WorldWideScience

Sample records for generation vhe instruments

  1. Search for VHE gamma-ray emission from Geminga pulsar and nebula with the MAGIC telescopes

    Science.gov (United States)

    Ahnen, M. L.; Ansoldi, S.; Antonelli, L. A.; Antoranz, P.; Babic, A.; Banerjee, B.; Bangale, P.; Barres de Almeida, U.; Barrio, J. A.; Becerra González, J.; Bednarek, W.; Bernardini, E.; Berti, A.; Biasuzzi, B.; Biland, A.; Blanch, O.; Bonnefoy, S.; Bonnoli, G.; Borracci, F.; Bretz, T.; Buson, S.; Carosi, A.; Chatterjee, A.; Clavero, R.; Colin, P.; Colombo, E.; Contreras, J. L.; Cortina, J.; Covino, S.; Da Vela, P.; Dazzi, F.; De Angelis, A.; De Lotto, B.; de Oña Wilhelmi, E.; Di Pierro, F.; Doert, M.; Domínguez, A.; Dominis Prester, D.; Dorner, D.; Doro, M.; Einecke, S.; Eisenacher Glawion, D.; Elsaesser, D.; Fallah Ramazani, V.; Fernández-Barral, A.; Fidalgo, D.; Fonseca, M. V.; Font, L.; Frantzen, K.; Fruck, C.; Galindo, D.; García López, R. J.; Garczarczyk, M.; Garrido Terrats, D.; Gaug, M.; Giammaria, P.; Godinović, N.; González Muñoz, A.; Gora, D.; Guberman, D.; Hadasch, D.; Hahn, A.; Hanabata, Y.; Hayashida, M.; Herrera, J.; Hose, J.; Hrupec, D.; Hughes, G.; Idec, W.; Kodani, K.; Konno, Y.; Kubo, H.; Kushida, J.; La Barbera, A.; Lelas, D.; Lindfors, E.; Lombardi, S.; Longo, F.; López, M.; López-Coto, R.; Majumdar, P.; Makariev, M.; Mallot, K.; Maneva, G.; Manganaro, M.; Mannheim, K.; Maraschi, L.; Marcote, B.; Mariotti, M.; Martínez, M.; Mazin, D.; Menzel, U.; Miranda, J. M.; Mirzoyan, R.; Moralejo, A.; Moretti, E.; Nakajima, D.; Neustroev, V.; Niedzwiecki, A.; Nievas Rosillo, M.; Nilsson, K.; Nishijima, K.; Noda, K.; Nogués, L.; Overkemping, A.; Paiano, S.; Palacio, J.; Palatiello, M.; Paneque, D.; Paoletti, R.; Paredes, J. M.; Paredes-Fortuny, X.; Pedaletti, G.; Peresano, M.; Perri, L.; Persic, M.; Poutanen, J.; Prada Moroni, P. G.; Prandini, E.; Puljak, I.; Reichardt, I.; Rhode, W.; Ribó, M.; Rico, J.; Rodriguez Garcia, J.; Saito, T.; Satalecka, K.; Schultz, C.; Schweizer, T.; Shore, S. N.; Sillanpää, A.; Sitarek, J.; Snidaric, I.; Sobczynska, D.; Stamerra, A.; Steinbring, T.; Strzys, M.; Surić, T.; Takalo, L.; Tavecchio, F.; Temnikov, P.; Terzić, T.; Tescaro, D.; Teshima, M.; Thaele, J.; Torres, D. F.; Toyama, T.; Treves, A.; Vanzo, G.; Verguilov, V.; Vovk, I.; Ward, J. E.; Will, M.; Wu, M. H.; Zanin, R.

    2016-06-01

    The Geminga pulsar, one of the brighest gamma-ray sources, is a promising candidate for emission of very-high-energy (VHE > 100 GeV) pulsed gamma rays. Also, detection of a large nebula has been claimed by water Cherenkov instruments. We performed deep observations of Geminga with the MAGIC telescopes, yielding 63 h of good-quality data, and searched for emission from the pulsar and pulsar wind nebula. We did not find any significant detection, and derived 95% confidence level upper limits. The resulting upper limits of 5.3 × 10-13 TeV cm-2 s-1 for the Geminga pulsar and 3.5 × 10-12 TeV cm-2 s-1 for the surrounding nebula at 50 GeV are the mostconstraining ones obtained so far at VHE. To complement the VHE observations, we also analyzed 5 yr of Fermi-LAT data from Geminga, finding that the sub-exponential cut-off is preferred over the exponential cut-off that has been typically used in the literature. We also find that, above 10 GeV, the gamma-ray spectra from Geminga can be described with a power law with index softer than 5. The extrapolation of the power-law Fermi-LAT pulsed spectra to VHE goes well below the MAGIC upper limits, indicating that the detection of pulsed emission from Geminga with the current generation of Cherenkov telescopes is very difficult.

  2. Dicty_cDB: VHE820 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available iol.tsukuba.ac.jp/CSM/VH/VHE8-A/VHE820Q.Seq.d/ Representative seq. ID - (Link to Original site) Representa...tive DNA sequence >VHE820 (VHE820Q) /CSM/VH/VHE8-A/VHE820Q.Seq.d/ XXXXXXXXXXAATCGGA

  3. Dicty_cDB: VHE860 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHE860 (Link to dictyBase) - G00529 DDB0191090 Contig-U12398-1 | Contig-U13609-1 VHE860...P (Link to Original site) VHE860F 629 VHE860Z 555 VHE860P 1164 - - Show VHE860 Libr...ary VH (Link to library) Clone ID VHE860 (Link to dictyBase) Atlas ID - NBRP ID G00529 dictyBase ID DDB01910...ycdb.biol.tsukuba.ac.jp/CSM/VH/VHE8-C/VHE860Q.Seq.d/ Representative seq. ID VHE860P (Link to Original site) ...Representative DNA sequence >VHE860 (VHE860Q) /CSM/VH/VHE8-C/VHE860Q.Seq.d/ AATGAAATCACAAAAAATAGGATCAATGATTC

  4. The 2010 M 87 VHE flare and its origin: the multi-wavelength picture

    CERN Document Server

    Raue, M; Mazin, D; Colin, P; Hui, C M; Beilicke, M; McConville, M; Giroletti, M; Harris, D E; Steele, I A; Walker, R C

    2011-01-01

    The giant radio galaxy M 87, with its proximity (16 Mpc) and its very massive black hole ((3 - 6) \\times 10^9 M_solar), provides a unique laboratory to investigate very high energy (E>100 GeV; VHE) gamma-ray emission from active galactic nuclei and, thereby, probe particle acceleration to relativistic energies near supermassive black holes (SMBH) and in relativistic jets. M 87 has been established as a VHE gamma-ray emitter since 2005. The VHE gamma-ray emission displays strong variability on timescales as short as a day. In 2008, a rise in the 43 GHz Very Long Baseline Array (VLBA) radio emission of the innermost region (core; extension of < 100 Rs ; Schwarzschild radii) was found to coincide with a flaring activity at VHE. This had been interpreted as a strong indication that the VHE emission is produced in the direct vicinity of the SMBH. In 2010 a flare at VHE was again detected triggering further multi-wavelength (MWL) observations with the VLBA, Chandra, and other instruments. At the same time, M 87 ...

  5. Latest MAGIC discoveries pushing redshift boundaries in VHE Astrophysics

    CERN Document Server

    Manganaro, M; Nievas, M; Sitarek, J; Tavecchio, F; Buson, S; Prester, D Dominis; Domínguez, A; Lindfors, E; Mazin, D; Moralejo, A; Stamerra, A

    2016-01-01

    The search for detection of gamma-rays from distant AGNs by Imaging Atmospheric Cherenkov Telescopes (IACTs) is challenging at high redshifts, not only because of lower flux due to the distance of the source, but also due to the consequent absorption of gamma-rays by the extragalactic background light (EBL). Before the MAGIC discoveries reported in this work, the farthest source ever detected in the VHE domain was the blazar PKS 1424+240, at z>0.6. MAGIC, a system of two 17 m of diameter IACTs located in the Canary island of La Palma, has been able to go beyond that limit and push the boundaries for VHE detection to redshifts z~ 1. The two sources detected and analyzed, the blazar QSO B0218+357 and the FSRQ PKS 1441+25 are located at redshift z=0.944 and z=0.939 respectively. QSO B0218+357 is also the first gravitational lensed blazar ever detected in VHE. The activity, triggered by Fermi-LAT in high energy gamma-rays, was followed up by other instruments, such as the KVA telescope in the optical band and the...

  6. Developing instrumentation to characterize thermoelectric generator modules

    Science.gov (United States)

    Liu, Dawei; Li, Qiming; Peng, Wenbo; Zhu, Lianjun; Gao, Hu; Meng, Qingsen; Jin, A. J.

    2015-03-01

    Based on the law of physics, known as "Seebeck effect," a thermoelectric generator (TEG) produces electricity when the temperature differential is applied across the TEG. This article reports a precision method in characterizing TEG modules. A precision instrument is constructed to study thermoelectric conversion in terms of output power and efficiency of TEG modules. The maximum allowable TEG module size is 150 mm, and the preferred size is from 30 mm to 60 mm. During measurements, the highest hot side temperature is 500 °C and the cold side temperature can be adjusted from room temperature to 100 °C. A mechanical structure is developed to control the pressure and parallelism of the clamping force of the TEG on both its hot and cold sides. A heat flux measurement module is installed at its cold side, and the heat flux through TEGs can be measured in position. Finally, the energy conversion efficiency of TEGs is calculated from experimental data of both an output power and a heat flux.

  7. Microcomputers: Instrument Generation Software. Evaluation Guides. Guide Number 11.

    Science.gov (United States)

    Gray, Peter J.

    Designed to assist evaluators in selecting the appropriate software for the generation of various data collection instruments, this guide discusses such key program characteristics as text entry, item storage and manipulation, item retrieval, and printing. Some characteristics of a good instrument generation program are discussed; these include…

  8. A search for VHE counterparts of galactic Fermi sources

    CERN Document Server

    Tam, P H Thomas; Tibolla, Omar; Chaves, Ryan

    2010-01-01

    Very high-energy (VHE; E > 100 GeV) gamma-rays have been detected from a wide range of astronomical objects, such as SNRs, pulsars and pulsar wind nebulae, AGN, gamma-ray binaries, molecular clouds, and possibly star-forming regions as well. At lower energies, sources detected using Large Area Telescope (LAT) aboard Fermi provide a rich set of data which can be used to study the behavior of cosmic accelerators in the GeV to TeV energy bands. In particular, the improved angular resolution in both bands compared to previous instruments significantly reduces source confusion and facilitates the identification of associated counterparts at lower energies. In this talk, a comprehensive search for VHE gamma-ray sources which are spatially coincident with Galactic Fermi/LAT bright sources is performed, and the GeV to TeV spectra of selected coincident sources are shown. It is found that LAT bright GeV sources are correlated to TeV sources, in contrast with previous studies using EGRET data.

  9. The effects of nuclear power generators upon electronic instrumentation

    Science.gov (United States)

    Miller, C. G.; Truscello, V. C.

    1970-01-01

    Radiation sensitivity of electronic instruments susceptible to neutron and gamma radiation is evaluated by means of a radioisotope thermoelectric generator /RTG/. The gamma field of the RTG affects instrument operation and requires shielding, the neutron field does not affect operation via secondary capture-gamma production.

  10. VLT/VLTI Second-Generation Instrumentation: Lessons Learned

    Science.gov (United States)

    Gilmozzi, R.; Pasquini, L.; Russell, A.

    2016-12-01

    The five second-generation instruments already delivered for the Very Large Telescope (VLT) represent worthy successors to the first generation of instrumentation development. Despite this success, it is still possible to learn many lessons for the future. A review, preceded by a workshop, on the lessons learned from the second-generation instrumentation for the VLT and VLT Interferometer took place in November 2015, following a previous review twelve years ago on lessons learned from the first-generation instruments. The aim of the workshop was to identify lessons in order to help define/refine good practice and make recommendations for the future. This article briefly reports on the workshop and summarises the findings of the review panel, their recommendations and some of the steps to implement them.

  11. The Second Generation High Speed Rotor Head Mounted Instrumentation System

    Science.gov (United States)

    Lewis, John; Reynolds, R. S. (Technical Monitor)

    1997-01-01

    NASA Ames Research Center has been investigating the air pressure flow of a rotor blade on a UH-60 Black Hawk helicopter in-flight. This paper will address the changes and improvements due to additional restrictions and requirements for the instrumentation system. The second generation instrumentation system was substantially larger and this allowed greatly improved accessibility to the components for ease of maintenance as well as improved gain and offset adjustment capabilities and better filtering.

  12. First broadband characterization and redshift determination of the VHE blazar MAGIC J2001+439

    CERN Document Server

    Aleksić, J; Antonelli, L A; Antoranz, P; Babic, A; Bangale, P; de Almeida, U Barres; Barrio, J A; González, J Becerra; Bednarek, W; Bernardini, E; Biland, A; Blanch, O; Bonnefoy, S; Bonnoli, G; Borracci, F; Bretz, T; Carmona, E; Carosi, A; Fidalgo, D Carreto; Colin, P; Colombo, E; Contreras, J L; Cortina, J; Covino, S; Da Vela, P; Dazzi, F; De Angelis, A; De Caneva, G; De Lotto, B; Mendez, C Delgado; Doert, M; Domínguez, A; Prester, D Dominis; Dorner, D; Doro, M; Einecke, S; Eisenacher, D; Elsaesser, D; Farina, E; Ferenc, D; Fonseca, M V; Font, L; Frantzen, K; Fruck, C; López, R J García; Garczarczyk, M; Terrats, D Garrido; Gaug, M; Godinović, N; Muñoz, A González; Gozzini, S R; Hadasch, D; Hayashida, M; Herrera, J; Herrero, A; Hildebrand, D; Hose, J; Hrupec, D; Idec, W; Kadenius, V; Kellermann, H; Kodani, K; Konno, Y; Krause, J; Kubo, H; Kushida, J; La Barbera, A; Lelas, D; Lewandowska, N; Lindfors, E; Lombardi, S; López, M; López-Coto, R; López-Oramas, A; Lorenz, E; Lozano, I; Makariev, M; Mallot, K; Maneva, G; Mankuzhiyil, N; Mannheim, K; Maraschi, L; Marcote, B; Mariotti, M; Martínez, M; Mazin, D; Menzel, U; Meucci, M; Miranda, J M; Mirzoyan, R; Moralejo, A; Munar-Adrover, P; Nakajima, D; Niedzwiecki, A; Nilsson, K; Nishijima, K; Noda, K; Nowak, N; Orito, R; Overkemping, A; Paiano, S; Palatiello, M; Paneque, D; Paoletti, R; Paredes, J M; Paredes-Fortuny, X; Partini, S; Persic, M; Prada, F; Moroni, P G Prada; Prandini, E; Preziuso, S; Puljak, I; Reinthal, R; Rhode, W; Ribó, M; Rico, J; Garcia, J Rodriguez; Rügamer, S; Saggion, A; Saito, T; Saito, K; Satalecka, K; Scalzotto, V; Scapin, V; Schultz, C; Schweizer, T; Shore, S N; Sillanpää, A; Sitarek, J; Snidaric, I; Sobczynska, D; Spanier, F; Stamatescu, V; Stamerra, A; Steinbring, T; Storz, J; Strzys, M; Sun, S; Surić, T; Takalo, L; Takami, H; Tavecchio, F; Temnikov, P; Terzić, T; Tescaro, D; Teshima, M; Thaele, J; Tibolla, O; Torres, D F; Toyama, T; Treves, A; Uellenbeck, M; Vogler, P; Wagner, R M; Zandanel, F; Zanin, R; D'Ammando, F; Hovatta, T; Larionov, V M; Max-Moerbeck, W; Perri, M; Readhead, A C S; Richards, J L; Sakamoto, T; Schwartz, R D; Verrecchia, F; Reyes, L C

    2014-01-01

    We aim to characterize the broadband emission from 2FGL J2001.1+4352, which has been associated with the unknown-redshift blazar MG4 J200112+4352. Based on its gamma-ray spectral properties, it was identified as a potential very high energy (VHE; E > 100 GeV) gamma-ray emitter. The source was observed with MAGIC first in 2009 and later in 2010 within a multi-instrument observation campaign. The MAGIC observations yielded 14.8 hours of good quality stereoscopic data. The object was monitored at radio, optical and gamma-ray energies during the years 2010 and 2011. The source, named MAGIC J2001+439, is detected for the first time at VHE with MAGIC at a statistical significance of 6.3 {\\sigma} (E > 70 GeV) during a 1.3-hour long observation on 2010 July 16. The multi-instrument observations show variability in all energy bands with the highest amplitude of variability in the X-ray and VHE bands. We also organized deep imaging optical observations with the Nordic Optical Telescope in 2013 to determine the source r...

  13. Testing for the Best Instrument to Generate Sustainable Food Consumption

    Directory of Open Access Journals (Sweden)

    Luca Panzone

    2011-12-01

    Full Text Available  The increase in the level of greenhouse gas (GHG emissions in the atmosphere in the last centuries, and the subsequent increase in temperature, has been a widely studied area in the last few decades. Climate change has become a key item on the political agenda due to concerns regarding the sustainability of current human consumption for future generations. Consumption of food and agricultural goods constitutes an important part of household based GHG emissions, and the relatively low costs associated with environmental improvements make it an interesting area of study to understand behavioural changes. Despite general agreement on the need to curb the amount of GHG emissions worldwide, little evidence exists regarding the best instruments policymakers can employ to stimulate changes toward more sustainable consumption. The present work explores which instruments are most effective in fostering change to more environmentally friendly food consumption. The instruments tested are CO2 labelling, GHG abatement subsidy and product-specific bans. We used a simulated online shopping trip in supermarkets in the Greater London area in the United Kingdom, where respondents shopped in four product categories: cola, milk, meat (chicken and beef, and butter/margarine. Consumer preferences reveal that, in the presence of these instruments, quantity instruments performed better than price incentives and labelling.

  14. A novel instrument for generating angular increments of 1 nanoradian

    Science.gov (United States)

    Alcock, Simon G.; Bugnar, Alex; Nistea, Ioana; Sawhney, Kawal; Scott, Stewart; Hillman, Michael; Grindrod, Jamie; Johnson, Iain

    2015-12-01

    Accurate generation of small angles is of vital importance for calibrating angle-based metrology instruments used in a broad spectrum of industries including mechatronics, nano-positioning, and optic fabrication. We present a novel, piezo-driven, flexure device capable of reliably generating micro- and nanoradian angles. Unlike many such instruments, Diamond Light Source's nano-angle generator (Diamond-NANGO) does not rely on two separate actuators or rotation stages to provide coarse and fine motion. Instead, a single Physik Instrumente NEXLINE "PiezoWalk" actuator provides millimetres of travel with nanometre resolution. A cartwheel flexure efficiently converts displacement from the linear actuator into rotary motion with minimal parasitic errors. Rotation of the flexure is directly measured via a Magnescale "Laserscale" angle encoder. Closed-loop operation of the PiezoWalk actuator, using high-speed feedback from the angle encoder, ensures that the Diamond-NANGO's output drifts by only ˜0.3 nrad rms over ˜30 min. We show that the Diamond-NANGO can reliably move with unprecedented 1 nrad (˜57 ndeg) angular increments over a range of >7000 μrad. An autocollimator, interferometer, and capacitive displacement sensor are used to independently confirm the Diamond-NANGO's performance by simultaneously measuring the rotation of a reflective cube.

  15. Search for VHE gamma-ray emission from Geminga pulsar and nebula with the MAGIC telescopes

    CERN Document Server

    Ahnen, M L; Antonelli, L A; Antoranz, P; Babic, A; Banerjee, B; Bangale, P; de Almeida, U Barres; Barrio, J A; González, J Becerra; Bednarek, W; Bernardini, E; Biasuzzi, B; Bil, A; Blanch, O; Bonnefoy, S; Bonnoli, G; Borracci, F; Bretz, T; Carmona, E; Carosi, A; Chatterjee, A; Clavero, R; Colin, P; Colombo, E; Contreras, J L; Cortina, J; Covino, S; Da Vela, P; Dazzi, F; De Angelis, A; De Lotto, B; Wilhelmi, E de O na; Mendez, C Delgado; Di Pierro, F; Prester, D Dominis; Dorner, D; Doro, M; Einecke, S; Glawion, D Eisenacher; Elsaesser, D; Fernández-Barral, A; Fidalgo, D; Fonseca, M V; Font, L; Frantzen, K; Fruck, C; Galindo, D; López, R J García; Garczarczyk, M; Terrats, D Garrido; Gaug, M; Giammaria, P; Godinovic, N; Muñoz, A González; Guberman, D; Hahn, A; Hanabata, Y; Hayashida, M; Herrera, J; Hose, J; Hrupec, D; Hughes, G; Idec, W; Kodani, K; Konno, Y; Kubo, H; Kushida, J; La Barbera, A; Lelas, D; Lindfors, E; Lombardi, S; Longo, F; López, M; López-Coto, R; López-Oramas, A; Lorenz, E; Majumdar, P; Makariev, M; Mallot, K; Maneva, G; Manganaro, M; Mannheim, K; Maraschi, L; Marcote, B; Mariotti, M; Martínez, M; Mazin, D; Menzel, U; Mira, J M; Mirzoyan, R; Moralejo, A; Moretti, E; Nakajima, D; Neustroev, V; Niedzwiecki, A; Rosillo, M Nievas; Nilsson, K; Nishijima, K; Noda, K; Orito, R; Overkemping, A; Paiano, S; Palacio, J; Palatiello, M; Paneque, D; Paoletti, R; Paredes, J M; Paredes-Fortuny, X; Persic, M; Poutanen, J; Moroni, P G Prada; Prini, E; Puljak, I; Rhode, W; Ribó, M; Rico, J; Garcia, J Rodriguez; Saito, T; Satalecka, K; Schultz, C; Schweizer, T; Shore, S N; Sillanpaa, A; Sitarek, J; Snidaric, I; Sobczynska, D; Stamerra, A; Steinbring, T; Strzys, M; Takalo, L; Takami, H; Tavecchio, F; Temnikov, P; Terzic, T; Tescaro, D; Teshima, M; Thaele, J; Torres, D F; Toyama, T; Treves, A; Verguilov, V; Vovk, I; Ward, J E; Will, M; Wu, M H; Zanin, R

    2016-01-01

    The Geminga pulsar, one of the brighest gamma-ray sources, is a promising candidate for emission of very-high-energy (VHE > 100 GeV) pulsed gamma rays. Also, detection of a large nebula have been claimed by water Cherenkov instruments. We performed deep observations of Geminga with the MAGIC telescopes, yielding 63 hours of good-quality data, and searched for emission from the pulsar and pulsar wind nebula. We did not find any significant detection, and derived 95% confidence level upper limits. The resulting upper limits of 5.3 x 10^{-13} TeV cm^{-2} s^{-1} for the Geminga pulsar and 3.5 x 10^{-12} TeV cm^{-2} s^{-1} for the surrounding nebula at 50 GeV are the most constraining ones obtained so far at VHE. To complement the VHE observations, we also analyzed 5 years of Fermi-LAT data from Geminga, finding that the sub-exponential cut-off is preferred over the exponential cut-off that has been typically used in the literature. We also find that, above 10 GeV, the gamma-ray spectra from Geminga can be describ...

  16. Dicty_cDB: VHE495 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHE495 (Link to dictyBase) - - - Contig-U11503-1 VHE495E (Link...) Clone ID VHE495 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Ori...uence kkkqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICTSLKDA...nce (All Frames) Frame A: kkkqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICTSLKDAVSRAFLL...ts: (bits) Value N AC115680 |AC115680.3 Dictyostelium discoideum chromosome 2 map 4915084-5005461 strain AX4

  17. A new generation control system for astrophysical instruments

    Science.gov (United States)

    Cirami, R.; Comari, M.; Corte, C.; Di Marcantonio, P.; Pucillo, M.; Santin, P.; Vuerli, C.

    A new generation control system for telescopes and astrophysical instruments, both by the software and hardware point of view, has been developed and tested at the laboratories of INAF-Astronomical Observatory of Trieste. In this paper we present a working prototype of such a system: a lightweight, portable, adaptive system, based on the most diffuse standards; such a prototype can be used as a general purpose building block in the design of new instruments. The software environment is based on Linux, Java and CORBA for the communications among the components of the system. The hardware has been chosen among COTS components; in particular the prototype presented here runs on a PC104+ platform.

  18. Next Generation UV Coronagraph Instrumentation for Solar Cycle-24

    Indian Academy of Sciences (India)

    John L. Kohl; Rajmal Jain; Steven R. Cranmer; Larry D. Gardner; Anil K. Pradhan; John C. Raymond; Leonard Strachan

    2008-03-01

    Ultraviolet coronagraph observations of the extended solar corona (defined here as 1.5 to 10 solar radii from Sun-center) have become a powerful tool for obtaining detailed empirical descriptions of coronal holes, streamers, and coronal mass ejections. The empirical models resulting from ultraviolet coronagraph observations provide the constraints needed to test and guide theoretical models aimed at determining the physical processes that control solar wind acceleration, CME heating and acceleration, and solar energetic particle (SEP) acceleration. Measurements to date from sounding rockets, the shuttle deployed Spartan 201 satellite and the Solar and Heliospheric Observatory (SOHO) have utilized high resolution spectroscopy over a very limited instantaneous field of view. New concepts for next generation instrumentation include imaging ultraviolet spectrocoronagraphs and large aperture ultraviolet coronagraph spectrometers. An imaging instrument would be the first to obtain absolute spectral line intensities of the extended corona over a wide field of view. Such images would provide the absolute intensities of spectral lines that can be used to determine densities and outflow velocities of specific coronal ions. Measurements from several charge states of a given element will allow electron temperatures to be determined. These measurements combined with observations of H I Ly provide absolute chemical abundances (relative to hydrogen) for observed elements. Ultraviolet imaging would be highly complementary to a large-aperture ultraviolet coronagraph spectrometer designed for high spectral resolution observations over a small instantaneous field of view. The images would be used to select targets for more detailed spectroscopic studies with the large aperture UV coronagraph spectrometer and to provide time dependent empirical descriptions of the regions surrounding the narrow instantaneous field of view of the large aperture instrument. Descriptions of both the

  19. Second generation Robo-AO instruments and systems

    Science.gov (United States)

    Baranec, Christoph; Riddle, Reed; Law, Nicholas M.; Chun, Mark R.; Lu, Jessica R.; Connelley, Michael S.; Hall, Donald; Atkinson, Dani; Jacobson, Shane

    2014-07-01

    The prototype Robo-AO system at the Palomar Observatory 1.5-m telescope is the world's first fully automated laser adaptive optics instrument. Scientific operations commenced in June 2012 and more than 12,000 observations have since been performed at the ~0.12" visible-light diffraction limit. Two new infrared cameras providing high-speed tip-tilt sensing and a 2' field-of-view will be integrated in 2014. In addition to a Robo-AO clone for the 2-m IGO and the natural guide star variant KAPAO at the 1-m Table Mountain telescope, a second generation of facility-class Robo-AO systems are in development for the 2.2-m University of Hawai'i and 3-m IRTF telescopes which will provide higher Strehl ratios, sharper imaging, ~0.07", and correction to λ = 400 nm.

  20. Second generation Robo-AO instruments and systems

    CERN Document Server

    Baranec, Christoph; Law, Nicholas M; Chun, Mark R; Lu, Jessica R; Connelley, Michael S; Hall, Donald; Atkinson, Dani; Jacobson, Shane

    2014-01-01

    The prototype Robo-AO system at the Palomar Observatory 1.5-m telescope is the world's first fully automated laser adaptive optics instrument. Scientific operations commenced in June 2012 and more than 12,000 observations have since been performed at the ~0.12" visible-light diffraction limit. Two new infrared cameras providing high-speed tip-tilt sensing and a 2' field-of-view will be integrated in 2014. In addition to a Robo-AO clone for the 2-m IGO and the natural guide star variant KAPAO at the 1-m Table Mountain telescope, a second generation of facility-class Robo-AO systems are in development for the 2.2-m University of Hawai'i and 3-m IRTF telescopes which will provide higher Strehl ratios, sharper imaging, ~0.07", and correction to {\\lambda} = 400 nm.

  1. Localizing the VHE γ-ray source at the Galactic Centre

    Science.gov (United States)

    Acero, F.; Aharonian, F.; Akhperjanian, A. G.; Anton, G.; Barres de Almeida, U.; Bazer-Bachi, A. R.; Becherini, Y.; Behera, B.; Bernlöhr, K.; Bochow, A.; Boisson, C.; Bolmont, J.; Borrel, V.; Braun, I.; Brucker, J.; Brun, F.; Brun, P.; Bühler, R.; Bulik, T.; Büsching, I.; Boutelier, T.; Chadwick, P. M.; Charbonnier, A.; Chaves, R. C. G.; Cheesebrough, A.; Conrad, J.; Chounet, L.-M.; Clapson, A. C.; Coignet, G.; Dalton, M.; Daniel, M. K.; Davids, I. D.; Degrange, B.; Deil, C.; Dickinson, H. J.; Djannati-Ataï, A.; Domainko, W.; Drury, L. O'c.; Dubois, F.; Dubus, G.; Dyks, J.; Dyrda, M.; Egberts, K.; Eger, P.; Espigat, P.; Fallon, L.; Farnier, C.; Fegan, S.; Feinstein, F.; Fiasson, A.; Förster, A.; Fontaine, G.; Füßling, M.; Gabici, S.; Gallant, Y. A.; Gérard, L.; Gerbig, D.; Giebels, B.; Glicenstein, J. F.; Glück, B.; Goret, P.; Göring, D.; Hauser, M.; Heinz, S.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hoffmann, A.; Hofmann, W.; Hofverberg, P.; Holleran, M.; Hoppe, S.; Horns, D.; Jacholkowska, A.; de Jager, O. C.; Jahn, C.; Jung, I.; Katarzyński, K.; Katz, U.; Kaufmann, S.; Kerschhaggl, M.; Khangulyan, D.; Khélifi, B.; Keogh, D.; Klochkov, D.; Kluźniak, W.; Kneiske, T.; Komin, Nu.; Kosack, K.; Kossakowski, R.; Lamanna, G.; Lenain, J.-P.; Lohse, T.; Marandon, V.; Martineau-Huynh, O.; Marcowith, A.; Masbou, J.; Maurin, D.; McComb, T. J. L.; Medina, M. C.; Méhault, J.; Moderski, R.; Moulin, E.; Naumann-Godo, M.; de Naurois, M.; Nedbal, D.; Nekrassov, D.; Nicholas, B.; Niemiec, J.; Nolan, S. J.; Ohm, S.; Olive, J.-F.; de Oña Wilhelmi, E.; Orford, K. J.; Ostrowski, M.; Panter, M.; Arribas, M. Paz; Pedaletti, G.; Pelletier, G.; Petrucci, P.-O.; Pita, S.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raubenheimer, B. C.; Raue, M.; Rayner, S. M.; Reimer, O.; Renaud, M.; Rieger, F.; Ripken, J.; Rob, L.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Ruppel, J.; Ryde, F.; Sahakian, V.; Santangelo, A.; Schlickeiser, R.; Schöck, F. M.; Schönwald, A.; Schwanke, U.; Schwarzburg, S.; Schwemmer, S.; Shalchi, A.; Sikora, M.; Skilton, J. L.; Sol, H.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Superina, G.; Sushch, I.; Szostek, A.; Tam, P. H.; Tavernet, J.-P.; Terrier, R.; Tibolla, O.; Tluczykont, M.; van Eldik, C.; Vasileiadis, G.; Venter, C.; Venter, L.; Vialle, J. P.; Vincent, P.; Vivier, M.; Völk, H. J.; Volpe, F.; Wagner, S. J.; Ward, M.; Zdziarski, A. A.; Zech, A.; H.E.S.S. Collaboration

    2010-03-01

    The inner 10pc of our Galaxy contains many counterpart candidates of the very high energy (VHE; >100GeV) γ-ray point source HESS J1745-290. Within the point spread function of the H.E.S.S. measurement, at least three objects are capable of accelerating particles to VHE and beyond and of providing the observed γ-ray flux. Previous attempts to address this source confusion were hampered by the fact that the projected distances between these objects were of the order of the error circle radius of the emission centroid (34arcsec, dominated by the pointing uncertainty of the H.E.S.S. instrument). Here we present H.E.S.S. data of the Galactic Centre region, recorded with an improved control of the instrument pointing compared to H.E.S.S. standard pointing procedures. Stars observed during γ-ray observations by optical guiding cameras mounted on each H.E.S.S. telescope are used for off-line pointing calibration, thereby decreasing the systematic pointing uncertainties from 20 to 6arcsec per axis. The position of HESS J1745-290 is obtained by fitting a multi-Gaussian profile to the background-subtracted γ-ray count map. A spatial comparison of the best-fitting position of HESS J1745-290 with the position and morphology of candidate counterparts is performed. The position is, within a total error circle radius of 13arcsec, coincident with the position of the supermassive black hole Sgr A* and the recently discovered pulsar wind nebula candidate G359.95-0.04. It is significantly displaced from the centroid of the supernova remnant Sgr A East, excluding this object with high probability as the dominant source of the VHE γ-ray emission.

