paper is to present the evolution of costs for environmental protection and the relevance of instruments used at the national level in environmental protection.

  16. Gas Detection Instrument Based on Wireless Sensor Networks

    Directory of Open Access Journals (Sweden)

    ANSONG FENG

    2013-06-01

    Full Text Available The wireless sensor network is used to simulate poisonous gas generating system in the Fire-Fighting Simulated Training System. In the paper, we use the wireless signal to simulate the poisonous gas source and use received signal strength indicator (RSSI to simulate the distance between the fireman and the gas source. The gas detection instrument samples the temperature and sphygmus of the trainee and uses the wireless signal as poisonous gas signal. When the trainee enters into the poisonous gas area, the gas detection instrument warns with sound and light and sends the type, density value, the location of the poisonous gas and vital signs of the trainee to host. The paper discusses the software and hardware design of the gas detection instrument. The system has been used to the several of Fire-Fighting training systems.

  17. Robotic thin layer chromatography instrument for synthetic chemistry

    International Nuclear Information System (INIS)

    Corkan, L.A.; Lindsey, J.S.

    1990-01-01

    One of our long-term goals is to develop robotic workstations for automated synthetic chemistry. Toward that goal we have constructed a 2nd generation instrument for performing TLC analysis. TLC has important advantages (over HPLC and GC) in analysis of crude reaction samples and parallel sample development. The TLC instrument consist of four dedicated stations for (1) plate dispensing, (2) sample application, (3) plate development, and (4) plate densitometry. A robot is used to move plates among stations. The combination of fixed automation and robotics gives high sample throughout (up to 10 samples per hour). A second robot performs reaction chemistry and feeds samples to the TLC instrument, thus enabling TLC analysis at the same time as synthetic reactions proceed on the workstation

  18. Development of multifunctional radiation monitoring instrument based on PLC technology

    International Nuclear Information System (INIS)

    Li Ziqiang; Zhu Yuye; Zhuang Min

    2007-01-01

    This eight-channel multifunctional Radiation Monitoring Instrument is developed by making use of the built-in high-speed counters and the powerful instruction system of the SIEMES SIMATICS S7 series Programmable Logic Controllers (PLC) to record and process the pulse signal output by the detectors. The instrument with functions, such as analog and digital display, digital storage of digital data, pulse signal generator, network communication, can connect various types of pulse detectors. The initial process can be translated between Graduation Apparatus method and Formula method. the logicality of the high-dosage warning system is processed itself. The signal output will drive the alarm lights and bell directly. This paper mainly describes the configuration, programming and feature of the instrument. (authors)

  19. Next-Generation Thermal Infrared Multi-Body Radiometer Experiment (TIMBRE)

    Science.gov (United States)

    Kenyon, M.; Mariani, G.; Johnson, B.; Brageot, E.; Hayne, P.

    2016-10-01

    We have developed an instrument concept called TIMBRE which belongs to the important class of instruments called thermal imaging radiometers (TIRs). TIMBRE is the next-generation TIR with unparalleled performance compared to the state-of-the-art.

  20. Computer utility for interactive instrument control

    International Nuclear Information System (INIS)

    Day, P.

    1975-08-01

    A careful study of the ANL laboratory automation needs in 1967 led to the conclusion that a central computer could support all of the real-time needs of a diverse collection of research instruments. A suitable hardware configuration would require an operating system to provide effective protection, fast real-time response and efficient data transfer. An SDS Sigma 5 satisfied all hardware criteria, however it was necessary to write an original operating system; services include program generation, experiment control real-time analysis, interactive graphics and final analysis. The system is providing real-time support for 21 concurrently running experiments, including an automated neutron diffractometer, a pulsed NMR spectrometer and multi-particle detection systems. It guarantees the protection of each user's interests and dynamically assigns core memory, disk space and 9-track magnetic tape usage. Multiplexor hardware capability allows the transfer of data between a user's device and assigned core area at rates of 100,000 bytes/sec. Real-time histogram generation for a user can proceed at rates of 50,000 points/sec. The facility has been self-running (no computer operator) for five years with a mean time between failures of 10 []ays and an uptime of 157 hours/week. (auth)