  2. Novel gratings for next-generation instruments of astronomical observations

    Science.gov (United States)

    Ebizuka, N.; Okamoto, T.; Takeda, M.; Hosobata, T.; Yamagata, Y.; Sasaki, M.; Uomoto, M.; Shimatsu, T.; Sato, S.; Hashimoto, N.; Tanaka, I.; Hattori, T.; Ozaki, S.; Aoki, W.

    2017-05-01

    We will introduce current status of development of a birefringence volume phase holographic (B-VPH) grating, volume binary (VB) grating and reflector facet transmission (RFT) grating developing as the novel dispersive optical element for astronomical instruments for the 8.2m Subaru Telescope, for next generation 30 m class huge ground-based telescopes and for next generation large space-bone telescopes. We will also introduce a hybrid grism developed for MOIRCS (Multi-Object InfraRed Camera and Spectrograph) of the Subaru Telescope and a quasi-Bragg (QB) immersion grating. Test fabrication of B-VPH gratings with a liquid crystal (LC) of UV curable and normal LCs or a resin of visible light curable are performed. We successfully fabricated VB gratings of silicon as a mold with ridges of a high aspect ratio by means of the cycle etching process, oxidation and removal of silicon oxide. The RFT grating which is a surface-relief (SR) transmission grating with sawtooth shaped ridges of an acute vertex angle. The hybrid grism, as a prototype of the RFT grating, combines a high-index prism and SR transmission grating with sawtooth shape ridges of an acute vertex angle. The mold of the SR grating for the hybrid grism on to a work of Ni-P alloy of non-electrolysic plating successfully fabricated by using our ultra-precision machine and a single-crystal diamond bite. The QB immersion grating was fabricated by a combination of an inclined QB grating, Littrow prism and surface reflection mirror.

  3. Discovery of VHE $\\gamma$-ray emission from the SNR G54.1+0.3

    CERN Document Server

    Acciari, V A; Arlen, T; Aune, T; Bautista, M; Beilicke, M; Benbow, W; Boltuch, D; Bradbury, S M; Buckley, J H; Bugaev, V; Butt, Y; Byrum, K; Cesarini, A; Ciupik, L; Cui, W; Dickherber, R; Duke, C; Finley, J P; Finnegan, G; Fortson, L; Furniss, A; Galante, N; Gall, D; Gillanders, G H; Godambe, S; Gotthelf, E V; Grube, J; Guenette, R; Gyuk, G; Hanna, D; Holder, J; Hui, C M; Humensky, T B; Imran, A; Kaaret, P; Karlsson, N; Kertzman, M; Kieda, D; Konopelko, A; Krawczynski, H; Krennrich, F; Lang, M J; LeBohec, S; Maier, G; McArthur, S; McCann, A; McCutcheon, M; Moriarty, P; Muhkerjee, R; Ong, R A; Otte, A N; Pandel, D; Perkins, J S; Pohl, M; Quinn, J; Ragan, K; Reyes, L C; Reynolds, P T; Roache, E; Rose, H J; Schroedter, M; Sembroski, G H; Senturk, G Demet; Slane, P; Smith, A W; Steele, D; Swordy, S P; Těsić, G; Theiling, M; Thibadeau, S; Vassiliev, V V; Vincent, S; Wakely, S P; Ward, J E; Weekes, T C; Weinstein, A; Weisgarber, T; Williams, D A; Wissel, S; Wood, M; Zitzer, B

    2010-01-01

    We report the discovery of very high energy gamma-ray emission from the direction of the SNR G54.1+0.3 using the VERITAS ground-based gamma-ray observatory. The TeV signal has an overall significance of 6.8$\\sigma$ and appears point-like given the 5$^{arcminute}$ resolution of the instrument. The integral flux above 1 TeV is 2.5\\% of the Crab Nebula flux and significant emission is measured between 250 GeV and 4 TeV, well described by a power-law energy spectrum dN/dE $\\sim$ E$^{-\\Gamma}$ with a photon index $\\Gamma= 2.39\\pm0.23_{stat}\\pm0.30_{sys}$. We find no evidence of time variability among observations spanning almost two years. Based on the location, the morphology, the measured spectrum, the lack of variability and a comparison with similar systems previously detected in the TeV band, the most likely counterpart of this new VHE gamma-ray source is the PWN in the SNR G54.1+0.3. The measured X-ray to VHE gamma-ray luminosity ratio is the lowest among all the nebulae supposedly driven by young rotation-p...

  4. VHE $\\gamma$-ray observations of Markarian 501

    CERN Document Server

    Breslin, A C; Bradbury, S M; Buckley, J H; Burdett, A M; Carson, M J; Carter-Lewis, D A; Catanese, M; Cawley, M F; Dunlea, S; D'Vali, M; Fegan, D J; Fegan, S J; Finley, J P; Gaidos, J A; Hall, T A; Hillas, A M; Horan, D; Kildea, J; Knapp, J; Krennrich, F; Le Bohec, S; Lessard, R W; Masterson, C; McKernan, B; Quinn, J; Rose, H J; Samuelson, F W; Sembroski, G H; Vasilev, V; Weekes, T C

    1999-01-01

    Markarian 501, a nearby (z=0.033) X-ray selected BL Lacertae object, is a well established source of Very High Energy (VHE, E>=300 GeV) gamma rays. Dramatic variability in its gamma-ray emission on time-scales from years to as short as two hours has been detected. Multiwavelength observations have also revealed evidence that the VHE gamma-ray and hard X-ray fluxes may be correlated. Here we present results of observations made with the Whipple Collaboration's 10 m Atmospheric Cerenkov Imaging Telescope during 1999 and discuss them in the context of observations made on Markarian 501 during the period from 1996-1998.

  5. Raster Scanning the Crab Nebula to Produce an Extended VHE Calibration Source

    CERN Document Server

    Bird, Ralph

    2015-01-01

    The Crab Nebula has long been the standard reference point source for very-high-energy (VHE, E $>$100 GeV) gamma-ray observatories such as VERITAS. It has enabled testing and improvement of analysis methods, validation of techniques, and has served as a calibration source. No comparable extended source is known with a high, constant flux and well understood morphology. In order to artificially generate such a source, VERITAS has performed raster scans across the Crab Nebula. By displacing the source within the field-of-view in a known pattern, it is possible to generate an extended calibration source for verification of extended source analysis techniques. The method as well as early results of this novel technique are presented.

  6. Instrumentation

    Institute of Scientific and Technical Information of China (English)

    2015-01-01

    Journal Scope:Instrumentation is a high quality open access peer reviewed research journal.Authors are solicited to contribute to these journals by submitting articles that illustrate most up-to-date research results,projects,surveying works and industrial experiences that describe significant advances in the instrumental science.The mission of the Instrumentation is

  7. Feasibility of leak-detection instrumentation for duplex-tube steam generator. [LMFBR

    Energy Technology Data Exchange (ETDEWEB)

    Berkey, E.; Witkowski, R.E.

    1974-01-01

    A literature search has been carried out to determine if current state-of-the-art for sodium vapor and water vapor detectors are feasible as leak detection instrumentation for the Westinghouse duplex-tube steam generator. A commercially available probe-type water vapor detector has been identified and a thermal ionization type sodium vapor detector, currently being developed by Westinghouse, has been selected as the reference sodium-vapor leak detector. Recommendations are made concerning the experimental studies required to adapt the selected instrumentation to steam-generator plant applications. Proposed future instrumentation development programs are also identified.

  8. Investigating the peculiar emission from the new VHE gamma-ray source H1722+119

    Science.gov (United States)

    Ahnen, M. L.; Ansoldi, S.; Antonelli, L. A.; Antoranz, P.; Babic, A.; Banerjee, B.; Bangale, P.; Barres de Almeida, U.; Barrio, J. A.; Becerra González, J.; Bednarek, W.; Bernardini, E.; Biasuzzi, B.; Biland, A.; Blanch, O.; Bonnefoy, S.; Bonnoli, G.; Borracci, F.; Bretz, T.; Buson, S.; Carosi, A.; Chatterjee, A.; Clavero, R.; Colin, P.; Colombo, E.; Contreras, J. L.; Cortina, J.; Covino, S.; Da Vela, P.; Dazzi, F.; De Angelis, A.; De Lotto, B.; de Oña Wilhelmi, E.; Di Pierro, F.; Doert, M.; Domínguez, A.; Dominis Prester, D.; Dorner, D.; Doro, M.; Einecke, S.; Eisenacher Glawion, D.; Elsaesser, D.; Fallah Ramazani, V.; Fernández-Barral, A.; Fidalgo, D.; Fonseca, M. V.; Font, L.; Frantzen, K.; Fruck, C.; Galindo, D.; García López, R. J.; Garczarczyk, M.; Garrido Terrats, D.; Gaug, M.; Giammaria, P.; Godinović, N.; González Muñoz, A.; Gora, D.; Guberman, D.; Hadasch, D.; Hahn, A.; Hanabata, Y.; Hayashida, M.; Herrera, J.; Hose, J.; Hrupec, D.; Hughes, G.; Idec, W.; Kodani, K.; Konno, Y.; Kubo, H.; Kushida, J.; La Barbera, A.; Lelas, D.; Lindfors, E.; Lombardi, S.; Longo, F.; López, M.; López-Coto, R.; Majumdar, P.; Makariev, M.; Mallot, K.; Maneva, G.; Manganaro, M.; Mannheim, K.; Maraschi, L.; Marcote, B.; Mariotti, M.; Martínez, M.; Mazin, D.; Menzel, U.; Miranda, J. M.; Mirzoyan, R.; Moralejo, A.; Moretti, E.; Nakajima, D.; Neustroev, V.; Niedzwiecki, A.; Nievas Rosillo, M.; Nilsson, K.; Nishijima, K.; Noda, K.; Nogués, L.; Orito, R.; Overkemping, A.; Paiano, S.; Palacio, J.; Palatiello, M.; Paneque, D.; Paoletti, R.; Paredes, J. M.; Paredes-Fortuny, X.; Pedaletti, G.; Perri, L.; Persic, M.; Poutanen, J.; Prada Moroni, P. G.; Prandini, E.; Puljak, I.; Rhode, W.; Ribó, M.; Rico, J.; Rodriguez Garcia, J.; Saito, T.; Satalecka, K.; Schultz, C.; Schweizer, T.; Sillanpää, A.; Sitarek, J.; Snidaric, I.; Sobczynska, D.; Stamerra, A.; Steinbring, T.; Strzys, M.; Takalo, L.; Takami, H.; Tavecchio, F.; Temnikov, P.; Terzić, T.; Tescaro, D.; Teshima, M.; Thaele, J.; Torres, D. F.; Toyama, T.; Treves, A.; Verguilov, V.; Vovk, I.; Ward, J. E.; Will, M.; Wu, M. H.; Zanin, R.; D'Ammando, F.; Berdyugin, A.; Hovatta, T.; Max-Moerbeck, W.; Raiteri, C. M.; Readhead, A. C. S.; Reinthal, R.; Richards, J. L.; Verrecchia, F.; Villata, M.

    2016-07-01

    The Major Atmospheric Gamma-ray Imaging Cherenkov (MAGIC) telescopes observed the BL Lac object H1722+119 (redshift unknown) for six consecutive nights between 2013 May 17 and 22, for a total of 12.5 h. The observations were triggered by high activity in the optical band measured by the KVA (Kungliga Vetenskapsakademien) telescope. The source was for the first time detected in the very high energy (VHE, E > 100 GeV) γ-ray band with a statistical significance of 5.9σ. The integral flux above 150 GeV is estimated to be (2.0 ± 0.5) per cent of the Crab nebula flux. We used contemporaneous high energy (HE, 100 MeV < E < 100 GeV) γ-ray observations from Fermi-Large Area Telescope to estimate the redshift of the source. Within the framework of the current extragalactic background light models, we estimate the redshift to be z = 0.34 ± 0.15. Additionally, we used contemporaneous X-ray to radio data collected by the instruments on board the Swift satellite, the KVA, and the Owens Valley Radio Observatory telescope to study multifrequency characteristics of the source. We found no significant temporal variability of the flux in the HE and VHE bands. The flux in the optical and radio wavebands, on the other hand, did vary with different patterns. The spectral energy distribution of H1722+119 shows surprising behaviour in the ˜3 × 1014-1018 Hz frequency range. It can be modelled using an inhomogeneous helical jet synchrotron self-Compton model.

  9. Instrumentation

    Institute of Scientific and Technical Information of China (English)

    2016-01-01

    Journal Scope:Instrumentation is a high quality open access peer reviewed research journal.Authors are solicited to contribute to these journals by submitting articles that illustrate most up-to-date research results,projects,surveying works and industrial experiences that describe significant advances in the instrumental science.The mission of the Instrumentation is to provide a platform for the researchers,academicians,

  10. [Research and development for next generation PET instrumentations].

    Science.gov (United States)

    Yamaya, Taiga

    2012-01-01

    Positron emission tomography (PET) plays important roles in cancer diagnosis and molecular imaging research; but potential points remain for which big improvements could be made, including resolution, sensitivity and costs. For example, the sensitivity of present PET scanners does not exceed 10%. This means that more than 90% of the gamma-rays emitted from a subject are not utilized for imaging. Therefore, research on next generation PET technologies remains a hot topic worldwide. In this paper, we introduce some research trends by describing PET physics research in the National Institute of Radiological Sciences (NIRS). A depth-of-interaction (DOI) detector, for which various methods have been studied, will be a key device to get any significant improvement in sensitivity while maintaining high spatial resolution. DOI measurement also has a potential to expand PET application fields because it allows for more flexible detector arrangement. As an example, we are developing the world's first, open-type PET geometry "OpenPET", which is expected to lead to PET imaging during treatment. The DOI detector itself continues to evolve with the help of recently developed semiconductor photodetectors, often referred to as silicon photomultipliers (SiPMs). We are developing a SiPM-based DOI detector to achieve sub-mm spatial resolution, which is reaching the theoretical limitation of PET imaging.

  11. First detection of VHE γ-rays from SN 1006 by HESS

    NARCIS (Netherlands)

    Acero, F.; Aharonian, F.; Akhperjanian, A.G.; Anton, G.; Vink, J.

    2010-01-01

    Aims. Recent theoretical predictions of the lowest very high energy (VHE) luminosity of SN 1006 are only a factor 5 below the previously published HESS upper limit, thus motivating further in-depth observations of this source. Methods. Deep observations at VHE energies (above 100 GeV) were carried o

  12. Instrumentation

    Energy Technology Data Exchange (ETDEWEB)

    Decreton, M

    2001-04-01

    SCK-CEN's research and development programme on instrumentation involves the assessment and the development of sensitive measurement systems used within a radiation environment. Particular emphasis is on the assessment of optical fibre components and their adaptability to radiation environments. The evaluation of ageing processes of instrumentation in fission plants, the development of specific data evaluation strategies to compensate for ageing induced degradation of sensors and cable performance form part of these activities. In 2000, particular emphasis was on in-core reactor instrumentation applied to fusion, accelerator driven and water-cooled fission reactors. This involved the development of high performance instrumentation for irradiation experiments in the BR2 reactor in support of new instrumentation needs for MYRRHA, and for diagnostic systems for the ITER reactor.

  13. Instrumentation

    Energy Technology Data Exchange (ETDEWEB)

    Decreton, M

    2002-04-01

    SCK-CEN's R and D programme on instrumentation involves the development of advanced instrumentation systems for nuclear applications as well as the assessment of the performance of these instruments in a radiation environment. Particular emphasis is on the use of optical fibres as umbilincal links of a remote handling unit for use during maintanance of a fusion reacor, studies on the radiation hardening of plasma diagnostic systems; investigations on new instrumentation for the future MYRRHA accelerator driven system; space applications related to radiation-hardened lenses; the development of new approaches for dose, temperature and strain measurements; the assessment of radiation-hardened sensors and motors for remote handling tasks and studies of dose measurement systems including the use of optical fibres. Progress and achievements in these areas for 2001 are described.

  14. Instrumentation

    Energy Technology Data Exchange (ETDEWEB)

    Decreton, M

    2000-07-01

    SCK-CEN's research and development programme on instrumentation aims at evaluating the potentials of new instrumentation technologies under the severe constraints of a nuclear application. It focuses on the tolerance of sensors to high radiation doses, including optical fibre sensors, and on the related intelligent data processing needed to cope with the nuclear constraints. Main achievements in these domains in 1999 are summarised.

  15. On-Orbit Absolute Radiance Standard for the Next Generation of IR Remote Sensing Instruments

    OpenAIRE

    Best, Fred. A.; Adler, Douglas P.; Pettersen, P. Claire; Gero, Jonathan; Taylor, Joseph K.; Revercomb, Henry E.; Knuteson, Robert O.; Perepezko, John H.

    2012-01-01

    The next generation of infrared remote sensing satellite instrumentation, including climate benchmark missions will require better absolute measurement accuracy than now available, and will most certainly rely on the emerging capability to fly SI traceable standards that provide irrefutable absolute measurement accuracy. As an example, instrumentation designed to measure spectrally resolved infrared radiances with an absolute brightness temperature error of better than 0.1 K will require high...

  16. Sound Generation by a Turbulent Flow in Musical Instruments - Multiphysics Simulation Approach -

    CERN Document Server

    Kobayashi, Taizo; Takahashi, Kin'ya; Mibu, Ryota; Aoyagi, Mutsumi

    2007-01-01

    Total computational costs of scientific simulations are analyzed between direct numerical simulations (DNS) and multiphysics simulations (MPS) for sound generation in musical instruments. In order to produce acoustic sound by a turbulent flow in a simple recorder-like instrument, compressible fluid dynamic calculations with a low Mach number are required around the edges and the resonator of the instrument in DNS, while incompressible fluid dynamic calculations coupled with dynamics of sound propagation based on the Lighthill's acoustic analogy are used in MPS. These strategies are evaluated not only from the viewpoint of computational performances but also from the theoretical points of view as tools for scientific simulations of complicated systems.

  17. Instruments

    Energy Technology Data Exchange (ETDEWEB)

    Buehrer, W. [Paul Scherrer Inst. (PSI), Villigen (Switzerland)

    1996-12-31

    The present paper mediates a basic knowledge of the most commonly used experimental techniques. We discuss the principles and concepts necessary to understand what one is doing if one performs an experiment on a certain instrument. (author) 29 figs., 1 tab., refs.

  18. Instrumentation

    Institute of Scientific and Technical Information of China (English)

    2015-01-01

    Journal Scope:Instrumentation is a high quality open access peer reviewed research journal,Authors are solicited to contribute to these journals by submitting articles that illustrate most up-to-date research results,projects,surveying works and industrial

  19. The Complex VHE And Multiwavelength Flaring Activity Of The FSRQ PKS 1510-089 In May 2015

    CERN Document Server

    Zacharias, Michael; Chakraborty, Nachiketa; Cologna, Gabriele; Jankowsky, Felix; Lenain, Jean-Philippe; Mohamed, Mahmoud; Prokoph, Heike; Wagner, Stefan; Wierzcholska, Alicja; Zaborov, Dmitry

    2016-01-01

    The blazar PKS 1510-089 was the first of the flat spectrum radio quasar type, which had been detected simultaneously by a ground based Cherenkov telescope (H.E.S.S.) and the LAT instrument on board the Fermi satellite. Given the strong broad line region emission defining this blazar class, and the resulting high optical depth for VHE ($E>100\\,$GeV) $\\gamma$-rays, it was surprising to detect VHE emission from such an object. In May 2015, PKS 1510-089 exhibited high states throughout the electromagnetic spectrum. Target of Opportunity observations with the H.E.S.S. experiment revealed strong and unprecedented variability of this source. Comparison with the lightcurves obtained with the \\textit{Fermi}-LAT in HE $\\gamma$-rays ($100\\,$MeV$

  20. An Integrated Optics beam combiner for the second generation VLTI instruments

    CERN Document Server

    Benisty, M; Jocou, L; Labeye, P; Malbet, F; Perraut, K; Kern, P

    2009-01-01

    The very recent years have seen a promising start in scientific publications making use of images produced by near-infrared long-baseline interferometry. The technique has reached, at last, a technical maturity level that opens new avenues for numerous astrophysical topics requiring milli-arcsecond model-independent imaging. The Very Large Telescope Interferometer (VLTI) is on the path to be equipped with instruments capable to combine between four to six telescopes. In the framework of the VLTI second generation instruments Gravity and VSI, we propose a new beam combining concept using Integrated Optics (IO) technologies with a novel ABCD-like fringe encoding scheme. Our goal is to demonstrate that IO-based combination brings considerable advantages in terms of instrumental design and performance. We therefore aim at giving a full characterization of an IO beam combiner to establish its performances and check its compliance with the specifications of an imaging instrument. Laboratory measurements were made i...

  1. A new generation active arrays for optical flexibility in astronomical instrumentation

    Science.gov (United States)

    Kroes, G.; Jaskó, A.; Pragt, J. H.; Venema, L.; De Haan, M.

    2012-09-01

    Throughout the history of telescopes and astronomical instrumentation, new ways were found to open up unexplored possibilities in fundamental astronomical research by increasing the telescope size and instrumentation complexity. The ever demanding requirements on instrument performance pushes instrument complexity to the edge. In order to take the next leap forward in instrument development the optical design freedom needs to be increased drastically. The use of more complex and more accurate optics allows for shorter optical trains with smaller sizes, smaller number of components and reduced fabrication and alignment verification time and costs. Current optics fabrication is limited in surface form complexity and/or accuracy. Traditional active and adaptive optics lack the needed intrinsic long term stability and simplicity in design, manufacturing, verification and control. This paper explains how and why active arrays literally provide a flexible but stable basis for the next generation optical instruments. Combing active arrays with optically high quality face sheets more complex and accurate optical surface forms can be provided including extreme a-spherical (freeform) surfaces and thus allow for optical train optimization and even instrument reconfiguration. A zero based design strategy is adopted for the development of the active arrays addressing fundamental issues in opto-mechanical engineering. The various choices are investigated by prototypes and Finite Element Analysis. Finally an engineering concept will be presented following a highly stable adjustment strategy allowing simple verification and control. The Optimization metrology is described in an additional paper for this conference by T. Agócs et al.

  2. Status of Identification of VHE Gamma-Ray Sources

    Energy Technology Data Exchange (ETDEWEB)

    Funk, Stefan; /SLAC

    2006-09-28

    With the recent advances made by Cherenkov telescopes such as H.E.S.S. the field of very high-energy (VHE) {gamma}-ray astronomy has recently entered a new era in which for the first time populations of Galactic sources such as e.g. Pulsar wind nebulae (PWNe) or Supernova remnants (SNRs) can be studied. However, while some of the new sources can be associated by positional coincidence as well as by consistent multi-wavelength data to a known counterpart at other wavelengths, most of the sources remain not finally identified. In the following, the population of Galactic H.E.S.S. sources will be used to demonstrate the status of the identifications, to classify them into categories according to this status and to point out outstanding problems.

  3. Discovery of VHE gamma-ray emission from the direction of the globular cluster Terzan 5

    CERN Document Server

    Domainko, W; Brun, F; Eger, P; Jamrozy, M; Dyrda, M; Komin, N; Schwanke, U

    2011-01-01

    Globular clusters are old stellar systems which exhibit very-high stellar densities in their cores. The globular cluster Terzan 5 is characterized by a high stellar encounter rate and hosts the largest detected population of millisecond pulsars. It also features bright GeV gamma-ray emission and extended X-ray radiation. However, no globular clusters have been detected in very-high-energy gamma rays (VHE, E> 100 GeV) so far. In order to investigate this possibility Terzan 5 has been observed with the H.E.S.S. telescope array in this energy band. The discovery of a source of VHE gamma rays from the direction of this globular cluster will be reported. The results of the VHE analysis and a multi-wavelength view of Terzan 5 will be presented in this contribution. No counterpart or model can fully explain the observed morphology of the detected VHE gamma-ray source.

  4. Investigating the peculiar emission from the new VHE gamma-ray source H1722+119

    CERN Document Server

    Ahnen, M L; Antonelli, L A; Antoranz, P; Babic, A; Banerjee, B; Bangale, P; de Almeida, U Barres; Barrio, J A; González, J Becerra; Bednarek, W; Bernardini, E; Biasuzzi, B; Biland, A; Blanch, O; Bonnefoy, S; Bonnoli, G; Borracci, F; Bretz, T; Buson, S; Carosi, A; Chatterjee, A; Clavero, R; Colin, P; Colombo, E; Contreras, J L; Cortina, J; Covino, S; Da Vela, P; Dazzi, F; De Angelis, A; De Lotto, B; Wilhelmi, E de Ona; Di Pierro, F; Doert, M; Domínguez, A; Prester, D Dominis; Dorner, D; Doro, M; Einecke, S; Glawion, D Eisenacher; Elsaesser, D; Ramazani, V Fallah; Fernández-Barral, A; Fidalgo, D; Fonseca, M V; Font, L; Frantzen, K; Fruck, C; Galindo, D; López, R J García; Garczarczyk, M; Terrats, D Garrido; Gaug, M; Giammaria, P; Godinović, N; Munoz, A González; Gora, D; Guberman, D; Hadasch, D; Hahn, A; Hanabata, Y; Hayashida, M; Herrera, J; Hose, J; Hrupec, D; Hughes, G; Idec, W; Kodani, K; Konno, Y; Kubo, H; Kushida, J; La Barbera, A; Lelas, D; Lindfors, E; Lombardi, S; Longo, F; López, M; López-Coto, R; Majumdar, P; Makariev, M; Mallot, K; Maneva, G; Manganaro, M; Mannheim, K; Maraschi, L; Marcote, B; Mariotti, M; Martínez, M; Mazin, D; Menzel, U; Miranda, J M; Mirzoyan, R; Moralejo, A; Moretti, E; Nakajima, D; Neustroev, V; Niedzwiecki, A; Rosillo, M Nievas; Nilsson, K; Nishijima, K; Noda, K; Nogués, L; Orito, R; Overkemping, A; Paiano, S; Palacio, J; Palatiello, M; Paneque, D; Paoletti, R; Paredes, J M; Paredes-Fortuny, X; Pedaletti, G; Perri, L; Persic, M; Poutanen, J; Moroni, P G Prada; Prandini, E; Puljak, I; Rhode, W; Ribó, M; Rico, J; Garcia, J Rodriguez; Saito, T; Satalecka, K; Schultz, C; Schweizer, T; Sillanpää, A; Sitarek, J; Snidaric, I; Sobczynska, D; Stamerra, A; Steinbring, T; Strzys, M; Takalo, L; Takami, H; Tavecchio, F; Temnikov, P; Terzić, T; Tescaro, D; Teshima, M; Thaele, J; Torres, D F; Toyama, T; Treves, A; Verguilov, V; Vovk, I; Ward, J E; Will, M; Wu, M H; Zanin, R; D'Ammando, F; Hovatta, T; Max-Moerbeck, W; Raiteri, C M; Readhead, A C S; Reinthal, R; Richards, J L; Verrecchia, F; Villata, M

    2016-01-01

    The MAGIC (Major Atmospheric Gamma-ray Imaging Cherenkov) telescopes observed the BL Lac object H1722+119 (redshift unknown) for six consecutive nights between 2013 May 17 and 22, for a total of 12.5 h. The observations were triggered by high activity in the optical band measured by the KVA (Kungliga Vetenskapsakademien) telescope. The source was for the first time detected in the very high energy (VHE, $E > 100$ GeV) $\\gamma$-ray band with a statistical significance of 5.9 $\\sigma$. The integral flux above 150 GeV is estimated to be $(2.0\\pm 0.5)$ per cent of the Crab Nebula flux. We used contemporaneous high energy (HE, 100 MeV $ < E < 100$ GeV) $\\gamma$-ray observations from Fermi-LAT (Large Area Telescope) to estimate the redshift of the source. Within the framework of the current extragalactic background light models, we estimate the redshift to be $z = 0.34 \\pm 0.15$. Additionally, we used contemporaneous X-ray to radio data collected by the instruments on board the Swift satellite, the KVA, and t...

  5. Portable generator-based XRF instrument for non-destructive analysis at crime scenes

    Science.gov (United States)

    Schweitzer, Jeffrey S.; Trombka, Jacob I.; Floyd, Samuel; Selavka, Carl; Zeosky, Gerald; Gahn, Norman; McClanahan, Timothy; Burbine, Thomas

    2005-12-01

    Unattended and remote detection systems find applications in space exploration, telemedicine, teleforensics, homeland security and nuclear non-proliferation programs. The National Institute of Justice (NIJ) and the National Aeronautics and Space Administration's (NASA) Goddard Space Flight Center (GSFC) have teamed up to explore the use of NASA developed technologies to help criminal justice agencies and professionals investigate crimes. The objective of the program is to produce instruments and communication networks that have application within both NASA's space program and NIJ, together with state and local forensic laboratories. A general-purpose X-ray fluorescence system has been built for non-destructive analyses of trace and invisible material at crime scenes. This portable instrument is based on a generator that can operate to 60 kV and a Schottky CdTe detector. The instrument has been shown to be successful for the analysis of gunshot residue and a number of bodily fluids at crime scenes.

  6. Meteosat Third Generation Lightning Imager: a discussion on user requirements and instrument features.

    Science.gov (United States)

    Biron, D.; de Leonibus, L.; Zauli, F.; Melfi, D.; Laquale, P.; Labate, D.

    2009-04-01

    For the next generation of earth observation geostationary satellite, major operating agencies are planning to insert an optical imaging mission, that continuously observes lightning pulses in the atmosphere; EUMETSAT has decided at the end of 2008 that one of the mission to be flown on MTG is LI, a Lightning Imager. The Centro Nazionale di Meteorologia e Climatologia Aeronautica recently hosted a fellowship sponsored by Selex Galileo, with the intent to study and perform a simulation of Meteosat Third Generation - Lightning Imager (MTG-LI) sensor behavior through Tropical Rainfall Measuring Mission - Lightning Imaging Sensor data (TRMM-LIS). MTG-LI mission has no Meteosat Second Generation heritage, but users need to evaluate the possible real time data output of the instrument to agree in inserting it on MTG payload. Authors took the expected LI design from MTG Mission Requirement Document, and reprocess real lightning dataset, acquired from space by TRMM-LIS instrument, to produce a simulated MTG-LI lightning dataset. The simulation is performed in several run, varying Minimum Detectable Energy, taking into account processing steps from event detection to final lightning information. A discussion on user requirements and instrument features is presented.

  7. Standardisation of a Vapour Generator for Calibration of Environmental Monitoring Instruments

    Directory of Open Access Journals (Sweden)

    Parul Rana

    2003-10-01

    Full Text Available Very low vapour pressure of 2,4,6 trinitrotoulene (TNT yields extremely low vapour concentrations at different flow rates in the air, yet considerable quantity of vapours and TNTdust during handling may be present at the workplace environment which is harmful to the health of the personnel working there. The explosive vapours, such as TNT,  2,6-dinitrotoluene (DNT, etc., though harmful to the health of the personnel, are not covered either in the emission standards or in the ambient air quality standards. Presently, no instrument is available for air monitoring of TNT vapours. These vapours need to be collected on-site to estimate TNT concentration. Realising the need for real-time air monitoring of TNT, efforts have been made to understand and device an instrument for on-site determination of TNT vapours parts per billiion (ppb range. Low-level TNT vapours and TNT buried in the soil in military operations are required to be detected. The instruments for this require careful calibration to yield accurate and reliable results. Hence, an effort has been made to develop a trace-level ppb vapour generator. The vapour generator of a spiral glass column of length 170 cm and inner diameter 4 mm 2 0.5 mm has been used. An activated charcoal glass tube has been used for sampling TNT vapours. The adsorbed TNT vapours were desorbed and analysed using high performance liquid chromatography. Thesolid support used has been studied. These vapours generated at different flow rates have been evaluated. The calibrated instrument can be used for in situ and on-site analysis of samples of TNT and also for samples collected.

  8. Discovery of VHE Gamma Rays from PKS 2005-489

    CERN Document Server

    Aharonian, F; Aye, K M; Bazer-Bachi, A R; Beilicke, M; Benbow, W; Berge, D; Berghaus, P; Bernlöhr, K; Boisson, C; Bolz, O; Braun, I; Breitling, F; Brown, A M; Bussons-Gordo, J; Chadwick, P M; Chounet, L M; Cornils, R; Costamante, L; Degrange, B; Djannati-Ata, A; O'Connor-Drury, L; Dubus, G; Emmanoulopoulos, D; Espigat, P; Feinstein, F; Fleury, P; Fontaine, G; Fuchs, Y; Funk, S; Gallant, Y A; Giebels, B; Gillessen, S; Glicenstein, J F; Goret, P; Hadjichristidis, C; Hauser, M; Heinzelmann, G; Henri, G; Hermann, G; Hinton, J A; Hofmann, W; Holleran, M; Horns, D; De Jager, O C; Khelifi, B; Komin, Nu; Konopelko, A; Latham, I J; Le Gallou, R; Lemiere, A; Lemoine-Goumard, M; Leroy, N; Lohse, T; Martineau-Huynh, O; Marcowith, A; Masterson, C; McComb, T J L; De Naurois, Mathieu; Nolan, S J; Noutsos, A; Orford, K J; Osborne, J L; Ouchrif, M; Panter, M; Pelletier, G; Pita, S; Pühlhofer, G; Punch, M; Raubenheimer, B C; Raue, M; Raux, J; Rayner, S M; Redondo, I; Reimer, A; Reimer, O; Ripken, J; Rob, L; Rolland, L; Rowell, G; Sahakian, V V; Sauge, L; Schlenker, S; Schlickeiser, R; Schuster, C; Schwanke, U; Siewert, M; Sol, H; Steenkamp, R; Stegmann, C; Tavernet, J P; Terrier, R; Theoret, C G; Tluczykont, M; Vasileiadis, G; Venter, C; Vincent, P; Völk, H J; Wagner, S J

    2005-01-01

    The high-frequency peaked BL Lac PKS 2005-489 (z=0.071) was observed in 2003 and 2004 with the H.E.S.S. stereoscopic array of imaging atmospheric-Cherenkov telescopes in Namibia. A signal was detected at the 6.7 sigma level in the 2004 observations (24.2 hrs live time), but not in the 2003 data set (27.3 hrs live time). PKS 2005-489 is the first blazar independently discovered by H.E.S.S. to be an emitter of VHE photons, and only the second such blazar in the Southern Hemisphere. The integral flux above 200 GeV observed in 2004 is (6.9 +/- 1.0 +/- 1.4) x 10$^{-12}$ cm$^{-2}$ s$^{-1}$, corresponding to ~2.5% of the flux observed from the Crab Nebula. The 99% upper limit on the flux in 2003, I(>200 GeV) < 5.2 x 10$^{-12}$ cm$^{-2}$ s$^{-1}$, is smaller than the flux measured in 2004, suggesting an increased level of activity in 2004. However, the data show no evidence for significant variability on any time scale less than a year. An energy spectrum is measured and is characterized by a very soft power law (...

  9. Pulsed VHE emission from the Crab Pulsar in the context of magnetocentrifugal particle acceleration

    CERN Document Server

    Osmanov, Z

    2016-01-01

    The Crab Pulsar has been recently detected at very high energies (VHE) with its pulsed VHE emission reaching up to $1.5$ TeV. The VHE peaks appear synchronised with the peaks at GeV energies and show VHE spectra following hard power-law functions. These new findings have been interpreted as evidence for a gamma-ray production that happens very close to the light cylinder. Motivated by these experimental results we consider the efficiency of magnetocentrifugal particle acceleration in the magnetosphere of the Crab Pulsar, reexamining and extending results obtained in a previous work (Osmanov & Rieger 2009). It is shown that efficient magnetocentrifugal acceleration close to the light cylinder could provide the required electron Lorentz factors of $5\\times 10^6$ and that the resulting inverse Compton (IC) scattering off thermal photons might explain the enigmatic TeV emission of the pulsar. We estimate the corresponding VHE luminosity and provide a derivation of its spectral characteristics, that appear rem...

  10. Portable generator-based X RF instrument for non-destructive analysis at crime scenes

    Energy Technology Data Exchange (ETDEWEB)

    Schweitzer, Jeffrey S. [University of Connecticut, Department of Physics, Unit 3046 Storrs, CT 06269-3046 (United States)]. E-mail: schweitz@phys.uconn.edu; Trombka, Jacob I. [Goddard Space Flight Center, Code 691, Greenbelt Road, Greenbelt, MD 20771 (United States); Floyd, Samuel [Goddard Space Flight Center, Code 691, Greenbelt Road, Greenbelt, MD 20771 (United States); Selavka, Carl [Massachusetts State Police Crime Laboratory, 59 Horse Pond Road, Sudbury, MA 01776 (United States); Zeosky, Gerald [Forensic Investigation Center, Crime Laboratory Building, 22 State Campus, Albany, NY 12226 (United States); Gahn, Norman [Assistant District Attorney, Milwaukee County, District Attorney' s Office, 821 West State Street, Milwaukee, WI 53233-1427 (United States); McClanahan, Timothy [Goddard Space Flight Center, Code 691, Greenbelt Road, Greenbelt, MD 20771 (United States); Burbine, Thomas [Goddard Space Flight Center, Code 691, Greenbelt Road, Greenbelt, MD 20771 (United States)

    2005-12-15

    Unattended and remote detection systems find applications in space exploration, telemedicine, teleforensics, homeland security and nuclear non-proliferation programs. The National Institute of Justice (NIJ) and the National Aeronautics and Space Administration's (NASA) Goddard Space Flight Center (GSFC) have teamed up to explore the use of NASA developed technologies to help criminal justice agencies and professionals investigate crimes. The objective of the program is to produce instruments and communication networks that have application within both NASA's space program and NIJ, together with state and local forensic laboratories. A general-purpose X-ray fluorescence system has been built for non-destructive analyses of trace and invisible material at crime scenes. This portable instrument is based on a generator that can operate to 60 kV and a Schottky CdTe detector. The instrument has been shown to be successful for the analysis of gunshot residue and a number of bodily fluids at crime scenes.

  11. 2WHSP: A multi-frequency selected catalog of VHE gamma-ray blazars and blazar candidates

    Science.gov (United States)

    Chang, Yu Lin; Arsioli, Bruno; Giommi, Paolo; Padovani, Paolo

    2016-08-01

    High Synchrotron Peaked Blazars (HSPs) are extremely important for VHE astronomy. We built the largest existing catalog of High Synchrotron Blazars (2WHSP) based on multi-frequency data. The catalog is an extension of the 1WHSP list. We compared several general properties of HSPs such as the synchrotron peak, the redshift and IR the color-color diagram. We also built the logN-logS for the sources, trying to see the evolution and the deficiency of the catalog. The catalog will provide a unique sample of targets for VHE observations in future since the HSPs are the dominant extra-Galactic sources in VHE sky. This might help find more VHE sources later. In the future, we will use this catalog to estimate other VHE properties of HSPs.

  12. Discovery and follow-up studies of the extended, off-plane, VHE gamma-ray source HESS J1507-622

    Science.gov (United States)

    H.E.S.S. Collaboration; Acero, F.; Aharonian, F.; Akhperjanian, A. G.; Anton, G.; Barres de Almeida, U.; Bazer-Bachi, A. R.; Becherini, Y.; Behera, B.; Bernlöhr, K.; Bochow, A.; Boisson, C.; Bolmont, J.; Borrel, V.; Brucker, J.; Brun, F.; Brun, P.; Bühler, R.; Bulik, T.; Büsching, I.; Boutelier, T.; Chadwick, P. M.; Charbonnier, A.; Chaves, R. C. G.; Cheesebrough, A.; Chounet, L.-M.; Clapson, A. C.; Coignet, G.; Dalton, M.; Daniel, M. K.; Davids, I. D.; Degrange, B.; Deil, C.; Dickinson, H. J.; Djannati-Ataï, A.; Domainko, W.; Drury, L. O'C.; Dubois, F.; Dubus, G.; Dyks, J.; Dyrda, M.; Egberts, K.; Emmanoulopoulos, D.; Espigat, P.; Farnier, C.; Feinstein, F.; Fiasson, A.; Förster, A.; Fontaine, G.; Füßling, M.; Gabici, S.; Gallant, Y. A.; Gérard, L.; Gerbig, D.; Giebels, B.; Glicenstein, J. F.; Glück, B.; Goret, P.; Göring, D.; Hauser, D.; Hauser, M.; Heinz, S.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hoffmann, A.; Hofmann, W.; Holleran, M.; Hoppe, S.; Horns, D.; Jacholkowska, A.; de Jager, O. C.; Jahn, C.; Jung, I.; Katarzyński, K.; Katz, U.; Kaufmann, S.; Kerschhaggl, M.; Khangulyan, D.; Khélifi, B.; Keogh, D.; Klochkov, D.; Kluźniak, W.; Kneiske, T.; Komin, Nu.; Kosack, K.; Kossakowski, R.; Lamanna, G.; Lenain, J.-P.; Lohse, T.; Marandon, V.; Martineau-Huynh, O.; Marcowith, A.; Masbou, J.; Maurin, D.; McComb, T. J. L.; Medina, M. C.; Méhault, J.; Moderski, R.; Moulin, E.; Naumann-Godo, M.; de Naurois, M.; Nedbal, D.; Nekrassov, D.; Nicholas, B.; Niemiec, J.; Nolan, S. J.; Ohm, S.; Olive, J.-F.; de Oña Wilhelmi, E.; Orford, K. J.; Ostrowski, M.; Panter, M.; Paz Arribas, M.; Pedaletti, G.; Pelletier, G.; Petrucci, P.-O.; Pita, S.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raubenheimer, B. C.; Raue, M.; Rayner, S. M.; Reimer, O.; Renaud, M.; Rieger, F.; Ripken, J.; Rob, L.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Ruppel, J.; Sahakian, V.; Santangelo, A.; Schlickeiser, R.; Schöck, F. M.; Schwanke, U.; Schwarzburg, S.; Schwemmer, S.; Shalchi, A.; Sikora, M.; Skilton, J. L.; Sol, H.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Superina, G.; Szostek, A.; Tam, P. H.; Tavernet, J.-P.; Terrier, R.; Tibolla, O.; Tluczykont, M.; van Eldik, C.; Vasileiadis, G.; Venter, C.; Venter, L.; Vialle, J. P.; Vincent, P.; Vivier, M.; Völk, H. J.; Volpe, F.; Wagner, S. J.; Ward, M.; Zdziarski, A. A.; Zech, A.; H.E.S.S. Collaboration

    2011-01-01

    Context. The detection of gamma-rays in the very-high-energy (VHE) range (100 GeV-100 TeV) offers the possibility of studying the parent population of ultrarelativistic particles found in astrophysical sources, so it is useful for understanding the underlying astrophysical processes in nonthermal sources. Aims: The discovery of the VHE gamma-ray source HESS J1507-622 is reported and possibilities regarding its nature are investigated. Methods: The H.E.S.S. array of imaging atmospheric Cherenkov telescopes (IACTs) has a high sensitivity compared with previous instruments (~1% of the Crab flux in 25 h observation time for a 5σ point-source detection) and has a large field of view (~5° in diameter). HESS J1507-622 was discovered within the ongoing H.E.S.S. survey of the inner Galaxy, and the source was also studied by means of dedicated multiwavelength observations. Results: A Galactic gamma-ray source, HESS J1507-622, located ~3.5° from the Galactic plane was detected with a statistical significance >9σ. Its energy spectrum is well fitted by a power law with spectral index Γ = 2.24 ± 0.16_stat ± 0.20_sys and a flux above 1 TeV of (1.5 ± 0.4_stat ± 0.3_sys) × 10-12 cm-2 s-1. Possible interpretations (considering both hadronic and leptonic models) of the VHE gamma-ray emission are discussed in the absence of an obvious counterpart.

  13. Optical depth for VHE gamma-rays from distant sources from a generic EBL density

    OpenAIRE

    Raue, M.; Mazin, D.

    2008-01-01

    Very-high-energy (VHE; E>100GeV) gamma-rays from distant sources suffer attenuation through pair-production with low energy photons from the diffuse extragalactic photon fields in the ultraviolet (UV) to far-infrared (FIR) (commonly referred to as Extragalactic Background Light; EBL). When modeling the intrinsic spectra of the VHE gamma-ray sources it is crucial to correctly account for the attenuation. Unfortunately, direct measurements of the EBL are difficult and the knowledge about the EB...

  14. Development of a Low Cost Telescope System for VHE Astronomy

    Science.gov (United States)

    Querrard, Rodney; Perkins, Jeremy S.

    2017-01-01

    Ground based gamma-ray astronomy has progressed dramatically over the past 40 years. Currently there are 176 confirmed sources detected above 100 GeV ranging from Supernova Remnants (SNR) to Active Galaxies and other objects The next generation of Imaging Air Cherenkov Telescopes (IACT) is currently being developed. The CTA, or Cherenkov Telescope Array, will be a ground-breaking facility made up of a few dozen telescopes of multiple sizes with a sensitivity an order of magnitude greater than the current generation. Nevertheless, an opportunity will remain for smaller, less-expensive instruments to make important contributions to the field of Cherenkov Imaging astronomy.We are investigating an approach that will use an inexpensive array of ground based telescopes built from commercial-off-the-shelf (COTS) products. This array will be capable of studying supernova remnants, gamma-ray-burst afterglows, and active galactic nuclei as well as other sources above 2 TeV at a cost which is much lower than larger facilities like the CTA. We are developing a single prototype telescope that will be installed at the Goddard Geophysical and Astronomical Observatory in Greenbelt, MD. We discuss issues arising from and technical solutions to challenges of using COTS components whose primary purpose is not astronomy for this application. We detail progress in the telescope development and outline future work to complete the prototype and to duplicate it for creation of a low-cost Cherenkov array.

  15. Light-Trap: a SiPM upgrade for VHE astronomy and beyond

    Science.gov (United States)

    Ward, J. E.; Cortina, J.; Guberman, D.

    2016-11-01

    Ground-based gamma-ray astronomy in the Very High Energy (VHE, E > 100 GeV) regime has fast become one of the most interesting and productive sub-fields of astrophysics today. Utilizing the Imaging Atmospheric Cherenkov Technique (IACT) to reconstruct the energy and direction of incoming gamma-ray photons from the universe, several source-classes have been revealed by previous and current generations of IACT telescopes (e.g. Whipple, MAGIC, HESS and VERITAS). The next generation pointing IACT experiment, the Cherenkov Telescope Array (CTA), will provide increased sensitivity across a wider energy range and with better angular resolution. With the development of CTA, the future of IACT pointing arrays is being directed towards having more and more telescopes (and hence cameras), and therefore the need to develop low-cost pixels with acceptable light-collection efficiency is clear. One of the primary paths to the above goal is to replace Photomultiplier Tubes (PMTs) with Silicon-PMs (SiPMs) as the pixels in IACT telescope cameras. However SiPMs are not yet mature enough to replace PMTs for several reasons: sensitivity to unwanted longer wavelengths while lacking sensitivity at short wavelengths, small physical area, high cost, optical cross-talk and dark rates. Here we propose a novel method to build relatively low-cost SiPM-based pixels utilising a disk of wavelength-shifting material, which overcomes some of these drawbacks by collecting light over a larger area than standard SiPMs and improving sensitivity to shorter wavelengths while reducing background. We aim to optimise the design of such pixels, integrating them into an actual 7-pixel cluster which will be inserted into a MAGIC camera and tested during real observations. Results of simulations, laboratory measurements and the current status of the cluster design and development will be presented.

  16. ESPRESSO instrument control electronics: a PLC based distributed layout for a second generation instrument at ESO VLT

    Science.gov (United States)

    Baldini, V.; Cirami, R.; Coretti, I.; Cristiani, S.; Di Marcantonio, P.; Mannetta, M.; Santin, P.; Mégevand, D.; Zerbi, F.

    2014-07-01

    ESPRESSO is an ultra-stable fiber-fed spectrograph designed to combine incoherently the light coming from up to 4 Unit Telescopes of the ESO VLT. From the Nasmyth focus of each telescope the light, through an optical path, is fed by the Coudé Train subsystems to the Front End Unit placed in the Combined Coudé Laboratory. The Front End is composed by one arm for each telescope and its task is to convey the incoming light, after a calibration process, into the spectrograph fibers. To perform these operations a large number of functions are foreseen, like motorized stages, lamps, digital and analog sensors that, coupled with dedicated Technical CCDs (two per arms), allow to stabilize the incoming beam up to the level needed to exploit the ESPRESSO scientific requirements. The Instrument Control Electronics goal is to properly control all the functions in the Combined Coudé Laboratory and the spectrograph itself. It is fully based on a distributed PLC architecture, abandoning in this way the VME-based technology previously adopted for the ESO VLT instruments. In this paper we will describe the ESPRESSO Instrument Control Electronics architecture, focusing on the distributed layout and its interfaces with the other ESPRESSO subsystems.

  17. Development and optimization of new generation Start-Up Instrumentation systems (SUI) for domestic CANDU reactors

    Science.gov (United States)

    Nasimi, Elnara

    Due to the age and operating experience of Bruce Power units, equipment ageing and obsolescence has become one of the main challenges that need to be resolved for all systems, structures and components in order to ensure a safe and reliable production of energy. The research objectives of this thesis will focus on methodology for modernization of Start-Up Instrumentation (SUI), both in-core and Control Room equipment, using a new generation of detectors and cables in order to manage obsolescence. The main objective of this thesis is to develop a new systematic approach to SUI installation/replacement procedure development and optimization. Although some additional features, such as real-time data monitoring and storage/archiving solutions for SUI systems are also examined to take full advantage of today's digital technology, the objective of this thesis does not include detailed parametrical studies of detector or system performance. Instead, a number of technological, operational and maintenance issues associated with Start-Up Instrumentation systems at Bruce Power will be identified in this project and a structured approach to developing a replacement/installation procedure that can be standardized and used across all of the domestic CANDU stations is proposed. Finally, benefits of Hierarchical Control Chart (HCC) methodology for all stages of plant life management, such as system design, development, operation and maintenance are demonstrated. Keywords: Task Breakdown and Analysis methodology, installation/removal procedure development and optimization, risk-based analysis and optimization, Hierarchical Control Chart (HCC) methodology for system maintenance and troubleshooting, Start-Up Instrumentation (SUI), Ion Chambers, Fission Chambers, proportional counters, Shutdown System 1 (SDS1), Shutdown System 2 (SDS2).

  18. Novel multi-telescopes beam combiners for next generation instruments (FIRST/SUBARU)

    Science.gov (United States)

    Martin, G.; Pugnat, T.; Gardillou, F.; Cassagnettes, C.; Barbier, D.; Guyot, C.; Hauden, J.; Huby, E.; Lacour, S.

    2016-07-01

    Integrated optic devices are nowadays achieving extremely good performances in the field of astronomical interferometry, as shown by PIONIER or GRAVITY silica/silicon-based instruments, already installed at VLTI. In order to address other wavelengths, increase the number of apertures to be combined and eventually ensure on-chip phase modulation, we are working on a novel generation of beam combiners, based on the hybridization of glass waveguides, that can ensure very sharp bend radius, high confinement and low propagation losses, together with lithium niobate phase modulators and channel waveguides that can achieve on-chip, fast (different issues of the combiners, such as transmission, birefringence, half-wave voltage modulation and spectral range.

  19. The role of VHE muons in an explanation of unusual events observed in cosmic rays

    NARCIS (Netherlands)

    Bogdanov, AG; Petrukhin, AA; Shalabaeva, AV

    2005-01-01

    Unusual events observed in cosmic-ray experiments that cannot be explained in the context of modern theories and models are considered. The peculiarities of VHE (>= 100 TeV) muon interactions and their possible contribution to the production of various unusual events in cosmic rays are analyzed. Som

  20. MAGIC discovery of VHE Emission from the FSRQ PKS 1222+21

    CERN Document Server

    Aleksić, J; Antoranz, P; Backes, M; Barrio, J; Bastieri, D; González, J Becerra; Bednarek, W; Berdyugin, A; Berger, K; Bernardini, E; Biland, A; Blanch, O; Bock, R; Boller, A; Bonnoli, G; Tridon, D Borla; Braun, I; Bretz, Dr Thomas; Cañellas, A; Carmona, E; Carosi, A; Colin, P; Colombo, E; Contreras, J; Cortina, J; Cossio, L; Covino, S; Dazzi, F; De Angelis, A; del Pozo, E De Cea; De Lotto, Dr Barbara; Mendez, Dr Carlos Delgado; Ortega, A Diago; Doert, M; Domìnguez, A; Prester, D Dominis; Dorner, D; Doro, M; Elsaesser, D; Ferenc, D; Fonseca, M; Font, L; Fruck, C; Lòpez, R Garcìa; Garczarczyk, M; Garrido, D; Giavitto, G; Godinović, N; Hadasch, D; Häfner, D; Herrero, A; Hildebrand, D; Höhne-Mönch, D; Hose, J; Hrupec, D; Huber, B; Jogler, T; Klepser, S; Krahenbuhl, T; Krause, J; La Barbera, A; Lelas, D; Leonardo, E; Lindfors, E; Lombardi, S; López, M; Lorenz, E; Makariev, M; Maneva, G; Mankuzhiyil, N; Mannheim, K; Maraschi, L; Mariotti, M; Martínez, M; Mazin, Dr Daniel; Meucci, M; Miranda, J; Mirzoyan, R; Miyamoto, H; Moldón, Mr Javier; Moralejo, A; Nieto, D; Nilsson, Dr Kari; Orito, R; Oya, I; Paneque, D; Paoletti, R; Pardo, S; Paredes, J; Partini, S; Pasanen, M; Pauss, F; Perez-Torres, M; Persic, Dr Massimo; Peruzzo, L; Pilia, M; Pochon, J; Prada, F; Moroni, Dr P G Prada; Prandini, E; Puljak, I; Reichardt, I; Reinthal, R; Rhode, W; Ribó, Marc; Rico, Dr Javier; Rügamer, S; Saggion, A; Saito, Mr Koji; Saito, T; Salvati, M; Satalecka, K; Scalzotto, V; Scapin, V; Schultz, C; Schweizer, T; Shayduk, M; Shore, S; Sillanpää, A; Sitarek, J; Sobczynska, D; Spanier, F; Spiro, S; Stamerra, A; Steinke, B; Storz, J; Strah, N; Surić, T; Takalo, L; Tavecchio, F; Temnikov, P; Terzić, T; Tescaro, D; Teshima, M; Thom, M; Tibolla, O; Perez-Torres, Dr Miguel-Angel; Treves, A; Vankov, H; Vogler, P; Wagner, R; Weitzel, Q; Zabalza, V; Zandanel, F; Zanin, R; Tanaka, Y; Wood, D; Buson, S

    2011-01-01

    Very High Energy (VHE) {\\gamma}-ray emission from the flat spectrum radio quasar PKS 1222+21 (4C 21.35, z=0.432) was detected with the MAGIC Cherenkov telescopes during a short observation ({\\approx}0.5 h) performed on 2010 June 17. The MAGIC detection coincides with high energy MeV/GeV {\\gamma}-ray activity measured by the Large Area Telescope (LAT) on board the Fermi satellite. The VHE spectrum measured by MAGIC extends from about 70 GeV up to at least 400 GeV and can be well described by a power law dN/dE \\propto E^-{\\Gamma} with a photon index {\\Gamma}= 3.75+/-0.27stat +/-0.2syst. The averaged integral flux above 100 GeV is (4.56+/-0.46){\\times} 10^(-10) cm^-2 s^-1. The VHE flux measured by MAGIC varies significantly within the 30 min exposure implying a flux doubling time of about 10 min. The absence of a spectral cutoff constrains the {\\gamma}-ray emission region outside the Broad Line Region, which would otherwise absorb the VHE {\\gamma}-rays. Together with the detected fast variability, this challenge...

  1. First detection of VHE gamma-rays from SN 1006 by H.E.S.S

    CERN Document Server

    Acero, F; Akhperjanian, A G; Anton, G; de Almeida, U Barres; Bazer-Bachi, A R; Becherini, Y; Behera, B; Beilicke, M; Bernlöhr, K; Bochow, A; Boisson, C; Bolmont, J; Borrel, V; Brucker, J; Brun, F; Brun, P; Bühler, R; Bulik, T; Büsching, I; Boutelier, T; Chadwick, P M; Charbonnier, A; Chaves, R C G; Cheesebrough, A; Conrad, J; Chounet, L -M; Clapson, A C; Coignet, G; Dalton, M; Daniel, M K; Davids, I D; Degrange, B; Deil, C; Dickinson, H J; Djannati-Ataï, A; Domainko, W; Drury, L O'C; Dubois, F; Dubus, G; Dyks, J; Dyrda, M; Egberts, K; Eger, P; Espigat, P; Fallon, L; Farnier, C; Fegan, S; Feinstein, F; Fiasson, A; Förster, A; Fontaine, G; Füßling, M; Gabici, S; Gallant, Y A; Gérard, L; Gerbig, D; Giebels, B; Glicenstein, J F; Glück, B; Goret, P; Göring, D; Hauser, D; Hauser, M; Heinz, S; Heinzelmann, G; Henri, G; Hermann, G; Hinton, J A; Hoffmann, A; Hofmann, W; Hofverberg, P; Holleran, M; Hoppe, S; Horns, D; Jacholkowska, A; de Jager, O C; Jahn, C; Jung, I; Katarzy'nski, K; Katz, U; Kaufmann, S; Kerschhaggl, M; Khangulyan, D; Khélifi, B; Keogh, D; Klochkov, D; Klu'zniak, W; Kneiske, T; Komin, Nu; Kosack, K; Kossakowski, R; Lamanna, G; Lemoine-Goumard, M; Lenain, J -P; Lohse, T; Marandon, V; Marcowith, A; Masbou, J; Maurin, D; McComb, T J L; Medina, M C; Méhault, J; Moulin, E; Naumann-Godo, M; de Naurois, M; Nedbal, D; Nekrassov, D; Nicholas, B; Niemiec, J; Nolan, S J; Ohm, S; Olive, J-F; Orford, E de Ona Wilhelmi K J; Ostrowski, M; Panter, M; Pedaletti, M Paz Arribas G; Pelletier, G; Petrucci, P -O; Pita, S; Pühlhofer, 12 G; Punch, M; Quirrenbach, A; Raubenheimer, B C; Raue, M; Rayner, S M; Reimer, O; Renaud, M; Reyes, R de los; Rieger, F; Ripken, J; Rob, L; Rosier-Lees, S; Rowell, G; Rudak, B; Rulten, C B; Ruppel, J; Ryde, F; Sahakian, V; Santangelo, A; Schlickeiser, R; Schöck, F M; Schönwald, A; Schwanke, U; Schwarzburg, S; Schwemmer, S; Shalchi, A; Sushch, I; Sikora, M; Skilton, J L; Sol, H; Stawarz, Ł; Steenkamp, R; Stegmann, C; Stinzing, F; Superina, G; Szostek, A; Tam, P H; Tavernet, J -P; Terrier, R; Tibolla, O; Tluczykont, M; van Eldik, C; Vasileiadis, G; Venter, C; Venter, L; Vialle, J P; Vincent, P; Vink, J; Vivier, M; Völk, H J; Volpe, F; Vorobiov, S; Wagner, S J; Ward, M; Zdziarski, A A; Zech, A

    2010-01-01

    Recent theoretical predictions of the lowest very high energy (VHE) luminosity of SN 1006 are only a factor 5 below the previously published H.E.S.S. upper limit, thus motivating further in-depth observations of this source. Deep observations at VHE energies (above 100 GeV) were carried out with the High Energy Stereoscopic System (H.E.S.S.) of Cherenkov Telescopes from 2003 to 2008. More than 100 hours of data have been collected and subjected to an improved analysis procedure. Observations resulted in the detection of VHE gamma-rays from SN 1006. The measured gamma-ray spectrum is compatible with a power-law, the flux is of the order of 1% of that detected from the Crab Nebula, and is thus consistent with the previously established H.E.S.S. upper limit. The source exhibits a bipolar morphology, which is strongly correlated with non-thermal X-rays. Because the thickness of the VHE-shell is compatible with emission from a thin rim, particle acceleration in shock waves is likely to be the origin of the gamma-r...

  2. First detection of VHE γ-rays from SN 1006 by HESS

    Science.gov (United States)

    Acero, F.; Aharonian, F.; Akhperjanian, A. G.; Anton, G.; Barres de Almeida, U.; Bazer-Bachi, A. R.; Becherini, Y.; Behera, B.; Beilicke, M.; Bernlöhr, K.; Bochow, A.; Boisson, C.; Bolmont, J.; Borrel, V.; Brucker, J.; Brun, F.; Brun, P.; Bühler, R.; Bulik, T.; Büsching, I.; Boutelier, T.; Chadwick, P. M.; Charbonnier, A.; Chaves, R. C. G.; Cheesebrough, A.; Conrad, J.; Chounet, L.-M.; Clapson, A. C.; Coignet, G.; Dalton, M.; Daniel, M. K.; Davids, I. D.; Degrange, B.; Deil, C.; Dickinson, H. J.; Djannati-Ataï, A.; Domainko, W.; O'C. Drury, L.; Dubois, F.; Dubus, G.; Dyks, J.; Dyrda, M.; Egberts, K.; Eger, P.; Espigat, P.; Fallon, L.; Farnier, C.; Fegan, S.; Feinstein, F.; Fiasson, A.; Förster, A.; Fontaine, G.; Füßling, M.; Gabici, S.; Gallant, Y. A.; Gérard, L.; Gerbig, D.; Giebels, B.; Glicenstein, J. F.; Glück, B.; Goret, P.; Göring, D.; Hauser, D.; Hauser, M.; Heinz, S.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hoffmann, A.; Hofmann, W.; Hofverberg, P.; Holleran, M.; Hoppe, S.; Horns, D.; Jacholkowska, A.; de Jager, O. C.; Jahn, C.; Jung, I.; Katarzyński, K.; Katz, U.; Kaufmann, S.; Kerschhaggl, M.; Khangulyan, D.; Khélifi, B.; Keogh, D.; Klochkov, D.; Kluźniak, W.; Kneiske, T.; Komin, Nu.; Kosack, K.; Kossakowski, R.; Lamanna, G.; Lemoine-Goumard, M.; Lenain, J.-P.; Lohse, T.; Marandon, V.; Marcowith, A.; Masbou, J.; Maurin, D.; McComb, T. J. L.; Medina, M. C.; Méhault, J.; Moderski, R.; Moulin, E.; Naumann-Godo, M.; de Naurois, M.; Nedbal, D.; Nekrassov, D.; Nicholas, B.; Niemiec, J.; Nolan, S. J.; Ohm, S.; Olive, J.-F.; de Oña Wilhelmi, E.; Orford, K. J.; Ostrowski, M.; Panter, M.; Paz Arribas, M.; Pedaletti, G.; Pelletier, G.; Petrucci, P.-O.; Pita, S.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raubenheimer, B. C.; Raue, M.; Rayner, S. M.; Reimer, O.; Renaud, M.; de Los Reyes, R.; Rieger, F.; Ripken, J.; Rob, L.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Ruppel, J.; Ryde, F.; Sahakian, V.; Santangelo, A.; Schlickeiser, R.; Schöck, F. M.; Schönwald, A.; Schwanke, U.; Schwarzburg, S.; Schwemmer, S.; Shalchi, A.; Sushch, I.; Sikora, M.; Skilton, J. L.; Sol, H.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Superina, G.; Szostek, A.; Tam, P. H.; Tavernet, J.-P.; Terrier, R.; Tibolla, O.; Tluczykont, M.; van Eldik, C.; Vasileiadis, G.; Venter, C.; Venter, L.; Vialle, J. P.; Vincent, P.; Vink, J.; Vivier, M.; Völk, H. J.; Volpe, F.; Vorobiov, S.; Wagner, S. J.; Ward, M.; Zdziarski, A. A.; Zech, A.; H.E.S.S. Collaboration

    2010-06-01

    Aims: Recent theoretical predictions of the lowest very high energy (VHE) luminosity of SN 1006 are only a factor 5 below the previously published HESS upper limit, thus motivating further in-depth observations of this source. Methods: Deep observations at VHE energies (above 100 GeV) were carried out with the high energy stereoscopic system (HESS) of Cherenkov Telescopes from 2003 to 2008. More than 100 h of data have been collected and subjected to an improved analysis procedure. Results: Observations resulted in the detection of VHE γ-rays from SN 1006. The measured γ-ray spectrum is compatible with a power-law, the flux is of the order of 1% of that detected from the Crab Nebula, and is thus consistent with the previously established HESS upper limit. The source exhibits a bipolar morphology, which is strongly correlated with non-thermal X-rays. Conclusions: Because the thickness of the VHE-shell is compatible with emission from a thin rim, particle acceleration in shock waves is likely to be the origin of the γ-ray signal. The measured flux level can be accounted for by inverse Compton emission, but a mixed scenario that includes leptonic and hadronic components and takes into account the ambient matter density inferred from observations also leads to a satisfactory description of the multi-wavelength spectrum.

  3. Discovery of the Hard Spectrum VHE γ-Ray Source HESS J1641-463

    NARCIS (Netherlands)

    Abramowski, A.; et al., [Unknown; Balzer, A.; Berge, D.; Bryan, M.; Salek, D.; Vink, J.

    2014-01-01

    This Letter reports the discovery of a remarkably hard spectrum source, HESS J1641-463, by the High Energy Stereoscopic System (H.E.S.S.) in the very high energy (VHE) domain. HESS J1641-463 remained unnoticed by the usual analysis techniques due to confusion with the bright nearby source HESS J1640

  4. VHE gamma-ray Emitting Pulsar Wind Nebulae Discovered by H.E.S.S.

    Energy Technology Data Exchange (ETDEWEB)

    Gallant, Y.A.; /Montpellier U.; Carrigan, S.; /Heidelberg, Max Planck Inst.; Djannati-Atai, A.; /APC, Paris; Funk, S.; /KIPAC, Menlo Park; Hinton, J.A.; /Leeds U.; Hoppe, S.; /Heidelberg, Max Planck Inst.; de Jager, O.C.; /Potchefstroom U.; Khelifi, B.; /Ecole Polytechnique; Komin, Nu.; /Montpellier U.; Kosack, K.; /Heidelberg, Max Planck Inst.; Lemiere, A. /APC, Paris; Masterson, C.; /Dublin Inst.

    2008-06-05

    Recent advances in very-high-energy (VHE) gamma-ray astronomy have opened a new observational window on the physics of pulsars. The high sensitivity of current imaging atmospheric Cherenkov telescopes, and in particular of the H.E.S.S. array, has already led to the discovery of about a dozen VHE-emitting pulsar wind nebulae (PWNe) and PWN candidates. These include the plerions in the composite supernova remnants MSH 15-52, G21.5-0.9, Kes 75, and Vela, two sources in the Kookaburra, and the nebula of PSR B1823-13. This VHE emission is generally interpreted as inverse Compton emission from the relativistic electrons and positrons accelerated by the pulsar and its wind; as such, it can yield a more direct spatial and spectral view of the accelerated particles than can be inferred from observations of their synchrotron emission. The VHE-emitting PWNe detected by the H.E.S.S. telescopes are reviewed and the implications for pulsar physics discussed.

  5. Probing the origin of VHE emission from M 87 with MWL observations in 2010

    CERN Document Server

    Raue, Martin; Mazin, Daniel; Colin, Pierre; Hui, Michelle; Beilicke, Matthias; Walker, Craig; MAGIC,; VERITAS,

    2012-01-01

    The large majority of extragalactic very high energy (VHE; E>100 GeV) sources belongs to the class of active galactic nuclei (AGN), in particular the BL Lac sub-class. AGNs are characterized by an extremely bright and compact emission region, powered by a super-massive black hole (SMBH) and an accretion disk, and relativistic outflows (jets) detected all across the electro-magnetic spectrum. In BL Lac sources the jet axis is oriented close to the line of sight, giving rise to a relativistic boosting of the emission. In radio galaxies, on the other hand, the jet makes a larger angle to the line of sight allowing to resolve the central core and the jet in great details. The giant radio galaxy M 87 with its proximity (1 6Mpc) and its very massive black hole ((3-6) x 10^9 M_solar) provides a unique laboratory to investigate VHE emission in such objects and thereby probe particle acceleration to relativistic energies near SMBH and in jets. M 87 has been established as a VHE emitter since 2005. The VHE emission dis...

  6. Multiwavelength observations of a VHE gamma-ray flare from PKS 1510-089 in 2015

    CERN Document Server

    Ahnen, M L; Antonelli, L A; Arcaro, C; Babić, A; Banerjee, B; Bangale, P; de Almeida, U Barres; Barrio, J A; González, J Becerra; Bednarek, W; Bernardini, E; Berti, A; Biasuzzi, B; Biland, A; Blanch, O; Bonnefoy, S; Bonnoli, G; Borracci, F; Bretz, T; Carosi, R; Carosi, A; Chatterjee, A; Colin, P; Colombo, E; Contreras, J L; Cortina, J; Covino, S; Cumani, P; Da Vela, P; Dazzi, F; De Angelis, A; De Lotto, B; Wilhelmi, E de Oña; Di Pierro, F; Doert, M; Domínguez, A; Prester, D Dominis; Dorner, D; Doro, M; Einecke, S; Glawion, D Eisenacher; Elsaesser, D; Engelkemeier, M; Ramazani, V Fallah; Fernández-Barral, A; Fidalgo, D; Fonseca, M V; Font, L; Fruck, C; Galindo, D; López, R J García; Garczarczyk, M; Gaug, M; Giammaria, P; Godinović, N; Gora, D; Guberman, D; Hadasch, D; Hahn, A; Hassan, T; Hayashida, M; Herrera, J; Hose, J; Hrupec, D; Hughes, G; Ishio, K; Konno, Y; Kubo, H; Kushida, J; Kuveždić, D; Lelas, D; Lindfors, E; Lombardi, S; Longo, F; López, M; Majumdar, P; Makariev, M; Maneva, G; Manganaro, M; Mannheim, K; Maraschi, L; Mariotti, M; Martínez, M; Mazin, D; Menzel, U; Mirzoyan, R; Moralejo, A; Moretti, E; Nakajima, D; Neustroev, V; Niedzwiecki, A; Rosillo, M Nievas; Nilsson, K; Nishijima, K; Noda, K; Nogués, L; Paiano, S; Palacio, J; Palatiello, M; Paneque, D; Paoletti, R; Paredes, J M; Paredes-Fortuny, X; Pedaletti, G; Peresano, M; Perri, L; Persic, M; Poutanen, J; Moroni, P G Prada; Prandini, E; Puljak, I; Garcia, J R; Reichardt, I; Rhode, W; Ribó, M; Rico, J; Saito, T; Satalecka, K; Schroeder, S; Schweizer, T; Shore, S N; Sillanpää, A; Sitarek, J; Šnidarić, I; Sobczynska, D; Stamerra, A; Strzys, M; Surić, T; Takalo, L; Tavecchio, F; Temnikov, P; Terzić, T; Tescaro, D; Teshima, M; Torres, D F; Torres-Albà, N; Toyama, T; Treves, A; Vanzo, G; Acosta, M Vazquez; Vovk, I; Ward, J E; Will, M; Wu, M H; Zarić, D; Desiante, R; González, J Becerra; D'Ammando, F; Larsson, S; Raiteri, C M; Reinthal, R; Lähteenmäki, A; Järvelä, E; Tornikoski, M; Ramakrishnan, V; Jorstad, S G; Marscher, A P; Bala, V; MacDonald, N R; Kaur, N; Sameer,; Baliyan, K; Acosta-Pulido, J A; Lazaro, C; Martínez-Lombilla, C; Grinon-Marin, A B; Yabar, A Pastor; Protasio, C; Carnerero, M I; Jermak, H; Steele, I A; Larionov, V M; Borman, G A; Grishina, T S

    2016-01-01

    Context. PKS 1510-089 is one of only a few flat spectrum radio quasars detected in the VHE (very-high-energy, > 100 GeV) gamma-ray band. Aims. We study the broadband spectral and temporal properties of the PKS 1510-089 emission during a high gamma-ray state. Methods. We performed VHE gamma-ray observations of PKS 1510-089 with the MAGIC telescopes during a high gamma-ray state in May 2015. In order to perform broad-band modelling of the source, we have also gathered contemporaneous multiwavelength data in radio, IR, optical photometry and polarization, UV, X-ray and GeV gamma-ray ranges. We construct a broadband spectral energy distribution (SED) in two periods, selected according to VHE gamma-ray state. Results. PKS 1510-089 has been detected in a high optical and gamma-ray state, showing for the first time a significant VHE gamma-ray variability. Similarly to the optical and gamma-ray high state of the source detected in 2012, it was accompanied by a rotation of the optical polarization angle and the emissi...

  7. XMM-Newton and Chandra X-ray follow-up observations of the VHE gamma-ray source HESS J1507-622

    CERN Document Server

    Tibolla, O; Kosack, K

    2014-01-01

    Context. The discovery of the unique source HESS J1507-622 in the very high energy (VHE) range (100 GeV-100 TeV) opened new possibilities to study the parent population of ultra-relativistic particles found in astrophysical sources and underlined the possibility of new scenarios/mechanisms crucial for understanding the underlying astrophysical processes in nonthermal sources. Aims. The follow-up X-ray (0.2 - 10 keV) observations on HESS J1507-622 are reported, and possibilities regarding the nature of the VHE source and that of the newly discovered X-ray sources are investigated. Methods.We obtained bservations with the X-ray satellites XMM-Newton and Chandra. Background corrections were applied to the data to search for extended diffuse emission. Since HESS J1507-622 covers a large part of the field of view of these instruments, blank-sky background fields were used. Results. The discovery of several new X-ray sources and a new, faint, extended X-ray source with a flux of ~6e-14 erg cm^-2 s^-1 is reported. I...

  8. Discovery and follow-up studies of the extended, off-plane, VHE gamma-ray source HESS J1507-622

    CERN Document Server

    Acero, F; Akhperjanian, A G; Anton, G; de Almeida, U Barres; Bazer-Bachi, A R; Becherini, Y; Behera, B; Bernlöhr, K; Bochow, A; Boisson, C; Bolmont, J; Borrel, V; Brucker, J; Brun, F; Brun, P; Bühler, R; Bulik, T; Büsching, I; Boutelier, T; Chadwick, P M; Charbonnier, A; Chaves, R C G; Cheesebrough, A; Chounet, L -M; Clapson, A C; Coignet, G; Dalton, M; Daniel, M K; Davids, I D; Degrange, B; Deil, C; Dickinson, H J; Djannati-Ataï, A; Domainko, W; Drury, L O'C; Dubois, F; Dubus, G; Dyks, J; Dyrda, M; Egberts, K; Emmanoulopoulos, D; Espigat, P; Farnier, C; Feinstein, F; Fiasson, A; Förster, A; Fontaine, G; Füssling, M; Gabici, S; Gallant, Y A; Gérard, L; Gerbig, D; Giebels, B; Glicenstein, J F; Glück16, B; Goret, P; Göring, D; Hauser, D; Hauser, M; Heinz, S; Heinzelmann, G; Henri, G; Hermann, G; Hinton, J A; Hoffmann, A; Hofmann, W; Holleran, M; Hoppe, S; Horns, D; Jacholkowska, A; de Jager, O C; Jahn, C; Jung, I; Katarzyński, K; Katz, U; Kaufmann, S; Kerschhaggl, M; Khangulyan, D; Khélifi, B; Keogh, D; Klochkov, D; Kluźniak, W; Kneiske, T; Komin, Nu; Kosack, K; Kossakowski, R; Lamanna, G; Lenain, J -P; Lohse, T; Marandon, V; Martineau-Huynh, O; Marcowith, A; Masbou, J; Maurin, D; McComb, T J L; Medina, M C; Méhault, J; Moderski, R; Moulin, E; Naumann-Godo, M; de Naurois, M; Nedbal, D; Nekrassov, D; Nicholas, B; Niemiec, J; Nolan, S J; Ohm, S; Olive, J-F; Wilhelmi, E de Oña; Orford, K J; Ostrowski, M; Panter, M; Arribas, M Paz; Pedaletti, G; Pelletier, G; Petrucci, P -O; Pita, S; Pühlhofer, G; Punch, M; Quirrenbach, A; Raubenheimer, B C; Raue, M; Rayner, S M; Reimer, O; Renaud, M; Rieger, F; Ripken, J; Rob, L; Rosier-Lees, S; Rowell, G; Rudak, B; Rulten, C B; Ruppel, J; Sahakian, V; Santangelo, A; Schlickeiser, R; Schöck, F M; Schwanke, U; Schwarzburg, S; Schwemmer, S; Shalchi, A; Sikora, M; Skilton, J L; Sol, H; Stawarz, Ł; Steenkamp, R; Stegmann, C; Stinzing, F; Superina, G; Szostek, A; Tam, P H; Tavernet, J -P; Terrier, R; Tibolla, O; Tluczykont, M; van Eldik, C; Vasileiadis, G; Venter, C; Venter, L; Vialle, J P; Vincent, P; Vivier, M; Völk, H J; Volpe, F; Wagner, S J; Ward, M; Zdziarski, A A; Zech, A

    2010-01-01

    Context: The detection of gamma-rays in the very-high-energy (VHE) range (100 GeV-100 TeV) offers the possibility of studying the parent population of ultrarelativistic particles found in astrophysical sources, so it is useful for understanding the underlying astrophysical processes in nonthermal sources. Aim: The discovery of the VHE gamma-ray source HESS J1507-622 is reported and possibilities regarding its nature are investigated. Methods: The H.E.S.S. array of imaging atmospheric Cherenkov telescopes (IACTs) has a high sensitivity compared with previous instruments (~1% of the Crab flux in 25 hours observation time for a 5 sigma point-source detection) and has a large field of view (~5 deg in diameter). HESS J1507-622 was discovered within the ongoing H.E.S.S. survey of the inner Galaxy, and the source was also studied by means of dedicated multiwavelength observations. Results: A Galactic gamma-ray source, HESS J1507-622, located ~3.5 deg from the Galactic plane was detected with a statistical significan...

  9. POTENTIAL DEFICIENCIES IN EDUCATION, INSTRUMENTATION, AND WARNINGS FOR LOCALLY GENERATED TSUNAMIS

    Directory of Open Access Journals (Sweden)

    Daniel A. Walker

    2010-01-01

    Full Text Available A review of historical data for Hawaii reveals that significant tsunamis have been reported for only four of twenty-six potentially tsunamigenic earthquakes from 1868 through 2009 with magnitudes of 6.0 or greater. During the same time period, three significant tsunamis have been reported for substantially smaller earthquakes. This historical perspective, the fact that the last significant local tsunami occurred in 1975, and an understandable preoccupation with tsunamis generated around the margins of the Pacific, all combine to suggest apparent deficiencies in: (1 personal awareness of what to do in the event of a possible local tsunami; (2 the distribution of instrumentation capable of providing rapid confirmation that a local tsunami has been generated; and (3 the subsequent issuance of timely warnings for local tsunamis. With these deficiencies, far more lives may be lost in Hawaii due to local tsunamis than will result from tsunamis that have originated along the margins of the Pacific. Similar deficiencies may exist in other areas of the world threatened by local tsunamis.

  10. The opto-mechanical design for GMOX: a next-generation instrument concept for Gemini

    Science.gov (United States)

    Smee, Stephen A.; Barkhouser, Robert; Robberto, Massimo; Ninkov, Zoran; Gennaro, Mario; Heckman, Timothy M.

    2016-08-01

    We present the opto-mechanical design of GMOX, the Gemini Multi-Object eXtra-wide-band spectrograph, a potential next-generation (Gen-4 #3) facility-class instrument for Gemini. GMOX is a wide-band, multi-object, spectrograph with spectral coverage spanning 350 nm to 2.4 um with a nominal resolving power of R 5000. Through the use of Digital Micromirror Device (DMD) technology, GMOX will be able to acquire spectra from hundreds of sources simultaneously, offering unparalleled flexibility in target selection. Utilizing this technology, GMOX can rapidly adapt individual slits to either seeing-limited or diffraction-limited conditions. The optical design splits the bandpass into three arms, blue, red, and near infrared, with the near-infrared arm being split into three channels covering the Y+J band, H band, and K band. A slit viewing camera in each arm provides imaging capability for target acquisition and fast-feedback for adaptive optics control with either ALTAIR (Gemini North) or GeMS (Gemini South). Mounted at the Cassegrain focus, GMOX is a large (1.3 m x 2.8 m x 2.0 m) complex instrument, with six dichroics, three DMDs (one per arm), five science cameras, and three acquisition cameras. Roughly half of these optics, including one DMD, operate at cryogenic temperature. To maximize stiffness and simplify assembly and alignment, the opto-mechanics are divided into three main sub-assemblies, including a near-infrared cryostat, each having sub-benches to facilitate ease of alignment and testing of the optics. In this paper we present the conceptual opto-mechanical design of GMOX, with an emphasis on the mounting strategy for the optics and the thermal design details related to the near-infrared cryostat.

  11. Automatic evaluation and data generation for analytical chemistry instrumental analysis exercises

    Directory of Open Access Journals (Sweden)

    Arsenio Muñoz de la Peña

    2014-01-01

    Full Text Available In general, laboratory activities are costly in terms of time, space, and money. As such, the ability to provide realistically simulated laboratory data that enables students to practice data analysis techniques as a complementary activity would be expected to reduce these costs while opening up very interesting possibilities. In the present work, a novel methodology is presented for design of analytical chemistry instrumental analysis exercises that can be automatically personalized for each student and the results evaluated immediately. The proposed system provides each student with a different set of experimental data generated randomly while satisfying a set of constraints, rather than using data obtained from actual laboratory work. This allows the instructor to provide students with a set of practical problems to complement their regular laboratory work along with the corresponding feedback provided by the system's automatic evaluation process. To this end, the Goodle Grading Management System (GMS, an innovative web-based educational tool for automating the collection and assessment of practical exercises for engineering and scientific courses, was developed. The proposed methodology takes full advantage of the Goodle GMS fusion code architecture. The design of a particular exercise is provided ad hoc by the instructor and requires basic Matlab knowledge. The system has been employed with satisfactory results in several university courses. To demonstrate the automatic evaluation process, three exercises are presented in detail. The first exercise involves a linear regression analysis of data and the calculation of the quality parameters of an instrumental analysis method. The second and third exercises address two different comparison tests, a comparison test of the mean and a t-paired test.

  12. Discovery of VHE gamma-rays from the radio galaxy PKS 0625-354 with H.E.S.S

    CERN Document Server

    Dyrda, Michal; Hervet, Olivier; Moderski, Rafal; Janiak, Mateusz; Ostrowski, Michał; Stawarz, Łukasz

    2015-01-01

    Most of the extragalactic objects detected so far in the very high energy (VHE) regime are blazars, but the discovered nearby radio galaxies: M87, Cen A and NGC 1275 of type FRI seem to constitute a new class of VHE emitters. The radio galaxy PKS 0625-354 was observed and detected ($\\sim$6$\\sigma$) with the H.E.S.S. phase I telescopes in 2012, above an energy threshold of 250 GeV. The time-averaged VHE energy spectrum is well characterized by a power law model. The broad-band light curve, including the available multiwavelength data, as well as the VHE data gathered with H.E.S.S. will be presented.

  13. CHARIS Science: Performance Simulations for the Subaru Telescope's Third-Generation of Exoplanet Imaging Instrumentation

    CERN Document Server

    Brandt, Timothy D; Janson, Markus; Knapp, Gillian R; Mede, Kyle; Limbach, Mary Anne; Groff, Tyler; Burrows, Adam; Gunn, James E; Guyon, Olivier; Hashimoto, Jun; Hayashi, Masahiko; Jovanovic, Nemanja; Kasdin, N Jeremy; Kuzuhara, Masayuki; Lupton, Robert H; Martinache, Frantz; Sorahana, Satoko; Spiegel, David S; Takato, Naruhisa; Tamura, Motohide; Turner, Edwin L; Vanderbei, Robert; Wisniewski, John

    2014-01-01

    We describe the expected scientific capabilities of CHARIS, a high-contrast integral-field spectrograph (IFS) currently under construction for the Subaru telescope. CHARIS is part of a new generation of instruments, enabled by extreme adaptive optics (AO) systems (including SCExAO at Subaru), that promise greatly improved contrasts at small angular separation thanks to their ability to use spectral information to distinguish planets from quasistatic speckles in the stellar point-spread function (PSF). CHARIS is similar in concept to GPI and SPHERE, on Gemini South and the Very Large Telescope, respectively, but will be unique in its ability to simultaneously cover the entire near-infrared $J$, $H$, and $K$ bands with a low-resolution mode. This extraordinarily broad wavelength coverage will enable spectral differential imaging down to angular separations of a few $\\lambda/D$, corresponding to $\\sim$$0.\\!\\!''1$. SCExAO will also offer contrast approaching $10^{-5}$ at similar separations, $\\sim$$0.\\!\\!''1$--$0...

  14. Probing unexplored territories with MUSE: a second generation instrument for the VLT

    CERN Document Server

    Bacon, R; Böhm, P; Boudon, D; Brau-Nogue, S; Caillier, P; Capoani, L; Carollo, C M; Champavert, N; Contini, T; Daguise, E; Dalle, D; Delabre, B; Devriendt, J; Dreizler, S; Du Bois, J; Dupieux, M; Dupin, J P; Emsellem, E; Ferruit, P; Franx, M; Gallou, G; Gerssen, J; Guiderdoni, B; Hahn, T; Hofmann, D; Jarno, A; Kelz, A; Köhler, C; Kollatschny, W; Kosmalski, J; Laurent, F; Lilly, S J; Lizon, J; Loupias, M; Lynn, S; Manescau, A; McDermid, R M; Monstein, C; Nicklas, H; Pares, L; Pasquini, L; Pecontal-Rousset, A; Pécontal, E; Pellò, R; Petit, C; Picat, J P; Popow, E; Quirrenbach, Andreas G; Reiss, R; Renault, E; Roth, M; Schaye, J; Soucail, G; Steinmetz, M; Stroebele, S; Stuik, R; Weilbacher, P; Wozniak, H; De Zeeuw, P T

    2006-01-01

    The Multi Unit Spectroscopic Explorer (MUSE) is a second-generation VLT panoramic integral-field spectrograph under preliminary design study. MUSE has a field of 1x1 arcmin**2 sampled at 0.2x0.2 arcsec**2 and is assisted by the VLT ground layer adaptive optics ESO facility using four laser guide stars. The simultaneous spectral range is 465-930 nm, at a resolution of R~3000. MUSE couples the discovery potential of a large imaging device to the measuring capabilities of a high-quality spectrograph, while taking advantage of the increased spatial resolution provided by adaptive optics. This makes MUSE a unique and tremendously powerful instrument for discovering and characterizing objects that lie beyond the reach of even the deepest imaging surveys. MUSE has also a high spatial resolution mode with 7.5x7.5 arcsec**2 field of view sampled at 25 milli-arcsec. In this mode MUSE should be able to obtain diffraction limited data-cubes in the 600-930 nm wavelength range. Although the MUSE design has been optimized f...

  15. Statistical pulses generator. Application to nuclear instrumentation (1962); Generateur d'impulsions aleatoires. Application a l'instrumentation nucleaire (1962)

    Energy Technology Data Exchange (ETDEWEB)

    Beranger, R. [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1962-07-01

    This report describes a random pulses generator adapted to nuclear instrumentation. After a short survey on the statistical nature of electronic signals, the different ways for generating pulses with a Poisson's time-distribution are studied. The final generator built from a gaseous thyratron in a magnetic field is then described. Several tests are indicated : counting-rate stability, Pearson's criterion, distribution of time-intervals. Applications of the generator in 'whole testing' of nuclear instrumentation are then indicated for sealers, dead time measurements, time analyzers. In this application, pulse-height spectrums have been made by Poissonian sampling of a recurrent or random low-frequency signal. (author) [French] Cette etude decrit un generateur d'impulsions aleatoires et ses applications a l'instrumentation nucleaire. Apres un bref rappel sur la nature statistique des signaux en electronique nucleaire, sont passes en revue les principaux moyens d'obtenir des impulsions distribuees en temps suivant une loi de Poisson. Le generateur utilisant un thyratron a gaz dans un champ magnetique est ensuite decrit; diverses methodes de test sont appliquees (stabilite du taux de comptage, criterium de Pearson, spectre des intervalles ds temps). Les applications du generateur a l'electronique nucleaire dans le domaine des 'essais globaux' sont indiques: test des echelles de comptage et mesure des temps morts, test des analyseurs en temps apres division du taux de comptage par une puissance de deux, test des analyseurs multicanaux en amplitude. Pour cette derniere application, on a realise des spectres d'amplitudes suivant une loi connue, par echantillonnage poissonien d'un signal basse frequence recurrent ou aleatoire. (auteur)

  16. H.E.S.S. discovery of VHE gamma-rays from the quasar PKS 1510-089

    CERN Document Server

    Abramowski, A; Aharonian, F; Akhperjanian, A G; Anton, G; Balenderan, S; Balzer, A; Barnacka, A; Becherini, Y; Tjus, J Becker; Behera, B; Bernlöhr, K; Birsin, E; Biteau, J; Bochow, A; Boisson, C; Bolmont, J; Bordas, P; Brucker, J; Brun, F; Brun, P; Bulik, T; Carrigan, S; Casanova, S; Cerruti, M; Chadwick, P M; Chaves, R C G; Cheesebrough, A; Colafrancesco, S; Cologna, G; Conrad, J; Couturier, C; Dalton, M; Daniel, M K; Davids, I D; Degrange, B; Deil, C; deWilt, P; Dickinson, H J; Djannati-Ataï, A; Domainko, W; Drury, L O'C; Dubus, G; Dutson, K; Dyks, J; Dyrda, M; Egberts, K; Eger, P; Espigat, P; Fallon, L; Farnier, C; Fegan, S; Feinstein, F; Fernandes, M V; Fernandez, D; Fiasson, A; Fontaine, G; Förster, A; Füßling, M; Gajdus, M; Gallant, Y A; Garrigoux, T; Gast, H; Giebels, B; Glicenstein, J F; Glück, B; Göring, D; Grondin, M -H; Grudzińska, M; Häffner, S; Hague, J D; Hahn, J; Hampf, D; Harris, J; Hauser, M; Heinz, S; Heinzelmann, G; Henri, G; Hermann, G; Hillert, A; Hinton, J A; Hofmann, W; Hofverberg, P; Holler, M; Horns, D; Jacholkowska, A; Jahn, C; Jamrozy, M; Jung, I; Kastendieck, M A; Katarzynski, K; Katz, U; Kaufmann, S; Khélifi, B; Klepser, S; Klochkov, D; Kluźniak, W; Kneiske, T; Kolitzus, D; Komin, Nu; Kosack, K; Kossakowski, R; Krayzel, F; Krüger, P P; Laffon, H; Lamanna, G; Lefaucheur, J; Lemoine-Goumard, M; Lenain, J -P; Lennarz, D; Lohse, T; Lopatin, A; Lu, C -C; Marandon, V; Marcowith, A; Masbou, J; Maurin, G; Maxted, N; Mayer, M; McComb, T J L; Medina, M C; Méhault, J; Menzler, U; Moderski, R; Mohamed, M; Moulin, E; Naumann, C L; Naumann-Godo, M; de Naurois, M; Nedbal, D; Nguyen, N; Niemiec, J; Nolan, S J; Ohm, S; Wilhelmi, E de Ona; Opitz, B; Ostrowski, M; Oya, I; Panter, M; Parsons, R D; Arribas, M Paz; Pekeur, N W; Pelletier, G; Perez, J; Petrucci, P -O; Peyaud, B; Pita, S; Pühlhofer, G; Punch, M; Quirrenbach, A; Raab, S; Raue, M; Reimer, A; Reimer, O; Renaud, M; Reyes, R de los; Rieger, F; Ripken, J; Rob, L; Rosier-Lees, S; Rowell, G; Rudak, B; Rulten, C B; Sahakian, V; Sanchez, D A; Santangelo, A; Schlickeiser, R; Schulz, A; Schwanke, U; Schwarzburg, S; Schwemmer, S; Sheidaei, F; Skilton, J L; Sol, H; Spengler, G; Stawarz, Ł; Steenkamp, R; Stegmann, C; Stinzing, F; Stycz, K; Sushch, I; Szostek, A; Tavernet, J -P; Terrier, R; Tluczykont, M; Trichard, C; Valerius, K; van Eldik, C; Vasileiadis, G; Venter, C; Viana, A; Vincent, P; Völk, H J; Volpe, F; Vorobiov, S; Vorster, M; Wagner, S J; Ward, M; White, R; Wierzcholska, A; Wouters, D; Zacharias, M; Zajczyk, A; Zdziarski, A A; Zech, A; Zechlin, H -S; 10.1051/0004-6361/201321135

    2013-01-01

    The quasar PKS 1510-089 (z=0.361) was observed with the H.E.S.S. array of imaging atmospheric Cherenkov telescopes during high states in the optical and GeV bands, to search for very high energy (VHE, defined as E >= 0.1 TeV) emission. VHE \\gamma-rays were detected with a statistical significance of 9.2 standard deviations in 15.8 hours of H.E.S.S. data taken during March and April 2009. A VHE integral flux of I(0.15 TeV < E < 1.0 TeV) = (1.0 +- 0.2 (stat) +- 0.2 (sys) x 10^{-11} cm^{-2}s^{-1} is measured. The best-fit power law to the VHE data has a photon index of \\Gamma=5.4 +- 0.7 (stat) +- 0.3 (sys). The GeV and optical light curves show pronounced variability during the period of H.E.S.S. observations. However, there is insufficient evidence to claim statistically significant variability in the VHE data. Because of its relatively high redshift, the VHE flux from PKS 1510-089 should suffer considerable attenuation in the intergalactic space due to the extragalactic background light (EBL). Hence, the...

  17. Analysis of the potential of one possible instrumental configuration of the next generation of IASI instruments to monitor lower tropospheric ozone

    Directory of Open Access Journals (Sweden)

    P. Sellitto

    2013-03-01

    Full Text Available To evaluate the added value brought by the next generation of IASI (Infrared Atmospheric Sounder Interferometer instruments to monitor lower tropospheric (LT ozone, we developed a pseudo-observation simulator, including a direct simulator of thermal infrared spectra and a full inversion scheme to retrieve ozone concentration profiles. We based our simulations on the instrumental configuration of IASI and of an IASI-like instrument, with a factor 2 improvement in terms of spectral resolution and radiometric noise. This scenario, that will be referred to as IASI/2, is one possible configuration of the IASI-NG (New Generation instrument (the configuration called IASI-NG/IRS2 currently designed by CNES (Centre National d'Études Spatiales. IASI-NG is expected to be launched in the 2020 timeframe as part of the EPS-SG (EUMETSAT Polar System-Second Generation, formerly post-EPS mission. We produced one month (August 2009 of tropospheric ozone pseudo-observations based on these two instrumental configurations. We compared the pseudo-observations and we found a clear improvement of LT ozone (up to 6 km altitude pseudo-observations quality for IASI/2. The estimated total error is expected to be more than 35% smaller at 5 km, and 20% smaller for the LT ozone column. The total error on the LT ozone column is, on average, lower than 10% for IASI/2. IASI/2 is expected to have a significantly better vertical sensitivity (monthly average degrees of freedom surface–6 km of 0.70 and to be sensitive at lower altitudes (more than 0.5 km lower than IASI, reaching nearly 3 km. Vertical ozone layers of 4 to 5 km thickness are expected to be resolved by IASI/2, while IASI has a vertical resolution of 6–8 km. According to our analyses, IASI/2 is expected to have the possibility of effectively separate lower from upper tropospheric ozone information even for low sensitivity scenarios. In addition, IASI/2 is expected to be able to better monitor LT ozone patterns at

  18. VERITAS Upper Limit on the VHE Emission from the Radio Galaxy NGC 1275

    CERN Document Server

    Acciari, V A; Arlen, T; Aune, T; Bautista, M; Beilicke, M; Benbow, W; Boltuch, D; Bradbury, S M; Buckley, J H; Bugaev, V; Byrum, K; Cannon, A; Celik, O; Cesarini, A; Ciupik, L; Cogan, P; Cui, W; Dickherber, R; Duke, C; Fegan, S J; Finley, J P; Fortin, P; Fortson, L; Furniss, A; Galante, N; Gall, D; Gibbs, K; Gillanders, G H; Godambe, S; Grube, J; Guenette, R; Gyuk, G; Hanna, D; Holder, J; Horan, D; Hui, C M; Humensky, T B; Imran, A; Kaaret, Philip; Karlsson, N; Kertzman, M; Kieda, D; Konopelko, A; Krawczynski, H; Krennrich, F; Lang, M J; Le Bohec, S; Maier, G; McCann, A; McCutcheon, M; Millis, J; Moriarty, P; Mukherjee, R; Ong, R A; Otte, A N; Pandel, D; Perkins, J S; Pohl, M; Quinn, J; Ragan, K; Reynolds, P T; Roache, E; Rose, H J; Schroedter, M; Sembroski, G H; Smith, A W; Steele, D; Swordy, S P; Theiling, M; Toner, J A; Varlotta, A; Vasilev, V V; Vincent, S; Wagner, R G; Wakely, S P; Ward, J E; Weekes, T C; Weinstein, A; Weisgarber, T; Williams, D A; Wissel, S; Wood, M; Zitzer, B; Kataoka, J; Cavazzuti, E; Cheung, C C; Lott, B; Thompson, D J; Tosti, G

    2009-01-01

    The recent detection by the Fermi gamma-ray space telescope of high-energy gamma-rays from the radio galaxy NGC 1275 makes the observation of the very high energy (VHE: E > 100 GeV) part of its broadband spectrum particularly interesting, especially for the understanding of active galactic nuclei (AGN) with misaligned multi-structured jets. The radio galaxy NGC 1275 was recently observed by VERITAS at energies above 100 GeV for about 8 hours. No VHE gamma-ray emission was detected by VERITAS from NGC 1275. A 99% confidence level upper limit of 2.1% of the Crab Nebula flux level is obtained at the decorrelation energy of approximately 340 GeV, corresponding to 19% of the power-law extrapolation of the Fermi Large Area Telescope (LAT) result.

  19. A New Eye on the VHE Transient Universe with the HAWC Online Flare Monitor

    CERN Document Server

    Weisgarber, Thomas

    2016-01-01

    The High Altitude Water Cherenkov (HAWC) Observatory recently began full-scale operations, surveying 2/3 of the entire sky at very high energy (VHE; E > 100 GeV). This new view of the sky offers the opportunity to detect flares from blazars, facilitating studies of the mechanisms powering their central engines and providing an avenue to constrain the properties of particles and fields in intergalactic space. The HAWC Collaboration has implemented an online flare monitor to search for rapid and extreme transient activity from a set of blazars either known or suspected to produce VHE emission. The goal of this project is to issue alerts sufficiently rapidly to form a complete multiwavelength picture of the flare. We describe the current status of the online flare monitor, demonstrating its ability to detect flares via a study of the blazars Markarian 421 and Markarian 501 in offline data.

  20. VHE Gamma-rays from Galactic X-ray Binary Systems

    CERN Document Server

    Paredes, J M

    2008-01-01

    The detection of TeV gamma-rays from LS 5039 and the binary pulsar PSR B1259-63 by HESS, and from LS I +61 303 and the stellar-mass black hole Cygnus X-1 by MAGIC, provides a clear evidence of very efficient acceleration of particles to multi-TeV energies in X-ray binaries. These observations demonstrate the richness of non-thermal phenomena in compact galactic objects containing relativistic outflows or winds produced near black holes and neutron stars. I review here some of the main observational results on very high energy (VHE) gamma-ray emission from X-ray binaries, as well as some of the proposed scenarios to explain the production of VHE gamma-rays. I put special emphasis on the flare TeV emission, suggesting that the flaring activity might be a common phenomena in X-ray binaries.

  1. The Thirty-Meter Telescope: Science and Instrumentation for a Next-Generation Observatory

    Indian Academy of Sciences (India)

    Luc Simard

    2013-06-01

    The Thirty-Meter Telescope international observatory will enable transformational observations over the full cosmic timeline all the way from the first luminous objects in the Universe to the planets and moons of our own solar system. To realize its full scientific potential, TMT will be equipped with a powerful suite of adaptive optics systems and science instruments. Three science instruments will be available at first light: an optical multi-object spectrometer, a nearinfrared multi-slit spectrometer and a diffraction-limited near-infrared imager and integral field spectrometer. In addition to these three instruments, a diverse set of new instruments under study will bring additional workhorse capabilities to serve the science interests of a broad user community. The development of TMT instruments represents a large, long-term program that offers a wide range of opportunities to all TMT partners.

  2. Complex of the new generation of the instrumental analytical approaches to prevent dangerous bioterrorism

    Science.gov (United States)

    Starodub, Nickolaj F.; Shavanova, Kateryna; Karpiuk, Andrii

    2014-10-01

    The real manifestations of biowarfare were only during local military conflicts. In previous times the danger with this factor forms through activation of terrorist organizations. To prevent non-desirable consequences and to preserve the lives and health of people it is necessary to provide constant control by the application of complex of the new generation of the instrumental devices based on the principles of biosensorics which allow rapid revealing step by step: total toxicity of environmental objects, presence of appropriate groups and specific chemical substances among them. It is demonstrated simple and rapid estimation of the total toxicity through the control of the intensity of chlorophyll fluorescence (IChF) by the direct or remote ways by the device "Floratest" (Ukraine). There is possible on the basis of IChF curve of growing plants from some territory during appropriate period to reveal appearance of toxic substances in this area. Their presence in more local cases may be done by using bioluminescent bacteria (pure Ukrainian strains) or/and controlling short term Daphnia living medium by developed portable chemiluminometer. For the revealing of some groups of toxic elements it is recommended the cerium oxide ISFETs based enzymatic biosensors. The last and devices based on SPR ("Plasmotest", Ukraine), porous silicon (with the registration of biospecific interaction macromolecules by luminescence or electro conductivity) and some nano-metal oxides were realized in immune biosensors at the determination of content of number of mycotoxins, some microorganisms (Salmonella spp.) and diagnostics of viral disease (retroviral leucosis). We present the main characteristics of the above mentioned devices and give confirmation that all the analysis meets practice demands. Overall time of analysis is in range 10 min and it is very simple and may be realized in field conditions.

  3. Detection of Extended VHE Gamma Ray Emission from G106.3+2.7 with VERITAS

    CERN Document Server

    Acciari, V A; Arlen, T; Aune, T; Bautista, M; Beilicke, M; Benbow, W; Boltuch, D; Bradbury, S M; Buckley, J H; Bugaev, V; Butt, Y; Byrum, K; Cannon, A; Cesarini, A; Chow, Y C; Ciupik, L; Cogan, P; Cui, W; Dickherber, R; Ergin, T; Fegan, S J; Finley, J P; Fortin, P; Fortson, L; Furniss, A; Gall, D; Gillanders, G H; Gotthelf, E V; Grube, J; Guenette, R; Gyuk, G; Hanna, D; Holder, J; Horan, D; Hui, C M; Humensky, T B; Kaaret, P; Karlsson, N; Kertzman, M; Kieda, D; Konopelko, A; Krawczynski, H; Krennrich, F; Lang, M J; LeBohec, S; Maier, G; McCann, A; McCutcheon, M; Millis, J; Moriarty, P; Mukherjee, R; Ong, R A; Otte, A N; Pandel, D; Perkins, J S; Pohl, M; Quinn, J; Ragan, K; Reyes, L C; Reynolds, P T; Roache, E; Rose, H J; Schroedter, M; Sembroski, G H; Smith, A W; Steele, D; Swordy, S P; Theiling, M; Toner, J A; Vassiliev, V V; Vincent, S; Wagner, R G; Wakely, S P; Ward, J E; Weekes, T C; Weinstein, A; Weisgarber, T; Williams, D A; Wissel, S; Wood, M; Zitzer, B; 10.1088/0004-637X/703/1/L6

    2009-01-01

    We report the detection of very-high-energy (VHE) gamma-ray emission from supernova remnant (SNR) G106.3+2.7. Observations performed in 2008 with the VERITAS atmospheric Cherenkov gamma-ray telescope resolve extended emission overlapping the elongated radio SNR. The 7.3 sigma (pre-trials) detection has a full angular extent of roughly 0.6deg by 0.4deg. Most notably, the centroid of the VHE emission is centered near the peak of the coincident 12CO (J = 1-0) emission, 0.4deg away from the pulsar PSR J2229+6114, situated at the northern end of the SNR. Evidently the current-epoch particles from the pulsar wind nebula are not participating in the gamma-ray production. The VHE energy spectrum measured with VERITAS is well characterized by a power law dN/dE = N_0(E/3 TeV)^{-G} with a differential index of G = 2.29 +/- 0.33stat +/- 0.30sys and a flux of N_0 = (1.15 +/- 0.27stat +/- 0.35sys)x 10^{-13} cm^{-2} s^{-1} TeV^{-1}. The integral flux above 1 TeV corresponds to ~5 percent of the steady Crab Nebula emission a...

  4. Observation of Extended VHE Emission from the Supernova Remnant IC 443 with VERITAS

    CERN Document Server

    Acciari, V A; Arlen, T; Aune, T; Bautista, M; Beilicke, M; Benbow, W; Bradbury, S M; Buckley, J H; Bugaev, V; Butt, Y; Byrum, K; Cannon, A; Celik, O; Cesarini, A; Chow, Y C; Ciupik, L; Cogan, P; Colin, P; Cui, W; Daniel, M K; Dickherber, R; Duke, C; Dwarkadas, V V; Ergin, T; Fegan, S J; Finley, J P; Finnegan, G; Fortin, P; Fortson, L; Furniss, A; Gall, D; Gibbs, K; Gillanders, G H; Godambe, S; Grube, J; Guenette, R; Gyuk, G; Hanna, D; Hays, E; Holder, J; Horan, D; Hui, C M; Humensky, T B; Imran, A; Kaaret, Philip; Karlsson, N; Kertzman, M; Kieda, D; Kildea, J; Konopelko, A; Krawczynski, H; Krennrich, F; Lang, M J; Le Bohec, S; Maier, G; McCann, A; McCutcheon, M; Millis, J; Moriarty, P; Ong, R A; Otte, A N; Pandel, D; Perkins, J S; Pohl, M; Quinn, J; Ragan, K; Reyes, L C; Reynolds, P T; Roache, E; Rose, H J; Schroedter, M; Sembroski, G H; Smith, A W; Steele, D; Swordy, S P; Theiling, M; Toner, J A; Valcarcel, L; Varlotta, A; Vasilev, V V; Vincent, S; Wagner, R G; Wakely, S P; Ward, J E; Weekes, T C; Weinstein, A; Weisgarber, T; Williams, D A; Wissel, S; Wood, M; Zitzer, B

    2009-01-01

    We present evidence that the very-high-energy (VHE, E > 100 GeV) gamma-ray emission coincident with the supernova remnant IC 443 is extended. IC 443 contains one of the best-studied sites of supernova remnant/molecular cloud interaction and the pulsar wind nebula CXOU J061705.3+222127, both of which are important targets for VHE observations. VERITAS observed IC 443 for 37.9 hours during 2007 and detected emission above 300 GeV with an excess of 247 events, resulting in a significance of 8.3 standard deviations (sigma) before trials and 7.5 sigma after trials in a point-source search. The emission is centered at 06 16 51 +22 30 11 (J2000) +- 0.03_stat +- 0.08_sys degrees, with an intrinsic extension of 0.16 +- 0.03_stat +- 0.04_sys degrees. The VHE spectrum is well fit by a power law (dN/dE = N_0 * (E/TeV)^-Gamma) with a photon index of 2.99 +- 0.38_stat +- 0.3_sys and an integral flux above 300 GeV of (4.63 +- 0.90_stat +- 0.93_sys) * 10^-12 cm^-2 s^-1. These results are discussed in the context of existing ...

  5. Discovery of VHE gamma-rays from the distant BL Lac 1ES 0347-121

    CERN Document Server

    Aharonian, F; Barres de Almeida, U; Bazer-Bachi, A R; Behera, B; Beilicke, M; Benbow, W; Bernlöhr, K; Boisson, C; Bolz, O; Borrel, V; Braun, I; Brion, E; Brown, A M; Buhler, R; Bulik, T; Büsching, I; Boutelier, T; Carrigan, S; Chadwick, P M; Chounet, L M; Clapson, A C; Coignet, G; Cornils, R; Costamante, L; Dalton, M; Degrange, B; Dickinson, H J; Djannati-Ata:, A; Domainko, W; O'Connor-Drury, L; Dubois, F; Dubus, G; Dyks, J; Egberts, K; Emmanoulopoulos, D; Espigat, P; Farnier, C; Feinstein, F; Fiasson, A; Förster, A; Fontaine, G; Funk, Seb; Fuling, M; Gallant, Y A; Giebels, B; Glicenstein, J F; Glück, B; Goret, P; Hadjichristidis, C; Hauser, D; Hauser, M; Heinzelmann, G; Henri, G; Hermann, G; Hinton, J A; Hoffmann, A; Hofmann, W; Holleran, M; Hoppe, S; Horns, D; Jacholkowska, A; De Jager, O C; Jung, I; Katarzynski, K; Kendziorra, E; Kerschhaggl, M; Khelifi, B; Keogh, D; Komin, Nu; Kosack, K; Lamanna, G; Latham, I J; Lemiere, A; Lemoine-Goumard, M; Lenain, J P; Lohse, T; Martin, J M; Martineau-Huynh, O; Marcowith, A; Masterson, C; Maurin, D; Maurin, G; McComb, T J L; Moderski, R; Moulin, E; De Naurois, Mathieu; Nedbal, D; Nolan, S J; Ohm, S; Olive, J P; De Ona Wilhelmi, E; Orford, K J; Osborne, J L; Ostrowski, M; Panter, M; Pedaletti, G; Pelletier, G; Petrucci, P O; Pita, S; Pühlhofer, G; Punch, M; Ranchon, S; Raubenheimer, B C; Raue, M; Rayner, S M; Renaud, M; Ripken, J; Rob, L; Rolland, L; Rosier-Lees, S; Rowell, G; Rudak, B; Ruppel, J; Sahakian, V V; Santangelo, A; Schlickeiser, R; Schock, F; Schroder, R; Schwanke, U; Schwarzburg, S; Schwemmer, S; Shalchi, A; Sol, H; Spangler, D; Stawarz,; Steenkamp, R; Stegmann, C; Superina, G; Tam, P H; Tavernet, J P; Terrier, R; Van Eldik, C; Vasileiadis, G; Venter, C; Vialle, J P; Vincent, P; Vivier, M; Völk, H J; Volpe, F; Wagner, S J; Ward, M; Zdziarski, A A; Zech, A

    2007-01-01

    Aims: Our aim is to study the production mechanism for very-high-energy (VHE; >100GeV) gamma-rays in distant active galactic nuclei (AGN) and use the observed VHE spectrum to derive limits on the Extragalactic Background Light (EBL). We also want to determine physical quantities through the modeling of the object's broad-band spectral energy distribution (SED). Methods: VHE observations (~25h live time) of the BL Lac 1ES 0347-121 (redshift z=0.188) were conducted with the High Energy Stereoscopic System (H.E.S.S.) between August and December 2006. Contemporaneous X-ray and UV/optical observations from the SWIFT satellite are used to interpret the SED of the source in terms of a synchrotron self Compton (SSC) model. Results: An excess of 327 events, corresponding to a statistical significance of 10.1 standard deviations, is detected from 1ES 0347-121. Its photon spectrum, ranging from ~250GeV to ~3TeV, is well described by a power law with a photon index of Gamma = 3.10 +/- 0.23_stat +/- 0.10_sys. The integral...

  6. Discovery of VHE gamma-rays from the BL Lac object PKS 0548-322

    CERN Document Server

    Akhperjanian, A G; de Almeida, U Barres; Bazer-Bachi, A R; Becherini, Y; Behera, B; Benbow, W; Bernlöhr, K; Bochow, A; Boisson, C; Bolmont, J; Borrel, V; Brucker, J; Brun, F; Brun, P; Bühler, R; Bulik, T; Büsching, I; Boutelier, T; Chadwick, P M; Charbonnier, A; Chaves, R C G; Cheesebrough, A; Chounet, L -M; Clapson, A C; Coignet, G; Dalton, M; Daniel, M K; Davids, I D; Degrange, B; Deil, C; Dickinson, H J; Djannati-Ataï, A; Domainko, W; Drury, L O'C; Dubois, F; Dubus, G; Dyks, J; Dyrda, M; Egberts, K; Emmanoulopoulos, D; Espigat, P; Farnier, C; Feinstein, F; Fiasson, A; Förster, A; Fontaine, G; Füssling, M; Gabici, S; Gallant, Y A; Gérard, L; Gerbig, D; Giebels, B; Glicenstein, J F; Glück, B; Goret, P; Göring, D; Hauser, D; Hauser, M; Heinz, S; Heinzelmann, G; Henri, G; Hermann, G; Hinton, J A; Hoffmann, A; Hofmann, W; Holleran, M; Hoppe, S; Horns, D; Jacholkowska, A; deJager, O C; Jahn, C; Jung, I; Katarzyński, K; Katz, U; Kaufmann, S; Kendziorra, E; Kerschhagg, M; Khangulyan, D; Khélifi, B; Keogh, D; Kluźniak, W; Kneiske, T; Komin, Nu; Kosack, K; Lamanna, G; Lenain, J -P; Lohse, T; Marandon, V; Martin, J M; Martineau-Huynh, O; Marcowith, A; Masbou, J; Maurin, D; McComb, T J L; Medina, M C; Moderski, R; Moulin, E; Naumann-Godo, M; deNaurois, M; Nedbal, D; Nekrassov, D; Nicholas, B; Niemiec, J; Nolan, S J; Ohm, S; Olive, J-F; Wilhelm, E de Oña; Orford, K J; Ostrowski, M; Panter, M; Arribas, M Paz; Pedaletti, G; Pelletier, G; Petrucci, P -O; Pita, S; Pühlhofer, G; Punch, M; Quirrenbach, A; Raubenheimer, B C; Raue, M; Rayner, S M; Renaud, M; Rieger, F; Ripken, J; Rob, L; Rosier-Lees, S; Rowell, G; Rudak, B; Rulten, C B; Ruppel, J; Sahakian, V; Santangelo, A; Schlickeiser, R; Schöck, F M; Schröder, R; Schwanke, U; Schwarzburg, S; Schwemmer, S; Shalchi, A; Sikora, M; Skilton, J L; Sol, H; Spangler, D; Stawarz, L; Steenkamp, R; Stegmann, C; Stinzing, F; Superina, G; Szostek, A; Tam, P H; Tavernet, J -P; Terrier, R; Tibolla, O; Tluczykont, M; vanEldik, C; Vasileiadis, G; Venter, C; Venter, L; Vialle, J P; Vincent, P; Vivier, M; Völk, H J; Volp, F; Wagner, S J; Ward, M; Zdziarski, A A; Zech, A

    2010-01-01

    PKS 0548-322 (z=0.069) is a ``high-frequency-peaked'' BL Lac object and a candidate very high energy (VHE, E>100 GeV) gamma-ray emitter, due to its high X-ray and radio flux. Observations at the VHE band provide insights into the origin of very energetic particles present in this source and the radiation processes at work. We report observations made between October 2004 and January 2008 with the H.E.S.S. array, a four imaging atmospheric-Cherenkov telescopes. Contemporaneous UV and X-ray observations with the Swift satellite in November 2006 are also reported. PKS 0548-322 is detected for the first time in the VHE band with H.E.S.S. We measure an excess of 216 gamma-rays corresponding to a significance of 5.6 standard deviations. The photon spectrum of the source is described by a power-law, with a photon index of Gamma=2.86 +/- 0.34 (stat) +/- 0.10 (sys). The integral flux above 200 GeV is 1.3 % of the flux of the Crab Nebula, and is consistent with being constant in time. Contemporaneous Swift/XRT observat...

  7. Discovery of VHE γ-ray emission and multi-wavelength observations of the BL Lacertae object 1RXS J101015.9-311909

    Science.gov (United States)

    H.E.S.S. Collaboration; Abramowski, A.; Acero, F.; Aharonian, F.; Akhperjanian, A. G.; Anton, G.; Balzer, A.; Barnacka, A.; Becherini, Y.; Becker, J.; Bernlöhr, K.; Birsin, E.; Biteau, J.; Bochow, A.; Boisson, C.; Bolmont, J.; Bordas, P.; Brucker, J.; Brun, F.; Brun, P.; Bulik, T.; Büsching, I.; Carrigan, S.; Casanova, S.; Cerruti, M.; Chadwick, P. M.; Charbonnier, A.; Chaves, R. C. G.; Cheesebrough, A.; Cologna, G.; Conrad, J.; Dalton, M.; Daniel, M. K.; Davids, I. D.; Degrange, B.; Deil, C.; Dickinson, H. J.; Djannati-Ataï, A.; Domainko, W.; Drury, L. O'C.; Dubus, G.; Dutson, K.; Dyks, J.; Dyrda, M.; Egberts, K.; Eger, P.; Espigat, P.; Fallon, L.; Fegan, S.; Feinstein, F.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Förster, A.; Füßling, M.; Gallant, Y. A.; Gast, H.; Gérard, L.; Gerbig, D.; Giebels, B.; Glicenstein, J. F.; Glück, B.; Göring, D.; Häffner, S.; Hague, J. D.; Hahn, J.; Hampf, D.; Harris, J.; Hauser, M.; Heinz, S.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hillert, A.; Hinton, J. A.; Hofmann, W.; Hofverberg, P.; Holler, M.; Horns, D.; Jacholkowska, A.; de Jager, O. C.; Jahn, C.; Jamrozy, M.; Jung, I.; Kastendieck, M. A.; Katarzyński, K.; Katz, U.; Kaufmann, S.; Keogh, D.; Khélifi, B.; Klochkov, D.; Kluźniak, W.; Kneiske, T.; Komin, Nu.; Kosack, K.; Kossakowski, R.; Krayzel, F.; Laffon, H.; Lamanna, G.; Lenain, J.-P.; Lennarz, D.; Lohse, T.; Lopatin, A.; Lu, C.-C.; Marandon, V.; Marcowith, A.; Masbou, J.; Maxted, N.; Mayer, M.; McComb, T. J. L.; Medina, M. C.; Méhault, J.; Moderski, R.; Mohamed, M.; Moulin, E.; Naumann, C. L.; Naumann-Godo, M.; de Naurois, M.; Nedbal, D.; Nekrassov, D.; Nguyen, N.; Nicholas, B.; Niemiec, J.; Nolan, S. J.; Ohm, S.; de Oña Wilhelmi, E.; Opitz, B.; Ostrowski, M.; Oya, I.; Panter, M.; Paz Arribas, M.; Pekeur, N. W.; Pelletier, G.; Perez, J.; Petrucci, P.-O.; Peyaud, B.; Pita, S.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raue, M.; Rayner, S. M.; Reimer, A.; Reimer, O.; Renaud, M.; de los Reyes, R.; Rieger, F.; Ripken, J.; Rob, L.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Sanchez, D. A.; Santangelo, A.; Schlickeiser, R.; Schulz, A.; Schwanke, U.; Schwarzburg, S.; Schwemmer, S.; Sheidaei, F.; Skilton, J. L.; Sol, H.; Spengler, G.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Stycz, K.; Sushch, I.; Szostek, A.; Tavernet, J.-P.; Terrier, R.; Tluczykont, M.; Valerius, K.; van Eldik, C.; Vasileiadis, G.; Venter, C.; Viana, A.; Vincent, P.; Völk, H. J.; Volpe, F.; Vorobiov, S.; Vorster, M.; Wagner, S. J.; Ward, M.; White, R.; Wierzcholska, A.; Zacharias, M.; Zajczyk, A.; Zdziarski, A. A.; Zech, A.; Zechlin, H.-S.

    2012-06-01

    1RXS J101015.9-311909 is a galaxy located at a redshift of z=0.14 hosting an active nucleus (called AGN) belonging to the class of bright BL Lac objects. Observations at high (HE, E > 100 MeV) and very high (VHE, E > 100 GeV) energies provide insights into the origin of very energetic particles present in such sources and the radiation processes at work. We report on results from VHE observations performed between 2006 and 2010 with the H.E.S.S. instrument, an array of four imaging atmospheric Cherenkov telescopes. H.E.S.S. data have been analysed with enhanced analysis methods, making the detection of faint sources more significant. VHE emission at a position coincident with 1RXS J101015.9-311909 is detected with H.E.S.S. for the first time. In a total good-quality livetime of about 49 h, we measure 263 excess counts, corresponding to a significance of 7.1 standard deviations. The photon spectrum above 0.2 TeV can be described by a power-law with a photon index of Γ = 3.08 ± 0.42stat ± 0.20sys. The integral flux above 0.2 TeV is about 0.8% of the flux of the Crab nebula and shows no significant variability over the time reported. In addition, public Fermi/LAT data are analysed to search for high energy emission from the source. The Fermi/LAT HE emission in the 100 MeV to 200 GeV energy range is significant at 8.3 standard deviations in the chosen 25-month dataset. UV and X-ray contemporaneous observations with the Swift satellite in May 2007 are also reported, together with optical observations performed with the atom telescope located at the H.E.S.S. site. Swift observations reveal an absorbed X-ray flux of F(0.3-7) keV = 1.04+0.04-0.05 × 10-11 erg cm-2 s-1 in the 0.3-7 keV range. Finally, all the available data are used to study the multi-wavelength properties of the source. The spectral energy distribution (SED) can be reproduced using a simple one-zone Synchrotron Self Compton (SSC) model with emission from a region with a Doppler factor of 30 and a

  8. Generation of a reference radiation pattern of string instruments using automatic excitation and acoustic centering.

    Science.gov (United States)

    Shabtai, Noam R; Behler, Gottfried; Vorländer, Michael

    2015-11-01

    Radiation patterns of musical instruments are important for the understanding of music perception in concert halls, and may be used to improve the plausibility of virtual acoustic systems. Many attempts have been performed to measure the spatial response of musical instruments using surrounding spherical microphone arrays with a limited number of microphones. This work presents a high-resolution spatial sampling of the radiation pattern of an electrically excited violin, and addresses technical problems that arise due to mechanical reasons of the excitation apparatus using acoustic centering.

  9. H.E.S.S. discovery of VHE γ-rays from the quasar PKS 1510-089

    Science.gov (United States)

    H.E.S.S. Collaboration; Abramowski, A.; Acero, F.; Aharonian, F.; Akhperjanian, A. G.; Anton, G.; Balenderan, S.; Balzer, A.; Barnacka, A.; Becherini, Y.; Becker Tjus, J.; Behera, B.; Bernlöhr, K.; Birsin, E.; Biteau, J.; Bochow, A.; Boisson, C.; Bolmont, J.; Bordas, P.; Brucker, J.; Brun, F.; Brun, P.; Bulik, T.; Carrigan, S.; Casanova, S.; Cerruti, M.; Chadwick, P. M.; Chaves, R. C. G.; Cheesebrough, A.; Colafrancesco, S.; Cologna, G.; Conrad, J.; Couturier, C.; Dalton, M.; Daniel, M. K.; Davids, I. D.; Degrange, B.; Deil, C.; deWilt, P.; Dickinson, H. J.; Djannati-Ataï, A.; Domainko, W.; O'C. Drury, L.; Dubus, G.; Dutson, K.; Dyks, J.; Dyrda, M.; Egberts, K.; Eger, P.; Espigat, P.; Fallon, L.; Farnier, C.; Fegan, S.; Feinstein, F.; Fernandes, M. V.; Fernandez, D.; Fiasson, A.; Fontaine, G.; Förster, A.; Füßling, M.; Gajdus, M.; Gallant, Y. A.; Garrigoux, T.; Gast, H.; Giebels, B.; Glicenstein, J. F.; Glück, B.; Göring, D.; Grondin, M.-H.; Grudzińska, M.; Häffner, S.; Hague, J. D.; Hahn, J.; Hampf, D.; Harris, J.; Hauser, M.; Heinz, S.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hillert, A.; Hinton, J. A.; Hofmann, W.; Hofverberg, P.; Holler, M.; Horns, D.; Jacholkowska, A.; Jahn, C.; Jamrozy, M.; Jung, I.; Kastendieck, M. A.; Katarzyński, K.; Katz, U.; Kaufmann, S.; Khélifi, B.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Kneiske, T.; Kolitzus, D.; Komin, Nu.; Kosack, K.; Kossakowski, R.; Krayzel, F.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lefaucheur, J.; Lemoine-Goumard, M.; Lenain, J.-P.; Lennarz, D.; Lohse, T.; Lopatin, A.; Lu, C.-C.; Marandon, V.; Marcowith, A.; Masbou, J.; Maurin, G.; Maxted, N.; Mayer, M.; McComb, T. J. L.; Medina, M. C.; Méhault, J.; Menzler, U.; Moderski, R.; Mohamed, M.; Moulin, E.; Naumann, C. L.; Naumann-Godo, M.; de Naurois, M.; Nedbal, D.; Nguyen, N.; Niemiec, J.; Nolan, S. J.; Ohm, S.; de Oña Wilhelmi, E.; Opitz, B.; Ostrowski, M.; Oya, I.; Panter, M.; Parsons, R. D.; Paz Arribas, M.; Pekeur, N. W.; Pelletier, G.; Perez, J.; Petrucci, P.-O.; Peyaud, B.; Pita, S.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Raue, M.; Reimer, A.; Reimer, O.; Renaud, M.; de los Reyes, R.; Rieger, F.; Ripken, J.; Rob, L.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Sanchez, D. A.; Santangelo, A.; Schlickeiser, R.; Schulz, A.; Schwanke, U.; Schwarzburg, S.; Schwemmer, S.; Sheidaei, F.; Skilton, J. L.; Sol, H.; Spengler, G.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Stycz, K.; Sushch, I.; Szostek, A.; Tavernet, J.-P.; Terrier, R.; Tluczykont, M.; Trichard, C.; Valerius, K.; van Eldik, C.; Vasileiadis, G.; Venter, C.; Viana, A.; Vincent, P.; Völk, H. J.; Volpe, F.; Vorobiov, S.; Vorster, M.; Wagner, S. J.; Ward, M.; White, R.; Wierzcholska, A.; Wouters, D.; Zacharias, M.; Zajczyk, A.; Zdziarski, A. A.; Zech, A.; Zechlin, H. S.

    2013-06-01

    The quasar PKS 1510-089 (z = 0.361) was observed with the H.E.S.S. array of imaging atmospheric Cherenkov telescopes during high states in the optical and GeV bands, to search for very high energy (VHE, defined as E ≥ 0.1 TeV) emission. VHE γ-rays were detected with a statistical significance of 9.2 standard deviations in 15.8 h of H.E.S.S. data taken during March and April 2009. A VHE integral flux of I(0.15 TeV < E < 1.0 TeV)= (1.0 ± 0.2stat ± 0.2sys) × 10-11 cm-2 s-1 is measured. The best-fit power law to the VHE data has a photon index of Γ = 5.4 ± 0.7stat ± 0.3sys. The GeV and optical light curves show pronounced variability during the period of H.E.S.S. observations. However, there is insufficient evidence to claim statistically significant variability in the VHE data. Because of its relatively high redshift, the VHE flux from PKS 1510-089 should suffer considerable attenuation in the intergalactic space due to the extragalactic background light (EBL). Hence, the measured γ-ray spectrum is used to derive upper limits on the opacity due to EBL, which are found to be comparable with the previously derived limits from relatively-nearby BL Lac objects. Unlike typical VHE-detected blazars where the broadband spectrum is dominated by nonthermal radiation at all wavelengths, the quasar PKS 1510-089 has a bright thermal component in the optical to UV frequency band. Among all VHE detected blazars, PKS 1510-089 has the most luminous broad line region. The detection of VHE emission from this quasar indicates a low level of γ - γ absorption on the internal optical to UV photon field.

  10. WEBSIM-COMPASS: a new generation scientific instrument simulator for the E-ELT

    Science.gov (United States)

    Puech, M.; Yang, Y.; Jégouzo, I.; Marchal, O.; Disseau, K.; Paillous, M.; Rodrigues, M.; Taburet, S.; Clénet, Y.; Gratadour, D.; Flores, H.; Hammer, F.

    2016-08-01

    We present a new scientific instrument simulator dedicated to the E-ELT named WEBSIM-COMPASS, and developed in the frame of the COMPASS project. This simulator builds on the previous series of WEBSIM simulators developed during the ESO E-ELT Design Reference Mission and Instrument Phase A studies. The WEBSIM-COMPASS observations simulator consists in a web interface coupled to an IDL code, which allows the user to perform end-to-end simulations of all E-ELT optical/NIR imagers and spectrographs foreseen for the future 39m European Extremely Large Telescope, i.e., MICADO, HARMONI, and MOSAIC. The simulation pipeline produces fake simulations in FITS format that mimic the result of a data reduction pipeline with perfectly extracted/reduced data. We give a functional description of this new simulator, emphasizing the new functionalities and current developments, and present science cases simulated used as test cases.

  11. The Increasing of Air and Biogas Mixer Instrument for Generating Friendly Environmental Electricity Power

    Science.gov (United States)

    Ketut Lasmi, Ni; Singarimbun, Alamta; Srigutomo, Wahyu

    2016-08-01

    The abolition of BBM Subsidize by the government causes increasing of its price, so a solution is necessary to find an alternative energy that is relatively cheap, environmentally friendly and affordable by all layers of society. Biogas is one of the renewable energy resources that are potential to be developed, especially in a farming area, because up until now, animal's excrement is not yet optimally used and it causes problem to environment. In response to this, one innovation to do is to make an instrument which is able to mix biogas and air by venture pipe using the basic theory of fluid mechanic, in order to raise the use of biogas as electricity source. Biogas conversion is done by changing fuel in benzene 5 kilowatt genset to biogas so it becomes a biogas genset. The biogas pressure is controlled when it enters the mixer instrument so that the velocity of biogas when it enters and it comes out the mixer is the same, and it will gain different pressure between biogas and air. By the pressure difference between biogas in the mixer instrument, biogas goes to the burning room so that the conversion of mechanical energy biogas to electricity will happen, and it will be applied as light and society's needs.

  12. The next generation of capillary electrophoresis instruments: performance of CE-SDS protein analysis.

    Science.gov (United States)

    Kahle, Julia; Maul, Kai Jorrit; Wätzig, Hermann

    2017-09-26

    Over the last decade, capillary electrophoresis gained tremendous importance, because it became an indispensible tool for the quality control of biologics, e.g. therapeutic antibodies. Consequently, there has been a continuous development within the CE market. Microchip techniques have been established in the last years. Further trends are complete solutions for specific applications by the usage of reagent kits. Step by step instructions and facilitated handling of the instruments are becoming more common. This work focuses on the sized-based protein analysis with CE-SDS. The instruments CE 7100 by Agilent Technologies, LabChip® GXII Touch HT by PerkinElmer, Maurice S. by ProteinSimple and PrinCE NextI870 by Prince Technologies have been evaluated, mainly analyzing protein mixtures of different molecular weights in long series. Published data of the PA 800 plus by SCIEX are also included in the tabled results. Precision, reliability, flexibility and speed have been identified as the most important performance parameters, others such as resolution, sensitivity, linearity, ease of use and sustainability have also been considered. All tested instruments have shown an excellent performance. Depending on application and necessities, each user can find the most appropriate one. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.

  13. Photon propagation and the VHE gamma-ray spectra of blazars: how transparent is really the Universe?

    CERN Document Server

    De Angelis, A; Persic, M; Roncadelli, M

    2008-01-01

    Recent findings by Imaging Atmospheric Cherenkov Telescopes (IACTs) suggest a transparency of the Universe to Very-High-Energy (VHE) photons beyond expectations based on realistic models of the Extragalactic Background Light. It has recently been shown that such transparency can be naturally explained by the mixing between the photon and a new very light Axion-Like Particle (ALP) predicted by many extensions of the Standard Model of elementary particles (DARMA scenario). We discuss the implications of the DARMA scenario for the observed spectra of blazars detected in the VHE band. In fact, contemplating all such blazars at once allows us to correlate the emitted and observed spectral indexes. Besides confirming the DARMA scenario in more general terms, we show that this picture automatically explains why - even starting from the same nominal value of 2.4 for the spectral index of all VHE blazars at emission - the observed spectral index predicted by the DARMA scenario reproduces the observations, becoming asy...

  14. Singer-Loomis TDI : the next generation of psychological type instrument

    Energy Technology Data Exchange (ETDEWEB)

    Dugan, S.; Wilson, K. [Calgary Univ., AB (Canada)

    2001-06-01

    This paper described the Singer-Loomis Type Development Instrument (TDI), a psychological type tool for personal and professional advancement. The key feature of the TDI is that it allows people to develop a better understanding of the challenges they face in interpersonal relationships and in teams. The TDI is also a tool to help learn competencies that will enable people to better align their skills and capacities with future challenges. Two applications of the S-L TDI were presented. Both applications have proven successful with hundreds of MBA and EMBA students. 6 refs.

  15. The optical design of GMOX: a next-generation instrument concept for Gemini

    Science.gov (United States)

    Barkhouser, Robert; Robberto, Massimo; Smee, Stephen A.; Ninkov, Zoran; Gennaro, Mario; Heckman, Timothy

    2016-08-01

    We present the optical design of GMOX, the Gemini Multi-Object eXtra-wide-band spectrograph. GMOX was selected as part of the Gemini Instrument Feasibility Study to develop capabilities and requirements for the next facility instrument (Gen4#3) for the observatory. We envision GMOX covering the entire optical/near-IR wavelength range accessible from the ground, from 3500 Å in the U band up to 2.4 μm in the K band, with nominal resolving power R≃5,000. To maximize efficiency, the bandpass is split into three spectrograph arms - blue, red, and near-infrared - with the near-infrared arm further split into three channels covering the Y+J, H, and K bands. At the heart of each arm is a Digital Micromirror Device (DMD) serving as a programmable slit array. This technology will enable GMOX to simultaneously acquire hundreds of spectra of faint sources in crowded fields with unparalleled spatial resolution, optimally adapting to both seeing-limited and diffraction limited conditions provided by ALTAIR and GeMS at Gemini North and South, respectively. Fed by GeMS at f/33, GMOX can synthesize slits as small as 40 mas (corresponding to a single HST/WFC3 CCD pixel) over its entire 85"x45" field of view. With either ALTAIR or the native telescope focal ratio of f/16, both the slit and field sizes double. In this paper we discuss the conceptual optical design of GMOX including, for each arm: the pre-slit optics, DMD slit array, off-axis Schmidt collimator, VPH grating, and refractive spectrograph and slit-viewing cameras.

  16. Recent VERITAS Results on VHE Gamma-ray Sources in Cygnus

    CERN Document Server

    Ong, Rene A

    2013-01-01

    The Cygnus region of the Galactic plane is a promising target for high-energy and very high energy (VHE) gamma-ray telescopes as it is home to many potential sources, such as supernova remnants, pulsar wind nebulae, X-ray binaries and massive star clusters. The VHE gamma-ray observatory VERITAS (Very Energetic Radiation Imaging Telescope Array System) is an array of four 12 m diameter imaging atmospheric Cherenkov telescopes located at Mt. Hopkins, AZ, USA. Over the period of 2007 to 2012, VERITAS has carried out extensive observations in the direction of Cygnus. These observations were initiated by a sky survey that covered Galactic longitudes between 67 and 82 degrees and Galactic latitudes between -1 and 4 degrees. Additional deep observations have been made near specific sources, including TeV J2032+4130, Cygnus X-3, VER J2019+407 (SNR G78.2+2.1/gamma-Cygni), CTB 87, and MGRO J2019+37. This paper summarizes the latest VERITAS results on the various source detections in the direction of Cygnus and our curr...

  17. Discovery of the hard spectrum VHE gamma-ray source HESS J1641-463

    CERN Document Server

    Abramowski, A; Benkhali, F Ait; Akhperjanian, A G; Angüner, E O; Backes, M; Balenderan, S; Balzer, A; Barnacka, A; Becherini, Y; Tjus, J Becker; Berge, D; Bernhard, S; Bernlöhr, K; Birsin, E; Biteau, J; Böttcher, M; Boisson, C; Bolmont, J; Bordas, P; Bregeon, J; Brun, F; Brun, P; Bryan, M; Bulik, T; Carrigan, S; Casanova, S; Chadwick, P M; Chakraborty, N; Chalme-Calvet, R; Chaves, R C G; Chrétien, M; Colafrancesco, S; Cologna, G; Conrad, J; Couturier, C; Cui, Y; Davids, I D; Degrange, B; Deil, C; deWilt, P; Djannati-Ataï, A; Domainko, W; Donath, A; Drury, L O'C; Dubus, G; Dutson, K; Dyks, J; Dyrda, M; Edwards, T; Egberts, K; Eger, P; Espigat, P; Farnier, C; Fegan, S; Feinstein, F; Fernandes, M V; Fernandez, D; Fiasson, A; Fontaine, G; Förster, A; Füßling, M; Gabici, S; Gajdus, M; Gallant, Y A; Garrigoux, T; Giavitto, G; Giebels, B; Glicenstein, J F; Gottschall, D; Grondin, M -H; Grudzińska, M; Hadasch, D; Häffner, S; Hahn, J; Harris, J; Heinzelmann, G; Henri, G; Hermann, G; Hervet, O; Hillert, A; Hinton, J A; Hofmann, W; Hofverberg, P; Holler, M; Horns, D; Ivascenko, A; Jacholkowska, A; Jahn, C; Jamrozy, M; Janiak, M; Jankowsky, F; Jung-Richardt, I; Kastendieck, M A; Katarzyński, K; Katz, U; Kaufmann, S; Khélifi, B; Kieffer, M; Klepser, S; Klochkov, D; Kluźniak, W; Kolitzus, D; Komin, Nu; Kosack, K; Krakau, S; Krayzel, F; Krüger, P P; Laffon, H; Lamanna, G; Lau, J; Lefaucheur, J; Lefranc, V; Lemière, A; Lemoine-Goumard, M; Lenain, J -P; Lohse, T; Lopatin, A; Lu, C -C; Marandon, V; Marcowith, A; Marx, R; Maurin, G; Maxted, N; Mayer, M; McComb, T J L; Méhault, J; Meintjes, P J; Menzler, U; Meyer, M; Mitchell, A M W; Moderski, R; Mohamed, M; Morå, K; Moulin, E; Murach, T; de Naurois, M; Niemiec, J; Nolan, S J; Oakes, L; Odaka, H; Ohm, S; Opitz, B; Ostrowski, M; Oya, I; Panter, M; Parsons, R D; Arribas, M Paz; Pekeur, N W; Pelletier, G; Petrucci, P -O; Peyaud, B; Pita, S; Poon, H; Pühlhofer, G; Punch, M; Quirrenbach, A; Raab, S; Reichardt, I; Reimer, A; Reimer, O; Renaud, M; Reyes, R de los; Rieger, F; Romoli, C; Rosier-Lees, S; Rowell, G; Rudak, B; Rulten, C B; Sahakian, V; Salek, D; Sanchez, D A; Santangelo, A; Schlickeiser, R; Schüssler, F; Schulz, A; Schwanke, U; Schwarzburg, S; Schwemmer, S; Sol, H; Spanier, F; Spengler, G; Spies, F; Stawarz, {Ł }; Steenkamp, R; Stegmann, C; Stinzing, F; Stycz, K; Sushch, I; Tavernet, J -P; Tavernier, T; Taylor, A M; Terrier, R; Tluczykont, M; Trichard, C; Valerius, K; van Eldik, C; van Soelen, B; Vasileiadis, G; Veh, J; Venter, C; Viana, A; Vincent, P; Vink, J; Völk, H J; Volpe, F; Vorster, M; Vuillaume, T; Wagner, S J; Wagner, P; Wagner, R M; Ward, M; Weidinger, M; Weitzel, Q; White, R; Wierzcholska, A; Willmann, P; Wörnlein, A; Wouters, D; Yang, R; Zabalza, V; Zaborov, D; Zacharias, M; Zdziarski, A A; Zech, A; Zechlin, H -S; Fukui, Y; Sano, H; Fukuda, T; Yoshiike, S

    2014-01-01

    This letter reports the discovery of a remarkably hard spectrum source, HESS J1641-463, by the High Energy Stereoscopic System (H.E.S.S.) in the very-high energy (VHE) domain. HESS J1641-463 remained unnoticed by the usual analysis techniques due to confusion with the bright nearby source HESS J1640-465. It emerged at a significance level of 8.5 standard deviations after restricting the analysis to events with energies above 4 TeV. It shows a moderate flux level of F(E > 1 TeV) = (3.64 +/- 0.44_stat +/- 0.73_sys) x 10^-13 cm^-2s-1, corresponding to 1.8% of the Crab Nebula flux above the same energy, and a hard spectrum with a photon index of Gamma = 2.07 +/- 0.11_stat +/- 0.20_sys. It is a point-like source, although an extension up to Gaussian width of sigma = 0.05 deg cannot be discounted due to uncertainties in the H.E.S.S. PSF. The VHE gamma-ray flux of HESS J1641-463 is found to be constant over the observed period when checking time binnings from year-by-year to the 28 min exposures timescales. HESS J16...

  18. MAGIC search for VHE $\\gamma$-ray emission from AE Aquarii in a multiwavelength context

    CERN Document Server

    Aleksić, J; Antonelli, L A; Antoranz, P; Babic, A; Bangale, P; Barrio, J A; González, J Becerra; Bednarek, W; Bernardini, E; Biasuzzi, B; Biland, A; Blanch, O; Bonnefoy, S; Bonnoli, G; Borracci, F; Bretz, T; Carmona, E; Carosi, A; Colin, P; Colombo, E; Contreras, J L; Cortina, J; Covino, S; Da Vela, P; Dazzi, F; De Angelis, A; De Caneva, G; De Lotto, B; Wilhelmi, E de Oña; Mendez, C Delgado; Doert, M; Prester, D Dominis; Dorner, D; Doro, M; Einecke, S; Eisenacher, D; Elsaesser, D; Fonseca, M V; Font, L; Frantzen, K; Fruck, C; Galindo, D; López, R J García; Garczarczyk, M; Terrats, D Garrido; Gaug, M; Godinović, N; Muñoz, A González; Gozzini, S R; Hadasch, D; Hanabata, Y; Hayashida, M; Herrera, J; Hildebrand, D; Hose, J; Hrupec, D; Idec, W; Kadenius, V; Kellermann, H; Kodani, K; Konno, Y; Krause, J; Kubo, H; Kushida, J; La Barbera, A; Lelas, D; Lewandowska, N; Lindfors, E; Lombardi, S; López, M; López-Coto, R; López-Oramas, A; Lorenz, E; Lozano, I; Makariev, M; Mallot, K; Maneva, G; Mankuzhiyil, N; Mannheim, K; Maraschi, L; Marcote, B; Mariotti, M; Martínez, M; Mazin, D; Menzel, U; Miranda, J M; Mirzoyan, R; Moralejo, A; Munar-Adrover, P; Nakajima, D; Niedzwiecki, A; Nilsson, K; Nishijima, K; Noda, K; Nowak, N; Orito, R; Overkemping, A; Paiano, S; Palatiello, M; Paneque, D; Paoletti, R; Paredes, J M; Paredes-Fortuny, X; Persic, M; Moroni, P G Prada; Prandini, E; Preziuso, S; Puljak, I; Reinthal, R; Rhode, W; Ribó, M; Rico, J; Garcia, J Rodriguez; Rügamer, S; Saggion, A; Saito, T; Saito, K; Satalecka, K; Scalzotto, V; Scapin, V; Schultz, C; Schweizer, T; Sillanpää, A; Sitarek, J; Snidaric, I; Sobczynska, D; Spanier, F; Stamatescu, V; Stamerra, A; Steinbring, T; Storz, J; Strzys, M; Takalo, L; Takami, H; Tavecchio, F; Temnikov, P; Terzić, T; Tescaro, D; Teshima, M; Thaele, J; Tibolla, O; Torres, D F; Toyama, T; Treves, A; Uellenbeck, M; Vogler, P; Wagner, R M; Zanin, R; Bogosavljevic, M; Ioannou, Z; Mauche, C W; Palaiologou, E V; Pérez-Torres, M A; Tuominen, T

    2014-01-01

    It has been claimed that the nova-like cataclysmic variable (CV) AE Aquarii (AE Aqr) is a very-high-energy (VHE, $E>$100 GeV) source both on observational and theoretical grounds. We aim to search for VHE gamma-ray emission from AE Aqr during different states of the source at several wavelengths to confirm or rule out previous claims of detection of gamma-ray emission from this object. We report on observations of AE Aqr performed by MAGIC. The source was observed during 12 hours as part of a multiwavelength campaign carried out between May and June 2012 covering the optical, X-ray, and gamma-ray ranges. Besides MAGIC, the other facilities involved were the KVA, Skinakas, and Vidojevica telescopes in the optical and Swift in X-rays. We calculated integral upper limits coincident with different states of the source in the optical. We computed upper limits to the pulsed emission limiting the signal region to 30% of the phaseogram and we also searched for pulsed emission at different frequencies applying the Ray...

  19. RES-E-NEXT: Next Generation of RES-E Policy Instruments

    Energy Technology Data Exchange (ETDEWEB)

    Miller, M.; Bird, L.; Cochran, J.; Milligan, M.; Bazilian, M. [National Renewable Energy Laboratory, Golden, CO (United States); Denny, E.; Dillon, J.; Bialek, J.; O’Malley, M. [Ecar Limited (Ireland); Neuhoff, K. [DIW Berlin (Germany)

    2013-07-04

    The RES-E-NEXT study identifies policies that are required for the next phase of renewable energy support. The study analyses policy options that secure high shares of renewable electricity generation and adequate grid infrastructure, enhance flexibility and ensure an appropriate market design. Measures have limited costs or even save money, and policies can be gradually implemented.

  20. Fourth-generation spinal instrumentation: experience with adolescent idiopathic scoliosis at a tertiary care hospital in Pakistan

    Directory of Open Access Journals (Sweden)

    Fazal A

    2012-02-01

    Full Text Available Akil Fazal1, Riaz H Lakdawala21Hospital for Joint Disease, New York University, New York, USA; 2Section of Orthopaedics, Department of Surgery, The Aga Khan University Hospital, Karachi, PakistanObjective: To evaluate the radiological and functional outcome of surgical treatment of adolescent idiopathic scoliosis using fourth-generation posterior spinal instrumentation at The Aga Khan University, Karachi, Pakistan.Design: Case series.Place and duration of study: The Aga Khan University Hospital after a minimum of 2 years postoperatively.Patients and methods: A total of 20 patients with adolescent idiopathic scoliosis were recruited into the study and evaluated for radiological and functional outcome. The study period was from 2000 to 2005. Radiological outcome was assessed using Cobb angle measurement pre and postoperatively, hence assessing percentage correction. The lower instrumented vertebra was taken as the neutral vertebra and the level was recorded. Functional outcome was determined using the Scoliosis Research Society patient administered questionnaire. All patients were called to the clinic and asked to fill in the form. Those patients who were out of the city were mailed the forms and requested via telephone to complete and return.Results: Of the 20 patients operated on, twelve were female and eight were male. The average age at operation was 12.7 years. The mean Cobb angle was 69° preoperatively and 20° postoperatively, representing a percentage correction of 71%. The average duration of follow-up was 3.6 years. There was one major complication involving neurological injury post-op and two minor complications involving wound infection. The average Scoliosis Research Society score (on a scale of 1–5, with 5 being best for pain was 4.5, self-image was 4.2, functional status was 4.1, mental status was 3.8, and satisfaction was 4.4. There was no relationship between the percentage correction of scoliosis and the functional outcome

  1. RES-E-NEXT: Next Generation of RES-E Policy Instruments

    Energy Technology Data Exchange (ETDEWEB)

    Miller, M. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Bird, L. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Cochran, J. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Milligan, M. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Bazilian, M. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Denny, E. [Ecar Limited (Ireland); Dillon, J. [Ecar Limited (Ireland); Bialek, J. [Ecar Limited (Ireland); O' Malley, M. [Ecar Limited (Ireland); Neuhoff, K. [DIW Berlin (Germany)

    2013-07-04

    The rapid deployment of renewable sources of electricity (RES-E) is transforming power systems globally. This trend is likely to continue with large increases in investment and deployment of RES-E capacity over the coming decades. Several countries now have penetration levels of variable RES-E generation (i.e., wind and solar) in excess of 15% of their annual electricity generation; and many jurisdictions (e.g., Spain, Portugal, Ireland, Germany, and Denmark; and, in the United States, Colorado) have experienced instantaneous penetration levels of more than 50% variable generation.1 These penetration levels of variable RES-E have prompted many jurisdictions to begin modifying practices that evolved in an era of readily dispatchable, centralised power systems. Providing insights for the transition to high levels of variable RES-E generation is the focus of this document, which is the final report of the RES-E-NEXT project commissioned by the International Energy Agency’s implementing agreement on Renewable Energy Technology Deployment (IEA-RETD). It presents a comprehensive assessment of issues that will shape power system evolution during the transition to high levels of variable RES-E generation. While policy will be a central tool to sustain the growth of RES-E capacity and to enable power system transitions, the scope of the report extends beyond policy considerations to include the related domains of regulation, power market design, and system operation protocols. This broad scope is in recognition that a changing resource mix with greater penetration levels of variable RES-E has broad implications for grid operations, wholesale and retail power markets, and infrastructure needs. The next decade will be a critical transition period for power system stakeholders, as global deployment of RES-E capacity (and especially variable RES-E capacity) continues to scale-up in many regions of the world. To address increased penetration levels of RES-E in power systems

  2. Identification of feigned mental retardation using the new generation of malingering detection instruments: preliminary findings.

    Science.gov (United States)

    Graue, Lili O; Berry, David T R; Clark, Jessica A; Sollman, Myriam J; Cardi, Michelle; Hopkins, Jaclyn; Werline, Dellynda

    2007-12-01

    A recent Supreme Court decision--Atkins v. Virginia, 536 U.S. 304 (2002)--prohibiting the execution of mentally retarded (MR) defendants may have raised the attractiveness of feigning this condition in the criminal justice system. Unfortunately, very few published studies have addressed the detection of feigned MR. The present report compared results from tests of intelligence, psychiatric feigning, and neurocognitive faking in a group of 26 mild MR participants (MR) and 25 demographically matched community volunteers asked to feign MR (CVM). Results showed that the CVM suppressed their IQ scores to approximate closely the level of MR participants. WAIS-III and psychiatric malingering measures were relatively ineffective at discriminating feigned from genuine MR. Although neurocognitive malingering tests were more accurate, their reduced specificity in MR participants was of potential concern. Revised cutting scores, set to maintain a Specificity rate of about .95 in MR clients, were identified, although they require cross-validation. Overall, these results suggest that new cutting scores will likely need to be validated to detect feigned MR using current malingering instruments.

  3. Discovery of extended VHE \\gamma-ray emission from the vicinity of the young massive stellar cluster Westerlund 1

    CERN Document Server

    Abramowski, A; Aharonian, F; Akhperjanian, A G; Anton, G; Balzer, A; Barnacka, A; de Almeida, U Barres; Becherini, Y; Becker, J; Behera, B; Bernlöhr, K; Birsin, E; Biteau, J; Bochow, A; Boisson, C; Bolmont, J; Bordas, P; Brucker, J; Brun, F; Brun, P; Bulik, T; Büsching, I; Carrigan, S; Casanova, S; Cerruti, M; Chadwick, P M; Charbonnier, A; Chaves, R C G; Cheesebrough, A; Chounet, L -M; Clapson, A C; Coignet, G; Cologna, G; Conrad, J; Dalton, M; Daniel, M K; Davids, I D; Degrange, B; Deil, C; Dickinson, H J; Djannati-Ataï, A; Domainko, W; Drury, L O'C; Dubois, F; Dubus, G; Dutson, K; Dyks, J; Dyrda, M; Egberts, K; Eger, P; Espigat, P; Fallon, L; Farnier, C; Fegan, S; Feinstein, F; Fernandes, M V; Fiasson, A; Fontaine, G; Förster, A; Füßling, M; Gallant, Y A; Gast, H; Gérard, L; Gerbig, D; Giebels, B; Glicenstein, J F; Glück, B; Goret, P; Göring, D; Häffner, S; Hague, J D; Hampf, D; Hauser, M; Heinz, S; Heinzelmann, G; Henri, G; Hermann, G; Hinton, J A; Hoffmann, A; Hofmann, W; Hofverberg, P; Holler, M; Horns, D; Jacholkowska, A; de Jager, O C; Jahn, C; Jamrozy, M; Jung, I; Kastendieck, M A; Katarzynski, K; Katz, U; Kaufmann, S; Keogh, D; Khangulyan, D; Khélifi, B; Klochkov, D; Kluźniak, W; Kneiske, T; Komin, Nu; Kosack, K; Kossakowski, R; Laffon, H; Lamanna, G; Lennarz, D; Lohse, T; Lopatin, A; Lu, C -C; Marandon, V; Marcowith, A; Masbou, J; Maurin, D; Maxted, N; Mayer, M; McComb, T J L; Medina, M C; Méhault, J; Moderski, R; Moulin, E; Naumann, C L; Naumann-Godo, M; de Naurois, M; Nedbal, D; Nekrassov, D; Nguyen, N; Nicholas, B; Niemiec, J; Nolan, S J; Ohm, S; Wilhelmi, E de Ona; Opitz, B; Ostrowski, M; Oya, I; Panter, M; Arribas, M Paz; Pedaletti, G; Pelletier, G; Petrucci, P -O; Pita, S; Pühlhofer, G; Punch, M; Quirrenbach, A; Raue, M; Rayner, S M; Reimer, A; Reimer, O; Renaud, M; Reyes, R de los; Rieger, F; Ripken, J; Rob, L; Rosier-Lees, S; Rowell, G; Rudak, B; Rulten, C B; Ruppel, J; Sahakian, V; Sanchez, D; Santangelo, A; Schlickeiser, R; Schöck, F M; Schulz, A; Schwanke, U; Schwarzburg, S; Schwemmer, S; Sheidaei, F; Sikora, M; Skilton, J L; Sol, H; Spengler, G; Stawarz, L; Steenkamp, R; Stegmann, C; Stinzing, F; Stycz, K; Sushch, I; Szostek, A; Tavernet, J -P; Terrier, R; Tluczykont, M; Valerius, K; van Eldik, C; Vasileiadis, G; Venter, C; Vialle, J P; Viana, A; Vincent, P; Völk, H J; Volpe, F; Vorobiov, S; Vorster, M; Wagner, S J; Ward, M; White, R; Wierzcholska, A; Zacharias, M; Zajczyk, A; Zdziarski, A A; Zech, A; Zechlin, H -S

    2011-01-01

    Results obtained in very-high-energy (VHE; E > 100 GeV) \\gamma-ray observations performed with the H.E.S.S. telescope array are used to investigate particle acceleration processes in the vicinity of the young massive stellar cluster Westerlund 1 (Wd 1). Imaging of Cherenkov light from \\gamma-ray induced particle cascades in the Earth's atmosphere is used to search for VHE \\gamma\\ rays from the region around Wd 1. Possible catalogued counterparts are searched for and discussed in terms of morphology and energetics of the H.E.S.S. source. The detection of the degree-scale extended VHE \\gamma-ray source HESS J1646-458 is reported based on 45 hours of H.E.S.S. observations performed between 2004 and 2008. The VHE \\gamma-ray source is centred on the nominal position of Wd 1 and detected with a total statistical significance of ~20\\sigma. The emission region clearly extends beyond the H.E.S.S. point-spread function (PSF). The differential energy spectrum follows a power law in energy with an index of \\Gamma=2.19 \\p...

  4. Discovery of variable VHE gamma-ray emission from the binary system 1FGL J1018.6-5856

    CERN Document Server

    :,; Aharonian, F; Benkhali, F Ait; Akhperjanian, A G; Angüner, E O; Backes, M; Balzer, A; Becherini, Y; Tjus, J Becker; Berge, D; Bernhard, S; Bernlöhr, K; Birsin, E; Blackwell, R; Böttcher, M; Boisson, C; Bolmont, J; Bordas, P; Bregeon, J; Brun, F; Brun, P; Bryan, M; Bulik, T; Carr, J; Casanova, S; Chakraborty, N; Chalme-Calvet, R; Chaves, R C G; Chen, A; Chrétien, M; Colafrancesco, S; Cologna, G; Conrad, J; Couturier, C; Cui, Y; Davids, I D; Degrange, B; Deil, C; deWilt, P; Djannati-Ataï, A; Domainko, W; Donath, A; Drury, L O'C; Dubus, G; Dutson, K; Dyks, J; Dyrda, M; Edwards, T; Egberts, K; Eger, P; Ernenwein, J -P; Espigat, P; Farnier, C; Fegan, S; Feinstein, F; Fernandes, M V; Fernandez, D; Fiasson, A; Fontaine, G; Förster, A; Füßling, M; Gabici, S; Gajdus, M; Gallant, Y A; Garrigoux, T; Giavitto, G; Giebels, B; Glicenstein, J F; Gottschall, D; Goyal, A; Grondin, M -H; Grudzińska, M; Hadasch, D; Häffner, S; Hahn, J; Hawkes, J; Heinzelmann, G; Henri, G; Hermann, G; Hervet, O; Hillert, A; Hinton, J A; Hofmann, W; Hofverberg, P; Hoischen, C; Holler, M; Horns, D; Ivascenko, A; Jacholkowska, A; Jahn, C; Jamrozy, M; Janiak, M; Jankowsky, F; Jung-Richardt, I; Kastendieck, M A; Katarzyński, K; Katz, U; Kerszberg, D; Khélifi, B; Kieffer, M; Klepser, S; Klochkov, D; Kluźniak, W; Kolitzus, D; Komin, Nu; Kosack, K; Krakau, S; Krayzel, F; Krüger, P P; Laffon, H; Lamanna, G; Lau, J; Lefaucheur, J; Lefranc, V; Lemière, A; Lemoine-Goumard, M; Lenain, J -P; Lohse, T; Lopatin, A; Lu, C -C; Lui, R; Marandon, V; Marcowith, A; Mariaud, C; Marx, R; Maurin, G; Maxted, N; Mayer, M; Meintjes, P J; Menzler, U; Meyer, M; Mitchell, A M W; Moderski, R; Mohamed, M; Morå, K; Moulin, E; Murach, T; de Naurois, M; Niemiec, J; Oakes, L; Odaka, H; Öttl, S; Ohm, S; Wilhelmi, E de Oña; Opitz, B; Ostrowski, M; Oya, I; Panter, M; Parsons, R D; Arribas, M Paz; Pekeur, N W; Pelletier, G; Petrucci, P -O; Peyaud, B; Pita, S; Poon, H; Prokoph, H; Pühlhofer, G; Punch, M; Quirrenbach, A; Raab, S; Reichardt, I; Reimer, A; Reimer, O; Renaud, M; Reyes, R de los; Rieger, F; Romoli, C; Rosier-Lees, S; Rowell, G; Rudak, B; Rulten, C B; Sahakian, V; Salek, D; Sanchez, D A; Santangelo, A; Sasaki, M; Schlickeiser, R; Schüssler, F; Schulz, A; Schwanke, U; Schwemmer, S; Seyffert, A S; Simoni, R; Sol, H; Spanier, F; Spengler, G; Spies, F; Stawarz, Ł; Steenkamp, R; Stegmann, C; Stinzing, F; Stycz, K; Sushch, I; Tavernet, J -P; Tavernier, T; Taylor, A M; Terrier, R; Tluczykont, M; Trichard, C; Valerius, K; van der Walt, J; van Eldik, C; van Soelen, B; Vasileiadis, G; Veh, J; Venter, C; Viana, A; Vincent, P; Vink, J; Voisin, F; Völk, H J; Vuillaume, T; Wagner, S J; Wagner, P; Wagner, R M; Weidinger, M; Weitzel, Q; White, R; Wierzcholska, A; Willmann, P; Wörnlein, A; Wouters, D; Yang, R; Zabalza, V; Zaborov, D; Zacharias, M; Zdziarski, A A; Zech, A; Zefi, F; Żywucka, N

    2015-01-01

    Re-observations with the H.E.S.S. telescope array of the very-high-energy (VHE) source HESS J1018-589 A coincident with the Fermi-LAT $\\gamma$-ray binary 1FGL J1018.6-5856 have resulted in a source detection significance of more than 9$\\sigma$, and the detection of variability ($\\chi^2$/$\

  5. On the possible correlation of Galactic VHE source locations and enhancements of the surface density in the Galactic plane

    CERN Document Server

    Pedaletti, G; Torres, D F

    2014-01-01

    The association of very-high energy sources with regions of the sky rich in dust and gas has been noticed in the study of individual VHE sources. However, the statistical significance of such correlation for the whole population of TeV detections has not been assessed yet. Here we present a study of the association of VHE sources in the central Galactic region with positions of enhanced material content. We obtain estimates of the material content through two classical tracers: dust emission and intensity of the $^\\textrm{12}$CO(1$\\rightarrow$0) line. We make use of the recently released all-sky maps of astrophysical foregrounds of the Planck Collaboration and of the extensive existing CO mapping of the Galactic sky. In order to test the correlation, we construct randomized samples of VHE source positions starting from the inner Galactic plane survey sources detected by the H.E.S.S. array. We find hints of a positive correlation between positions of VHE sources and regions rich in molecular material, which in...

  6. Generating a Long-Term Land Data Record from the AVHRR and MODIS Instruments

    Science.gov (United States)

    Pedelty, Jeffrey; Devadiga, Sadashiva; Masuoka, Edward; Brown, Molly; Pinzon, Jorge; Tucker, Compton; Vermote, Eric; Prince, Stephen; Nagol, Jyotheshwar; Justice, Christopher; Roy, David; Ju, Junchang; Schaaf, Crystal; Liu, Jicheng; Privette, Jeffrey; Pincheiro, Ana

    2007-01-01

    The goal of NASA's Land Long Term Iiata Record (LTDR) project is to produce a consistent long term data set from the AVHRR and MODIS instruments for land climate studies. The project will create daily surface reflectance and normalized difference vegetation index (NDVI) products at a resolution of 0.05 deg., which is identical to the Climate Modeling Grid (CMG) used for MODIS products from EOS Terra and Aqua. Higher order products such as burned area, land surface temperature, albedo, bidirectional reflectance distribution function (BRDF) correction, leaf area index (LAI), and fraction of photosyntheticalIy active radiation absorbed by vegetation (fPAR), will be created. The LTDR project will reprocess Global Area Coverage (GAC) data from AVHRR sensors onboard NOAA satellites by applying the preprocessing improvements identified in the AVHRR Pathfinder Il project and atmospheric and BRDF corrections used in MODIS processing. The preprocessing improvements include radiometric in-flight vicarious calibration for the visible and near infrared channels and inverse navigation to relate an Earth location to each sensor instantaneous field of view (IFOV). Atmospheric corrections for Rayleigh scattering, ozone, and water vapor are undertaken, with aerosol correction being implemented. The LTDR also produces a surface reflectance product for channel 3 (3.75 micrometers). Quality assessment (QA) is an integral part of the LTDR production system, which is monitoring temporal trands in the AVHRR products using time-series approaches developed for MODIS land product quality assessment. The land surface reflectance products have been evaluated at AERONET sites. The AVHRR data record from LTDR is also being compared to products from the PAL (Pathfinder AVHRR Land) and GIMMS (Global Inventory Modeling and Mapping Studies) systems to assess the relative merits of this reprocessing vis-a-vis these existing data products. The LTDR products and associated information can be found at

  7. Cyclic Fatigue Resistance and Force Generated by OneShape Instruments during Curved Canal Preparation

    Science.gov (United States)

    Zhang, Xiaolei

    2016-01-01

    Objectives To evaluate the cyclic fatigue resistance and the force generated by OneShape files during preparation of simulated curved canals. Methods Six OneShape files (the test) and six ProTaper F2 files (the control) were subject to the bending ability test. Another thirty files of each type were used to prepare artificial canals (n = 60), which were divided into 3 groups according to respective curvatures of the canals (30°, 60°, and 90°). The numbers of cycles to fatigue (NCF) as well as the positive and negative forces that were generated by files during canal preparation were recorded. The scanning electron microscopy was applied to detect the fracture surfaces. Results Compared with ProTaper F2 files, the bending loads of OneShape files were significantly lower at deflections of 45°(P ProTaper files in 30° canals. During the preparation of 30° canals by both files, the negative forces were dominant. With the increase of the curvature, more positive forces were observed. When the OneShape Files were compared with the control, significant different forces were found at D3 and D2 (P ProTaper F2 files. PMID:27513666

  8. Evidence of underground electric current generation during the 2009 L'Aquila earthquake: Real or instrumental?

    Science.gov (United States)

    Masci, F.; Thomas, J. N.

    2016-06-01

    We investigate magnetic effects in correspondence of the Mw6.1 L'Aquila earthquake. Magnetic and seismic records are analyzed. Rapid and distinct changes and an offset can be seen in magnetic field components after the main shock. We show that these effects result from electromagnetic induction due to the movement of the sensors through the Earth's magnetic field and from a permanent displacement of the sensors from their original position caused by the passing seismic waves. A transient signal in total field data from an overhauser magnetometer apparently occurs in correspondence with the earthquake. Our analysis shows that the transient was not observed by other sensors that were operating in close proximity to the overhauser. Thus, the transient signal in the total magnetic field data, and the offset in the magnetic field components, cannot be associated with a hypothetical underground electric current generated by the earthquake, as suggested by Nenovski (2015).

  9. DISCOVERY OF THE HARD SPECTRUM VHE γ-RAY SOURCE HESS J1641–463

    Energy Technology Data Exchange (ETDEWEB)

    Abramowski, A. [Institut für Experimentalphysik, Universität Hamburg, Luruper Chaussee 149, D-22761 Hamburg (Germany); Aharonian, F.; Ait Benkhali, F.; Bernlöhr, K. [Max-Planck-Institut für Kernphysik, PO Box 103980, D-69029 Heidelberg (Germany); Akhperjanian, A. G. [National Academy of Sciences of the Republic of Armenia, Marshall Baghramian Avenue, 24, 0019 Yerevan, Republic of Armenia (Armenia); Angüner, E. O.; Birsin, E. [Institut für Physik, Humboldt-Universität zu Berlin, Newtonstr. 15, D-12489 Berlin (Germany); Backes, M. [Department of Physics, University of Namibia, Private Bag 13301, Windhoek (Namibia); Balenderan, S. [Department of Physics, University of Durham, South Road, Durham DH1 3LE (United Kingdom); Balzer, A. [GRAPPA, Anton Pannekoek Institute for Astronomy, University of Amsterdam, Science Park 904, 1098 XH Amsterdam (Netherlands); Barnacka, A. [Obserwatorium Astronomiczne, Uniwersytet Jagielloński, ul. Orla 171, 30-244 Kraków (Poland); Becherini, Y. [Department of Physics and Electrical Engineering, Linnaeus University, 351 95 Växjö (Sweden); Becker Tjus, J. [Institut für Theoretische Physik, Lehrstuhl IV: Weltraum und Astrophysik, Ruhr-Universität Bochum, D-44780 Bochum (Germany); Berge, D. [GRAPPA, Anton Pannekoek Institute for Astronomy and Institute of High-Energy Physics, University of Amsterdam, Science Park 904, 1098 XH Amsterdam (Netherlands); Bernhard, S. [Institut für Astro- und Teilchenphysik, Leopold-Franzens-Universität Innsbruck, A-6020 Innsbruck (Austria); Biteau, J. [Laboratoire Leprince-Ringuet, Ecole Polytechnique, CNRS/IN2P3, F-91128 Palaiseau (France); Böttcher, M. [Centre for Space Research, North-West University, Potchefstroom 2520 (South Africa); Boisson, C., E-mail: sabrina.casanova@ifj.edu.pl, E-mail: sabrina.casanova@mpi-hd.mpg.de [LUTH, Observatoire de Paris, CNRS, Université Paris Diderot, 5 Place Jules Janssen, F-92190 Meudon (France); Collaboration: H.E.S.S. Collaboration; and others

    2014-10-10

    This Letter reports the discovery of a remarkably hard spectrum source, HESS J1641–463, by the High Energy Stereoscopic System (H.E.S.S.) in the very high energy (VHE) domain. HESS J1641–463 remained unnoticed by the usual analysis techniques due to confusion with the bright nearby source HESS J1640–465. It emerged at a significance level of 8.5 standard deviations after restricting the analysis to events with energies above 4 TeV. It shows a moderate flux level of φ(E>1 TeV) = (3.64 ± 0.44{sub stat} ± 0.73{sub sys}) × 10{sup –13} cm{sup –2} s{sup –1}, corresponding to 1.8% of the Crab Nebula flux above the same energy, and a hard spectrum with a photon index of Γ = 2.07 ± 0.11{sub stat} ± 0.20{sub sys}. It is a point-like source, although an extension up to a Gaussian width of σ = 3 arcmin cannot be discounted due to uncertainties in the H.E.S.S. point-spread function. The VHE γ-ray flux of HESS J1641–463 is found to be constant over the observed period when checking time binnings from the year-by-year to the 28 minute exposure timescales. HESS J1641–463 is positionally coincident with the radio supernova remnant SNR G338.5+0.1. No X-ray candidate stands out as a clear association; however, Chandra and XMM-Newton data reveal some potential weak counterparts. Various VHE γ-ray production scenarios are discussed. If the emission from HESS J1641–463 is produced by cosmic ray protons colliding with the ambient gas, then their spectrum must extend close to 1 PeV. This object may represent a source population contributing significantly to the galactic cosmic ray flux around the knee.

  10. Discovery of the hard spectrum VHE γ-ray source HESS J1641-463

    Energy Technology Data Exchange (ETDEWEB)

    Abramowski, A. [Univ. Hamburg (Germany). Inst. fuer Experimentalphysik; Aharonian, F. [Max-Plank-Institut fuer Kernphysik, Heidelberg (Germany); Dublin Institute for Advanced Studies (Iran, Islamic Republic of); National Academy of Sciences of the Republic Armenia, Yerevan (Armenia); Ait Benkhali, F. [Dublin Institute for Advanced Studies (Iran, Islamic Republic of); Collaboration: H.E.S.S. Collaboration; and others

    2014-10-15

    This letter reports the discovery of a remarkably hard spectrum source, HESS J1641.463, by the High Energy Stereoscopic System (H.E.S.S.) in the very high energy (VHE) domain. HESS J1641.463 remained unnoticed by the usual analysis techniques due to confusion with the bright nearby source HESS J1640.465. It emerged at a significance level of 8.5 standard deviations after restricting the analysis to events with energies above 4 TeV. It shows a moderate flux level of φ (E>1 TeV)=(3.64 ± 0.44{sub stat} ± 0.73{sub sys}) x 10{sup -13} cm{sup -2}s{sup -1}, corresponding to 1.8% of the Crab Nebula flux above the same energy, and a hard spectrum with a photon index of Γ=2.07±0.11{sub stat}±0.20{sub sys}. It is a point-like source, although an extension up to a Gaussian width of σ=3 arcmin cannot be discounted due to uncertainties in the H.E.S.S. point-spread function. The VHE γ-ray flux of HESS J1641.463 is found to be constant over the observed period when checking time binnings from the year-by-year to the 28 minute exposure timescales. HESS J1641.463 is positionally coincident with the radio supernova remnant SNR G338.5+0.1. No X-ray candidate stands out as a clear association; however, Chandra and XMM-Newton data reveal some potential weak counterparts. Various VHE γ-ray production scenarios are discussed. If the emission from HESS J1641.463 is produced by cosmic ray protons colliding with the ambient gas, then their spectrum must extend close to 1 PeV. This object may represent a source population contributing significantly to the galactic cosmic ray flux around the knee.

  11. Beyond Californium-A Neutron Generator Alternative for Dosimetry and Instrument Calibration in the U.S.

    Science.gov (United States)

    Piper, Roman K; Mozhayev, Andrey V; Murphy, Mark K; Thompson, Alan K

    2017-09-01

    Evaluations of neutron survey instruments, area monitors, and personal dosimeters rely on reference neutron radiations, which have evolved from the heavy reliance on (α,n) sources to a shared reliance on (α,n) and the spontaneous fission neutrons of californium-252 (Cf). Capable of producing high dose equivalent rates from an almost point source geometry, the characteristics of Cf are generally more favorable when compared to the use of (α,n) and (γ,n) sources or reactor-produced reference neutron radiations. Californium-252 is typically used in two standardized configurations: unmoderated, to yield a fission energy spectrum; or with the capsule placed within a heavy-water moderating sphere to produce a softened spectrum that is generally considered more appropriate for evaluating devices used in nuclear power plant work environments. The U.S. Department of Energy Cf Loan/Lease Program, a longtime origin of affordable Cf sources for research, testing and calibration, was terminated in 2009. Since then, high-activity sources have become increasingly cost-prohibitive for laboratories that formerly benefited from that program. Neutron generators, based on the D-T and D-D fusion reactions, have become economically competitive with Cf and are recognized internationally as important calibration and test standards. Researchers from the National Institute of Standards and Technology and the Pacific Northwest National Laboratory are jointly considering the practicality and technical challenges of implementing neutron generators as calibration standards in the U.S. This article reviews the characteristics of isotope-based neutron sources, possible isotope alternatives to Cf, and the rationale behind the increasing favor of electronically generated neutron options. The evaluation of a D-T system at PNNL has revealed characteristics that must be considered in adapting generators to the task of calibration and testing where accurate determination of a dosimetric quantity is

  12. Influence of water depth on the sound generated by air-bubble vibration in the water musical instrument

    Science.gov (United States)

    Ohuchi, Yoshito; Nakazono, Yoichi

    2014-06-01

    We have developed a water musical instrument that generates sound by the falling of water drops within resonance tubes. The instrument can give people who hear it the healing effect inherent in the sound of water. The sound produced by falling water drops arises from air- bubble vibrations. To investigate the impact of water depth on the air-bubble vibrations, we conducted experiments at varying values of water pressure and nozzle shape. We found that air-bubble vibration frequency does not change at a water depth of 50 mm or greater. Between 35 and 40 mm, however, the frequency decreases. At water depths of 30 mm or below, the air-bubble vibration frequency increases. In our tests, we varied the nozzle diameter from 2 to 4 mm. In addition, we discovered that the time taken for air-bubble vibration to start after the water drops start falling is constant at water depths of 40 mm or greater, but slower at depths below 40 mm.

  13. VIENTOS: a feasibility study of innovative pupil systems for the new generation of instruments in the large telescopes

    Science.gov (United States)

    García-Vargas, M. L.; Pérez-Calpena, A.; Gallego, J.; Gil de Paz, A.; Sánchez-Blanco, E.; Martínez-Delgado, I.; Maldonado Medina, M.; Zamorano Calvo, J.

    2012-09-01

    The goal of VIENTOS project is to analyze pupil innovative systems that could be used in the new generation of instruments for the large telescopes. This study tries to identify the current scientific needs, to understand why some of them have not been fulfilled yet (due to pre-conceived technical ideas or to managerial reasons) and to propose optomechanical solutions for these pupil elements that could produce a qualitative leap in the performance of the instruments to operate in the large telescopes. VIENTOS is currently on-going as a collaborative project between FRACTAL and the University Complutense of Madrid (UCM) and is being partially funded by a CDTI grant under the program Industry for Science. CDTI is the Development and Industrial Transfer Center from the Minister of Science and Innovation (Spain). Among the different innovative systems that we have carried out, our team has explored potential solutions for narrow band Imaging with tunable filters in the near-IR and a novel pupil system called sliced-pupil grating, a device designed for increasing the spectral resolution in astronomical spectrographs, without changing the geometry of the main optics. Nanotechnology customized filters to be applicable to astronomical systems are under study.

  14. VHE Gamma-Rays From Westerlund 2 And Implications for the Inferred Energetics

    Energy Technology Data Exchange (ETDEWEB)

    Reimer, O.; /Stanford U., HEPL /KIPAC, Menlo Park; Aharonian, F.; /Heidelberg, Max Planck Inst. /Dublin Inst.; Hinton, J.; /Leeds U.; Hofmann, W.; Hoppe, S.; /Heidelberg, Max Planck Inst.; Raue, M.; /Hamburg U.; Reimer, A.; /Stanford U., HEPL /KIPAC, Menlo Park

    2007-11-14

    The H.E.S.S. collaboration recently reported the discovery of VHE {gamma}-ray emission coincident with the young stellar cluster Westerlund 2. This system is known to host a population of hot, massive stars, and, most particularly, the WR binary WR 20a. Particle acceleration to TeV energies in Westerlund 2 can be accomplished in several alternative scenarios, therefore we only discuss energetic constraints based on the total available kinetic energy in the system, the actual mass loss rates of respective cluster members, and implied gamma-ray production from processes such as inverse Compton scattering or neutral pion decay. From the inferred gamma-ray luminosity of the order of 10{sup 35} erg/s, implications for the efficiency of converting available kinetic energy into non-thermal radiation associated with stellar winds in the Westerlund 2 cluster are discussed under consideration of either the presence or absence of wind clumping.

  15. Evaluating musical instruments

    Energy Technology Data Exchange (ETDEWEB)

    Campbell, D. Murray

    2014-04-01

    Scientific measurements of sound generation and radiation by musical instruments are surprisingly hard to correlate with the subtle and complex judgments of instrumental quality made by expert musicians.

  16. Discovery of extended VHE γ-ray emission from the vicinity of the young massive stellar cluster Westerlund 1

    Science.gov (United States)

    Abramowski, A.; Acero, F.; Aharonian, F.; Akhperjanian, A. G.; Anton, G.; Balzer, A.; Barnacka, A.; Barres de Almeida, U.; Becherini, Y.; Becker, J.; Behera, B.; Bernlöhr, K.; Birsin, E.; Biteau, J.; Bochow, A.; Boisson, C.; Bolmont, J.; Bordas, P.; Brucker, J.; Brun, F.; Brun, P.; Bulik, T.; Büsching, I.; Carrigan, S.; Casanova, S.; Cerruti, M.; Chadwick, P. M.; Charbonnier, A.; Chaves, R. C. G.; Cheesebrough, A.; Chounet, L.-M.; Clapson, A. C.; Coignet, G.; Cologna, G.; Conrad, J.; Dalton, M.; Daniel, M. K.; Davids, I. D.; Degrange, B.; Deil, C.; Dickinson, H. J.; Djannati-Ataï, A.; Domainko, W.; O'C. Drury, L.; Dubois, F.; Dubus, G.; Dutson, K.; Dyks, J.; Dyrda, M.; Egberts, K.; Eger, P.; Espigat, P.; Fallon, L.; Farnier, C.; Fegan, S.; Feinstein, F.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Förster, A.; Füßling, M.; Gallant, Y. A.; Gast, H.; Gérard, L.; Gerbig, D.; Giebels, B.; Glicenstein, J. F.; Glück, B.; Goret, P.; Göring, D.; Häffner, S.; Hague, J. D.; Hampf, D.; Hauser, M.; Heinz, S.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hoffmann, A.; Hofmann, W.; Hofverberg, P.; Holler, M.; Horns, D.; Jacholkowska, A.; de Jager, O. C.; Jahn, C.; Jamrozy, M.; Jung, I.; Kastendieck, M. A.; Katarzyński, K.; Katz, U.; Kaufmann, S.; Keogh, D.; Khangulyan, D.; Khélifi, B.; Klochkov, D.; Klużniak, W.; Kneiske, T.; Komin, Nu.; Kosack, K.; Kossakowski, R.; Laffon, H.; Lamanna, G.; Lennarz, D.; Lohse, T.; Lopatin, A.; Lu, C.-C.; Marandon, V.; Marcowith, A.; Masbou, J.; Maurin, D.; Maxted, N.; Mayer, M.; McComb, T. J. L.; Medina, M. C.; Méhault, J.; Moderski, R.; Moulin, E.; Naumann, C. L.; Naumann-Godo, M.; de Naurois, M.; Nedbal, D.; Nekrassov, D.; Nguyen, N.; Nicholas, B.; Niemiec, J.; Nolan, S. J.; Ohm, S.; de Oña Wilhelmi, E.; Opitz, B.; Ostrowski, M.; Oya, I.; Panter, M.; Paz Arribas, M.; Pedaletti, G.; Pelletier, G.; Petrucci, P.-O.; Pita, S.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raue, M.; Rayner, S. M.; Reimer, A.; Reimer, O.; Renaud, M.; de Los Reyes, R.; Rieger, F.; Ripken, J.; Rob, L.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Ruppel, J.; Sahakian, V.; Sanchez, D.; Santangelo, A.; Schlickeiser, R.; Schöck, F. M.; Schulz, A.; Schwanke, U.; Schwarzburg, S.; Schwemmer, S.; Sheidaei, F.; Sikora, M.; Skilton, J. L.; Sol, H.; Spengler, G.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Stycz, K.; Sushch, I.; Szostek, A.; Tavernet, J.-P.; Terrier, R.; Tluczykont, M.; Valerius, K.; van Eldik, C.; Vasileiadis, G.; Venter, C.; Vialle, J. P.; Viana, A.; Vincent, P.; Völk, H. J.; Volpe, F.; Vorobiov, S.; Vorster, M.; Wagner, S. J.; Ward, M.; White, R.; Wierzcholska, A.; Zacharias, M.; Zajczyk, A.; Zdziarski, A. A.; Zech, A.; Zechlin, H.-S.

    2012-01-01

    Results obtained in very-high-energy (VHE; E ≥ 100 GeV) γ-ray observations performed with the H.E.S.S. telescope array are used to investigate particle acceleration processes in the vicinity of the young massive stellar cluster Westerlund 1 (Wd 1). Methods. Imaging of Cherenkov light from γ-ray induced particle cascades in the Earth's atmosphere is used to search for VHE γ rays from the region around d 1. Possible catalogued counterparts are searched for and discussed in terms of morphology and energetics of the H.E.S.S. source. Results. The detection of the degree-scale extended VHE γ-ray source HESS J1646-458 is reported based on 45 h of H.E.S.S. observations performed between 2004 and 2008. The VHE γ-ray source is centred on the nominal position of Wd 1 and detected with a total statistical significance of ~20σ. The emission region clearly extends beyond the H.E.S.S. point-spread function (PSF). The differential energy spectrum follows a power law in energy with an index of Λ = 2.19 ± 0.08stat ± 0.20sys and a flux normalisation at 1 TeV of φ0 = (9.0 ± 1.4stat ± 1.8sys) × 10-12 TeV-1 cm-2 s-1. The integral flux above 0.2 TeV amounts to (5.2 ± 0.9) × 10-11 cm-2 s-1. Conclusions. Four objects coincident with HESS J1646-458 are discussed in the search of a counterpart, namely the magnetar CXOU J164710.2 - 455216, the X-ray binary 4U 1642-45, the pulsar PSR J1648-4611 and the massive stellar cluster Wd 1. In a single-source scenario, Wd 1 is favoured as site of VHE particle acceleration. Here, a hadronic parent population would be accelerated within the stellar cluster. Beside this, there is evidence for a multi-source origin, where a scenario involving PSR J1648-4611 could be viable to explain parts of the VHE γ-ray emission of HESS J1646-458.

  17. PKS 2005-489 at VHE: four years of monitoring with HESS and simultaneous multi-wavelength observations

    Science.gov (United States)

    H.E.S.S. Collaboration; Acero, F.; Aharonian, F.; Akhperjanian, A. G.; Anton, G.; Barres de Almeida, U.; Bazer-Bachi, A. R.; Becherini, Y.; Behera, B.; Benbow, W.; Bernlöhr, K.; Bochow, A.; Boisson, C.; Bolmont, J.; Borrel, V.; Brucker, J.; Brun, F.; Brun, P.; Bühler, R.; Bulik, T.; Büsching, I.; Boutelier, T.; Chadwick, P. M.; Charbonnier, A.; Chaves, R. C. G.; Cheesebrough, A.; Chounet, L.-M.; Clapson, A. C.; Coignet, G.; Costamante, L.; Dalton, M.; Daniel, M. K.; Davids, I. D.; Degrange, B.; Deil, C.; Dickinson, H. J.; Djannati-Ataï, A.; Domainko, W.; O'C. Drury, L.; Dubois, F.; Dubus, G.; Dyks, J.; Dyrda, M.; Egberts, K.; Eger, P.; Espigat, P.; Fallon, L.; Farnier, C.; Fegan, S.; Feinstein, F.; Fiasson, A.; Förster, A.; Fontaine, G.; Füßling, M.; Gabici, S.; Gallant, Y. A.; Gérard, L.; Gerbig, D.; Giebels, B.; Glicenstein, J. F.; Glück, B.; Goret, P.; Göring, D.; Hauser, M.; Heinz, S.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hoffmann, A.; Hofmann, W.; Hofverberg, P.; Holleran, M.; Hoppe, S.; Horns, D.; Jacholkowska, A.; de Jager, O. C.; Jahn, C.; Jung, I.; Katarzyński, K.; Katz, U.; Kaufmann, S.; Kerschhaggl, M.; Khangulyan, D.; Khélifi, B.; Keogh, D.; Klochkov, D.; Kluźniak, W.; Kneiske, T.; Komin, Nu.; Kosack, K.; Kossakowski, R.; Lamanna, G.; Lenain, J.-P.; Lohse, T.; Marandon, V.; Martineau-Huynh, O.; Marcowith, A.; Masbou, J.; Maurin, D.; McComb, T. J. L.; Medina, M. C.; Méhault, J.; Moderski, R.; Moulin, E.; Naumann-Godo, M.; de Naurois, M.; Nedbal, D.; Nekrassov, D.; Nicholas, B.; Niemiec, J.; Nolan, S. J.; Ohm, S.; Olive, J.-F.; de Oña Wilhelmi, E.; Orford, K. J.; Ostrowski, M.; Panter, M.; Paz Arribas, M.; Pedaletti, G.; Pelletier, G.; Petrucci, P.-O.; Pita, S.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raubenheimer, B. C.; Raue, M.; Rayner, S. M.; Renaud, M.; Rieger, F.; Ripken, J.; Rob, L.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Ruppel, J.; Sahakian, V.; Santangelo, A.; Schlickeiser, R.; Schöck, F. M.; Schwanke, U.; Schwarzburg, S.; Schwemmer, S.; Shalchi, A.; Sikora, M.; Skilton, J. L.; Sol, H.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Superina, G.; Szostek, A.; Tam, P. H.; Tavernet, J.-P.; Terrier, R.; Tibolla, O.; Tluczykont, M.; van Eldik, C.; Vasileiadis, G.; Venter, C.; Venter, L.; Vialle, J. P.; Vincent, P.; Vivier, M.; Völk, H. J.; Volpe, F.; Wagner, S. J.; Ward, M.; Zdziarski, A. A.; Zech, A.

    2010-02-01

    Aims: Our aim is to study the very high energy (VHE; E>100 GeV) γ-ray emission from BL Lac objects and the evolution in time of their broad-band spectral energy distribution (SED). Methods: VHE observations of the high-frequency peaked BL Lac object PKS 2005-489 were made with the High Energy Stereoscopic System (HESS) from 2004 through 2007. Three simultaneous multi-wavelength campaigns at lower energies were performed during the HESS data taking, consisting of several individual pointings with the XMM-Newton and RXTE satellites. Results: A strong VHE signal, ~17σ total, from PKS 2005-489 was detected during the four years of HESS observations (90.3 h live time). The integral flux above the average analysis threshold of 400 GeV is ~3% of the flux observed from the Crab Nebula and varies weakly on time scales from days to years. The average VHE spectrum measured from ~300 GeV to ~5 TeV is characterized by a power law with a photon index, Γ = 3.20± 0.16_stat± 0.10_syst. At X-ray energies the flux is observed to vary by more than an order of magnitude between 2004 and 2005. Strong changes in the X-ray spectrum (ΔΓX ≈ 0.7) are also observed, which appear to be mirrored in the VHE band. Conclusions: The SED of PKS 2005-489, constructed for the first time with contemporaneous data on both humps, shows significant evolution. The large flux variations in the X-ray band, coupled with weak or no variations in the VHE band and a similar spectral behavior, suggest the emergence of a new, separate, harder emission component in September 2005. Supported by CAPES Foundation, Ministry of Education of Brazil.Now at Harvard-Smithsonian Center for Astrophysics, Cambridge, USA.Now at W.W. Hansen Experimental Physics Laboratory & Kavli Institute for Particle Astrophysics and Cosmology, Stanford University, Stanford, USA.

  18. The Hard VHE Gamma-ray Emission in High-Redshift TeV Blazars: Comptonization of Cosmic Microwave Background Radiation in an Extended Jet?

    CERN Document Server

    Boettcher, Markus; Finke, Justin D

    2008-01-01

    Observations of very-high-energy (VHE, E > 250 GeV) gamma-ray emission from several blazars at z > 0.1 have placed stringent constraints on the elusive spectrum and intensity of the intergalactic infrared background radiation (IIBR). Correcting their observed VHE spectrum for gamma-gamma absorption even by the lowest plausible level of the IIBR provided evidence for a very hard (photon spectral index Gamma_{ph} 4 X 10^6) on kiloparsec scales along the jet.

  19. VHE observations of the gamma-ray binary system LS 5039 with H.E.S.S

    CERN Document Server

    Mariaud, C; Aharonian, F; Boettcher, M; Dubus, G; de Naurois, M; Romoli, C

    2015-01-01

    LS 5039 is a gamma-ray binary system observed in a broad energy range, from radio to TeV energies. The binary system exhibits both flux and spectral modulation as a function of its orbital period. The X-ray and very-high-energy (VHE, E > 100 GeV) gamma-ray fluxes display a maximum/minimum at inferior/superior conjunction, with spectra becoming respectively harder/softer, a behaviour that is completely reversed in the high-energy domain (HE, 0.1 10 GeV that is compatible with the low-energy tail of the TeV emission. The low 10 - 100 GeV flux, however, makes the HE and VHE components difficult to reconcile with a scenario including emission from only a single particle population. We report on new observations of LS 5039 conducted with the High Energy Stereoscopic System (H.E.S.S.) telescopes from 2006 to 2015. This new data set enables for an unprecedentedly-deep phase-folded coverage of the source at TeV energies, as well as an extension of the VHE spectral range down to ~120 GeV, which makes LS 5039 the firs...

  20. VHE γ-ray emission of PKS 2155-304: spectral and temporal variability

    Science.gov (United States)

    H.E.S.S. Collaboration; Abramowski, A.; Acero, F.; Aharonian, F.; Akhperjanian, A. G.; Anton, G.; Barres de Almeida, U.; Bazer-Bachi, A. R.; Becherini, Y. Behera, B.; Benbow, W.; Bernlöhr, K.; Bochow, A.; Boisson, C.; Bolmont, J.; Borrel, V.; Brucker, J.; Brun, F.; Brun, P.; Bühler, R.; Bulik, T.; Büsching, I.; Boutelier, T.; Chadwick, P. M.; Charbonnier, A.; Chaves, R. C. G.; Cheesebrough, A.; Chounet, L.-M.; Clapson, A. C.; Coignet, G.; Conrad, J.; Costamante, L.; Dalton, M.; Daniel, M. K.; Davids, I. D.; Degrange, B.; Deil, C.; Dickinson, H. J.; Djannati-Ataï, A.; Domainko, W.; O'C. Drury, L.; Dubois, F.; Dubus, G.; Dyks, J.; Dyrda, M.; Egberts, K.; Eger, P.; Espigat, P.; Fallon, L.; Farnier, C.; Fegan, S.; Feinstein, F.; Fernandes, M. V.; Fiasson, A.; Förster, A.; Fontaine, G.; Füßling, M.; Gabici, S.; Gallant, Y. A.; Gérard, L.; Gerbig, D.; Giebels, B.; Glicenstein, J. F.; Glück, B.; Goret, P.; Göring, D.; Hampf, D.; Hauser, M.; Heinz, S.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hoffmann, A.; Hofmann, W.; Hofverberg, P.; Holleran, M.; Hoppe, S.; Horns, D.; Jacholkowska, A.; de Jager, O. C.; Jahn, C.; Jung, I.; Katarzyński, K.; Katz, U.; Kaufmann, S.; Kerschhaggl, M.; Khangulyan, D.; Khélifi, B.; Keogh, D.; Klochkov, D.; Kluźniak, W.; Kneiske, T.; Komin, Nu.; Kosack, K.; Kossakowski, R.; Lamanna, G.; Lenain, J.-P.; Lohse, T.; Lu, C.-C.; Marandon, V.; Marcowith, A.; Masbou, J.; Maurin, D.; McComb, T. J. L.; Medina, M. C.; Méhault, J.; Moderski, R.; Moulin, E.; Naumann-Godo, M.; de Naurois, M.; Nedbal, D.; Nekrassov, D.; Nguyen, N.; Nicholas, B.; Niemiec, J.; Nolan, S. J.; Ohm, S.; Olive, J.-F.; de Oña Wilhelmi, E.; Opitz, B.; Orford, K. J.; Ostrowski, M.; Panter, M.; Paz Arribas, M.; Pedaletti, G.; Pelletier, G.; Petrucci, P.-O.; Pita, S.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raubenheimer, B. C.; Raue, M.; Rayner, S. M.; Reimer, O.; Renaud, M.; de los Reyes, R.; Rieger, F.; Ripken, J.; Rob, L.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Ruppel, J.; Ryde, F.; Sahakian, V.; Santangelo, A.; Schlickeiser, R.; Schöck, F. M.; Schönwald, A.; Schwanke, U.; Schwarzburg, S.; Schwemmer, S.; Shalchi, A.; Sushch, I.; Sikora, M.; Skilton, J. L.; Sol, H.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Superina, G.; Szostek, A.; Tam, P. H.; Tavernet, J.-P.; Terrier, R.; Tibolla, O.; Tluczykont, M.; Valerius, K.; van Eldik, C.; Vasileiadis, G.; Venter, C.; Venter, L.; Vialle, J. P.; Viana, A.; Vincent, P.; Vivier, M.; Völk, H. J.; Volpe, F.; Vorobiov, S.; Wagner, S. J.; Ward, M.; Zdziarski, A. A.; Zech, A.; Zechlin, H. S.

    2010-09-01

    Context. Observations of very high-energy γ-rays from blazars provide information about acceleration mechanisms occurring in their innermost regions. Studies of variability in these objects lead to a better understanding of the mechanisms in play. Aims: To investigate the spectral and temporal variability of VHE (>100 GeV) γ-rays of the well-known high-frequency-peaked BL Lac object PKS 2155-304 with the HESS imaging atmospheric Cherenkov telescopes over a wide range of flux states. Methods: Data collected from 2005 to 2007 were analyzed. Spectra were derived on time scales ranging from 3 years to 4 min. Light curve variability was studied through doubling timescales and structure functions and compared with red noise process simulations. Results: The source was found to be in a low state from 2005 to 2007, except for a set of exceptional flares that occurred in July 2006. The quiescent state of the source is characterized by an associated mean flux level of (4.32 ± 0.09stat ± 0.86syst) × 10-11 cm-2 s-1 above 200 GeV, or approximately 15% of the Crab Nebula, and a power-law photon index of Γ = 3.53 ± 0.06stat ± 0.10syst. During the flares of July 2006, doubling timescales of ~2 min are found. The spectral index variation is examined over two orders of magnitude in flux, yielding different behavior at low and high fluxes, which is a new phenomenon in VHE γ-ray emitting blazars. The variability amplitude characterized by the fractional rms Fvar is strongly energy-dependent and is ∝ E0.19±0.01. The light curve rms correlates with the flux. This is the signature of a multiplicative process that can be accounted for as a red noise with a Fourier index of ~2. Conclusions: This unique data set shows evidence of a low-level γ-ray emission state from PKS 2155-304 that possibly has a different origin than the outbursts. The discovery of the light curve lognormal behavior might be an indicator of the origin of aperiodic variability in blazars.

  1. Detection of VHE gamma-ray emission from the distant blazar 1ES 1101-232 with HESS and broadband characterisation

    Science.gov (United States)

    Aharonian, F.; Akhperjanian, A. G.; Bazer-Bachi, A. R.; Beilicke, M.; Benbow, W.; Berge, D.; Bernlöhr, K.; Boisson, C.; Bolz, O.; Borrel, V.; Braun, I.; Brion, E.; Brown, A. M.; Bühler, R.; Büsching, I.; Boutelier, T.; Carrigan, S.; Chadwick, P. M.; Chounet, L.-M.; Coignet, G.; Cornils, R.; Costamante, L.; Degrange, B.; Dickinson, H. J.; Djannati-Ataï, A.; O'C. Drury, L.; Dubus, G.; Egberts, K.; Emmanoulopoulos, D.; Espigat, P.; Farnier, C.; Feinstein, F.; Ferrero, E.; Fiasson, A.; Fontaine, G.; Funk, Seb.; Funk, S.; Füßling, M.; Gallant, Y. A.; Giebels, B.; Glicenstein, J. F.; Glück, B.; Goret, P.; Hadjichristidis, C.; Hauser, D.; Hauser, M.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hoffmann, A.; Hofmann, W.; Holleran, M.; Hoppe, S.; Horns, D.; Jacholkowska, A.; de Jager, O. C.; Kendziorra, E.; Kerschhaggl, M.; Khélifi, B.; Komin, Nu.; Kosack, K.; Lamanna, G.; Latham, I. J.; Le Gallou, R.; Lemière, A.; Lemoine-Goumard, M.; Lohse, T.; Martin, J. M.; Martineau-Huynh, O.; Marcowith, A.; Masterson, C.; Maurin, G.; McComb, T. J. L.; Moulin, E.; de Naurois, M.; Nedbal, D.; Nolan, S. J.; Noutsos, A.; Olive, J.-P.; Orford, K. J.; Osborne, J. L.; Panter, M.; Pelletier, G.; Petrucci, P.-O.; Pita, S.; Pühlhofer, G.; Punch, M.; Ranchon, S.; Raubenheimer, B. C.; Raue, M.; Rayner, S. M.; Ripken, J.; Rob, L.; Rolland, L.; Rosier-Lees, S.; Rowell, G.; Sahakian, V.; Santangelo, A.; Saugé, L.; Schlenker, S.; Schlickeiser, R.; Schröder, R.; Schwanke, U.; Schwarzburg, S.; Schwemmer, S.; Shalchi, A.; Sol, H.; Spangler, D.; Spanier, F.; Steenkamp, R.; Stegmann, C.; Superina, G.; Tam, P. H.; Tavernet, J.-P.; Terrier, R.; Tluczykont, M.; van Eldik, C.; Vasileiadis, G.; Venter, C.; Vialle, J. P.; Vincent, P.; Völk, H. J.; Wagner, S. J.; Ward, M.

    2007-08-01

    Context: The blazar 1ES 1101-232 was observed with the High Energy Stereoscopic System (HESS) of Atmospheric Cherenkov Telescopes (ACT) in 2004 and 2005, for a live time of 43 h. VHE (E > 1011 eV) γ-rays were detected for the first time from this object. Aims: VHE observations of blazars are used to investigate the inner parts of the blazar jets, and also to study the extragalactic background light (EBL) in the near-infrared band. Methods: Observations in 2005 were conducted in a multiwavelength campaign, together with the RXTE satellite and optical observations. In 2004, simultaneous observations with XMM-Newton were obtained. Results: 1ES 1101-232 was detected with HESS with an excess of 649 photons, at a significance of 10σ. The measured VHE γ-ray flux amounts to dN/dE = (5.63 ± 0.89) × 10-13 (E/TeV)-(2.94±0.20) cm-2 s-1 TeV-1, above a spectral energy threshold of 225 GeV. No significant variation of the VHE γ-ray flux on any time scale was found. 1ES 1101-232 exhibits a very hard spectrum, and at a redshift of z = 0.186, is the blazar with the highest confirmed redshift detected in VHE γ-rays so far. Conclusions: The data allow the construction of truly simultaneous spectral energy distributions of the source, from the optical to the VHE band. Using an EBL model with ν Fν = 14 nWm-2 sr-1 at 1.5~μm as presented in Aharonian et al. (2006a) suggests an intrinsic VHE power output peak of the source at above 3 TeV.

  2. VHE gamma-ray emission of PKS 2155-304: spectral and temporal variability

    CERN Document Server

    Abramowski, A; Aharonian, F; Akhperjanian, A G; Anton, G; de Almeida, U Barres; Bazer-Bachi, A R; Becherini, Y; Behera, B; Benbow, W; Bernlohr, K; Bochow, A; Boisson, C; Bolmont, J; Borrel, V; Brucker, J; Brun, F; Brun, P; Buhler, R; Bulik, T; Busching, I; Boutelier, T; Chadwick, P M; Charbonnier, A; Chaves, R C G; Cheesebrough, A; Conrad, J; Chounet, L -M; Clapson, A C; Coignet, G; Costamante, L; Dalton, M; Daniel, M K; Davids, I D; Degrange, B; Deil, C; Dickinson, H J; Djannati-Atai, A; Domainko, W; Drury, L O'C; Dubois, F; Dubus, G; Dyks, J; Dyrda, M; Egberts, K; Eger, P; Espigat, P; Fallon, L; Farnier, C; Fegan, S; Feinstein, F; Fernandes, M V; Fiasson, A; Foerster, A; Fontaine, G; Fussling, M; Gabici, S; Gallant, Y A; Gerard, L; Gerbig, D; Giebels, B; Glicenstein, J F; Glueck, B; Goret, P; Goering, D; Hampf, D; Hauser, M; Heinz, S; Heinzelmann, G; Henri, G; Hermann, G; Hinton, J A; Hoffmann, A; Hofmann, W; Hofverberg, P; Holleran, M; Hoppe, S; Horns, D; Jacholkowska, A; de Jager, O C; Jahn, C; Jung, I; Katarzynski, K; Katz, U; Kaufmann, S; Kerschhaggl, M; Khangulyan, D; Khelifi, B; Keogh, D; Klochkov, D; Kluzniak, W; Kneiske, T; Komin, Nu; Kosack, K; Kossakowski, R; Lamanna, G; Lenain, J -P; Lohse, T; Lu, C -C; Marandon, V; Marcowith, A; Masbou, J; Maurin, D; McComb, T J L; Medina, M C; Mehault, J; Moderski, R; Moulin, E; Naumann-Godo, M; de Naurois, M; Nedbal, D; Nekrassov, D; Nguyen, N; Nicholas, B; Niemiec, J; Nolan, S J; Ohm, S; Olive, J-F; Wilhelmi, E de Ona; Opitz, B; Orford, K J; Ostrowski, M; Panter, M; Arribas, M Paz; Pedaletti, G; Pelletier, G; Petrucci, P -O; Pita, S; Puehlhofer, G; Punch, M; Quirrenbach, A; Raubenheimer, B C; Raue, M; Rayner, S M; Reimer, O; Renaud, M; Reyes, R de los; Rieger, F; Ripken, J; Rob, L; Rosier-Lees, S; Rowell, G; Rudak, B; Rulten, C B; Ruppel, J; Ryde, F; Sahakian, V; Santangelo, A; Schlickeiser, R; Schoeck, F M; Schoenwald, A; Schwanke, U; Schwarzburg, S; Schwemmer, S; Shalchi, A; Sushch, I; Sikora, M; Skilton, J L; Sol, H; Stawarz, L; Steenkamp, R; Stegmann, C; Stinzing, F; Superina, G; Szostek, A; Tam, P H; Tavernet, J -P; Terrier, R; Tibolla, O; Tluczykont, M; Valerius, K; van Eldik, C; Vasileiadis, G; Venter, C; Venter, L; Vialle, J P; Viana, A; Vincent, P; Vivier, M; Voelk, H J; Volpe, F; Vorobiov, S; Wagner, S J; Ward, M; Zdziarski, A A; Zech, A; Zechlin, H -S

    2010-01-01

    Observations of very high energy gamma-rays from blazars provide information about acceleration mechanisms occurring in their innermost regions. Studies of variability in these objects allow a better understanding of the mechanisms at play. To investigate the spectral and temporal variability of VHE (>100 GeV) gamma-rays of the well-known high-frequency-peaked BL Lac object PKS 2155-304 with the H.E.S.S. imaging atmospheric Cherenkov telescopes over a wide range of flux states. Data collected from 2005 to 2007 are analyzed. Spectra are derived on time scales ranging from 3 years to 4 minutes. Light curve variability is studied through doubling timescales and structure functions, and is compared with red noise process simulations. The source is found to be in a low state from 2005 to 2007, except for a set of exceptional flares which occurred in July 2006. The quiescent state of the source is characterized by an associated mean flux level of 4.32 +/-0.09 x 10^-11 cm^-2 s^-1 above 200 GeV, or approximately 15% ...

  3. Study of the Shadows of the Moon and the Sun with VHE Cosmic Rays

    CERN Document Server

    Atkins, R; Berley, D; Chen, M L; Coyne, D G; Delay, R S; Dingus, B L; Dorfan, D E; Ellsworth, R W; Evans, D; Falcone, A D; Fleysher, L; Fleysher, R; Gisler, G; Goodman, J A; Haines, T J; Hoffman, C M; Hugenberger, S; Kelley, L A; Leonor, I; Macri, J R; McConnell, M; McCullough, J F; McEnery, J E; Miller, R S; Mincer, A I; Morales, M F; Némethy, P; Ryan, J M; Schneider, M; Shen, B; Shoup, A L; Sinnis, G; Smith, A J; Sullivan, G W; Thompson, T N; Tümer, T O; Wang, K; Wascko, M O; Westerhoff, S; Williams, D A; Yang, T; Yodh, G B

    1999-01-01

    Milagrito, a prototype for the Milagro detector, operated for 15 months in 1997-8 and collected 8.9 billion events. It was the first extensive air shower (EAS) array sensitive to showers intiated by primaries with energy below 1 TeV. The shadows of the sun and moon observed with cosmic rays can be used to study systematic pointing shifts and measure the angular resolution of EAS arrays. Below a few TeV, the paths of cosmic rays coming toward the earth are bent by the helio- and geo-magnetic fields. This is expected to distort and displace the shadows of the sun and the moon. The moon shadow, offset from the nominal (undeflected) position, has been observed with high statistical significance in Milagrito. This can be used to establish energy calibrations, as well as to search for the anti-matter content of the VHE cosmic ray flux. The shadow of the sun has also been observed with high significance.

  4. Demystifying an unidentified EGRET source by VHE gamma-ray observations

    CERN Document Server

    Reimer, O; Reimer, Olaf; Funk, Stefan

    2006-01-01

    In a novel approach in observational high-energy gamma-ray astronomy, observations carried out by imaging atmospheric Cherenkov telescopes provide necessary templates to pinpoint the nature of intriguing, yet unidentified EGRET gamma-ray sources. Using GeV-photons detected by CGRO EGRET and taking advantage of high spatial resolution images from H.E.S.S. observations, we were able to shed new light on the EGRET observed gamma-ray emission in the Kookaburra complex, whose previous coverage in the literature is somewhat contradictory. 3EGJ1420-6038 very likely accounts for two GeV gamma-ray sources (E>1 GeV), both in positional coincidence with the recently reported pulsar wind nebulae (PWN) by HESS in the Kookaburra/Rabbit complex. PWN associations at VHE energies, supported by accumulating evidence from observations in the radio and X-ray band, are indicative for the PSR/plerionic origin of spatially coincident, but still unidentified Galactic gamma-ray sources from EGRET. This not only supports the already s...

  5. VHE $\\Gamma$-Ray Observation of the Crab Nebula and Pulsar with MAGIC

    CERN Document Server

    Albert, J; Anderhub, H; Antoranz, P; Armada, A; Baixeras, C; Barrio, J A; Bartko, H; Bastieri, D; Becker, J K; Bednarek, W; Berger, K; Bigongiari, C; Biland, A; Böck, R K; Bordas, P; Bosch-Ramon, V; Bretz, T; Britvitch, I; Camara, M; Carmona, E; Chilingarian, A; Coarasa, J A; Commichau, S; Contreras, J L; Cortina, J; Costado, M T; Curtef, V; Danielyan, V; Dazzi, F; De Angelis, A; Delgado, C; De los Reyes, R; De Lotto, B; Domingo-Santamaria, E; Dorner, D; Doro, M; Errando, M; Fagiolini, M; Ferenc, D; Fern, E; Firpo, R; Flix, J; Fonseca, M V; Font, L; Fuchs, M; Galante, N; Garcia-Lopez, R; Garczarczyk, M; Gaug, M; Giller, M; Göbel, F; Hakobyan, D; Hayashida, M; Hengstebeck, T; Herrero, A; Höhne, D; Hose, J; Hsu, C C; Jacon, P; Jogler, T; Kosyra, R; Kranich, D; Kritzer, R; Laille, A; Lindfors, E; Lombardi, S; Longo, F; López, J; López, M; Lorenz, E; Majumdar, P; Maneva, G; Mannheim, K; Mansutti, O; Mariotti, M; Martínez, M; Mazin, D; Merck, C; Meucci, M; Meyer, M; Miranda, J M; Mirzoyan, R; Mizobuchi, S; Moralejo, A; Nieto, D; Nilsson, K; Ninkovic, J; Ona-Wilhelmi, E; Otte, N; Oya, I; Paneque, D; Panniello, M; Paoletti, R; Paredes, J M; Pasanen, M; Pascoli, D; Pauss, F; Pegna, R; Persic, M; Peruzzo, L; Piccioli, A; Poller, M; Prandini, E; Puchades, N; Raymers, A; Rhode, W; Ribó, M; Rico, J; Rissi, M; Robert, A; Rugamer, S; Saggion, A; Sánchez, A; Sartori, P; Scalzotto, V; Scapin, V; Schmitt, R; Schweizer, T; Shayduk, M; Shinozaki, K; Shore, S N; Sidro, N; Sillanpää, A; Sobczynska, D; Stamerra, A; Stark, L S; Takalo, L; Temnikov, P; Tescaro, D; Teshima, M; Tonello, N; Torres, D F; Turini, N; Vankov, H; Vitale, V; Wagner, R M; Wibig, T; Wittek, W; Zandanel, F; Zanin, R; Zapatero, J

    2007-01-01

    We report about very high energy (VHE) gamma-ray observations of the Crab Nebula with the MAGIC telescope. The gamma-ray flux from the nebula was measured between 60 GeV and 9 TeV. The energy spectrum can be described with a curved power law dF/dE=f0 (E/300 GeV)^(a+b*log10(E/300 GeV)) with a flux normalization f0 of(6.0+-0.2)*10^-10 1/(cm^2 s TeV), a=-2.31+-0.06 and b=-0.26+-0.07. The position of the IC-peak is determined at (77+-47) GeV. Within the observation time and the experimental resolution of the telescope, the gamma-ray emission is steady and pointlike. The emission's center of gravity coincides with the position of the pulsar. Pulsed gamma-ray emission from the pulsar could not be detected. We constrain the cutoff energy of the spectrum to be less than 27 GeV, assuming that the differential energy spectrum has an exponential cutoff. For a super-exponential shape, the cutoff energy can be as high as 60 GeV.

  6. A Search for VHE Emission from GRBs using the HAWC Observatory Air Shower Data

    Science.gov (United States)

    Sparks Woodle, Kathryne

    2014-03-01

    At an altitude of 4100 m near the peak of Sierra Negra in Mexico, the High Altitude Water Cherenkov Observatory (HAWC) is a second generation water Cherenkov detector that primarily looks for very high-energy gamma-rays from the galaxy and beyond. Due to its wide field of view (~2 sr) and high duty cycle, this extensive air shower detector can observe the beginning of the prompt phase of GRBs occurring overhead. HAWC is sensitive to showers in the sub-TeV to TeV energy range and will be able to help constrain the shape and cutoff of high-energy GRB spectra, especially in conjunction with observations from other detectors such as Fermi. With the design improvement and higher elevation than its predecessor Milagro, HAWC will be almost two orders of magnitude more sensitive to GRBs at 100 GeV when complete. Existing instruments identify about 5 GRBs within HAWC's field of view per month. The detector has been operated throughout construction, and we will present a search for high-energy emission from GRBs, triggered by existing instruments, using HAWC directional air shower data.

  7. A multi-criteria evaluation of policy instruments for climate change mitigation in the power generation sector of Trinidad and Tobago

    Energy Technology Data Exchange (ETDEWEB)

    Heinrich Blechinger, Philipp Friedrich, E-mail: p.blechinger@gmx.de [Department of Environmental and Economic Policy, Berlin Institute of Technology, H 50, Strasse des 17. Juni 135, Berlin 10623 (Germany); Shah, Kalim U., E-mail: kalim_shah@hotmail.com [Arthur Lok-Jack Graduate School of Business, University of the West Indies, P.O. Box 4874, Max Richards Drive, Uriah Butler Highway N.W., Mount Hope (Trinidad and Tobago); Faculty of Environmental Studies, York University, HNES 109, 4700 Keele St., Toronto, Ontario, M3J 1P3 (Canada)

    2011-10-15

    Even as small island developing states (SIDS) like Trinidad and Tobago (T and T) increase industrialization and grapple with the challenges of increased pollution, few studies provide guidance to policy makers of such countries on appropriate policy measures and instruments that can be implemented to mitigate greenhouse gas emissions. Here we apply a multi-criteria evaluation methodology to ascertain preferences for policy measures and instruments in the power generation sector. Four broad policy measures and twelve policy instruments are assessed on criteria of environmental performance, feasibility of implementation and political acceptability. This method proves useful in T and T, since typical to many SIDS, the intensive data required by other policy assessment methods is unavailable. Results indicate little difference in preference among the four policy measures thereby indicating that a multi-pronged approach on several policy fronts is required. The most preferred policy instruments to operationalize measures included provision of subsidies for energy saving technologies, creating an industry wide carbon trading scheme and implementing a feed-in tariff to increase the use of renewable energy sources. This study therefore provides specific insights for policy makers in Trinidad and Tobago while also providing power generation sector specific guidance to other rapidly industrializing small island developing states. - Highlights: > Application of the MCA as research method to evaluate policy instruments for SIDS. > Evaluation of the importance of evaluation criteria for greenhouse gas policy. > Difference in policy preferences among industry, academic and policy experts. > Results of panel evaluation of twelve greenhouse gas mitigation policy instruments. > Planning a way forward for greenhouse gas policy in Trinidad and Tobago.

  8. Evidence for VHE emission from SNR G22.7-0.2 region with H.E.S.S

    CERN Document Server

    Laffon, Hélène; Brun, Francois; Acero, Fabio; Méhault, Jérémie; Pühlhofer, Gerd; Eger, Peter; Jamrozy, Marek; Djannati-Ataï, Arache; Clapson, Andre-Claude

    2011-01-01

    Observations of the supernova remnant G22.7-0.2 in the field of view of W41 with the H.E.S.S. telescope array have resulted in evidence for a very high energy (VHE) gamma-ray emission from the direction of the object. The emission region is spatially coincident with molecular clouds visible in 13CO data, suggesting a hadronic origin of the TeV emission, although other scenarios brought by X-ray observations with the XMM-Newton satellite are also discussed. The latest results obtained on this SNR with H.E.S.S. and associated multi-wavelength information are presented here.

  9. Upper limits on the VHE $\\gamma$-ray flux from the ULIRG Arp 220 and other galaxies with VERITAS

    CERN Document Server

    Fleischhack, Henrike

    2015-01-01

    The cores of ultra-luminous infrared galaxies (ULIRGs) are very dense environments, with a high rate of star formation and supernova explosions. They are thought to be sites of cosmic-ray acceleration, and are predicted to emit $\\gamma$-rays in the GeV to TeV range. So far, no ULIRG has been detected in $\\gamma$-rays. Arp 220, the closest ULIRG to Earth, has been well studied, and detailed models of $\\gamma$-ray production in this galaxy are available. They predict a rather hard $\\gamma$-ray spectrum up to several TeV. Due to its large rate of star formation, high gas density, and its close proximity to Earth, Arp 220 is thought to be a very good candidate for observations in very-high-energy (VHE; 100 GeV - 100 TeV) $\\gamma$-rays. Arp 220 was observed by the VERITAS telescopes for more than 30 hours with no significant excess over the cosmic-ray background. The upper limits on the VHE $\\gamma$-ray flux of Arp 220 derived from these observations are the most sensitive limits presented so far and are starting ...

  10. On the Spectral Curvature of VHE Blazar 1ES 1011+496: Effect of Spatial Particle Diffusion

    Science.gov (United States)

    Sinha, Atreyee; Sahayanathan, S.; Acharya, B. S.; Anupama, G. C.; Chitnis, V. R.; Singh, B. B.

    2017-02-01

    A detailed multi-epoch study of the broadband spectral behavior of the very high energy (VHE) source 1ES 1011+496 provides us with valuable information regarding the underlying particle distribution. Simultaneous observations of the source at optical/UV/X-ray/γ-ray during three different epochs, as obtained from Swift-UVOT/Swift-XRT/Fermi-LAT, are supplemented with the information available from the VHE telescope array, HAGAR. The long-term flux variability at the Fermi-LAT energies is clearly found to be lognormal. It is seen that the broadband spectral energy distribution of 1ES 1011+496 can be successfully reproduced by synchrotron and synchrotron self Compton emission models. Notably, the observed curvature in the photon spectrum at X-ray energies demands a smooth transition of the underlying particle distribution from a simple power law to a power law with an exponential cutoff, or a smooth broken power law distribution, which may possibly arise when the escape of the particles from the main emission region is energy dependent. Specifically, if the particle escape rate is related to its energy as {E}0.5, then the observed photon spectrum is consistent with the ones observed during the various epochs.

  11. On the spectral curvature of VHE blazar 1ES\\,1011+496: Effect of spatial particle diffusion

    CERN Document Server

    Sinha, Atreyee; Acharya, B S; Anupama, G C; Chitnis, V R; Singh, B B

    2016-01-01

    A detailed multi-epoch study of the broadband spectral behaviour of the very high energy (VHE) source, 1ES\\,1011+496, provides us with valuable information regarding the underlying particle distribution. Simultaneous observations of the source at optical/ UV/ X-ray/ $\\gamma$-ray during three different epochs, as obtained from Swift-UVOT/ Swift-XRT/ Fermi-LAT, are supplemented with the information available from the VHE telescope array, HAGAR. The longterm flux variability at the Fermi-LAT energies is clearly found to be lognormal. It is seen that the broadband spectral energy distribution (SED) of 1ES\\,1011+496 can be successfully reproduced by synchrotron and synchrotron self Compton emission models. Notably, the observed curvature in the photon spectrum at X-ray energies demands a smooth transition of the underlying particle distribution from a simple power law to a power law with an exponential cutoff or a smooth broken power law distribution, which may possibly arise when the escape of the particles from ...

  12. Integrated photonic building blocks for next-generation astronomical instrumentation II: the multimode to single mode transition

    CERN Document Server

    Spaleniak, Izabela; Gross, Simon; Ireland, Michael J; Lawrence, Jon S; Withford, Michael J

    2013-01-01

    There are numerous advantages to exploiting diffraction-limited instrumentation at astronomical observatories, which include smaller footprints, less mechanical and thermal instabilities and high levels of performance. To realize such instrumentation it is imperative to convert the atmospheric seeing-limited signal that is captured by the telescope into a diffraction-limited signal. This process can be achieved photonically by using a mode reformatting device known as a photonic lantern that performs a multimode to single-mode transition. With the aim of developing an optimized integrated photonic lantern, we undertook a systematic parameter scan of devices fabricated by the femtosecond laser direct-write technique. The devices were designed for operation around 1.55 {\\mu}m. The devices showed (coupling and transition) losses of less than 5% for F/# $\\geq$ 12 injection and the total device throughput (including substrate absorption) as high as 75-80%. Such devices show great promise for future use in astronom...

  13. Methods and apparatus for cleaning objects in a chamber of an optical instrument by generating reactive ions using photon radiation

    Energy Technology Data Exchange (ETDEWEB)

    Klebanoff, Leonard E.; Delgado, Gildardo R.; Hollenshead, Jeromy T.; Umstadter, Karl R.; Starodub, Elena; Zhuang, Guorong V.

    2015-10-13

    An optical instrument, including a chamber, an object exposed to an interior of the chamber, a source of low-pressure gas, the gas comprising at least one of low-pressure molecular hydrogen gas, low-pressure molecular oxygen and a low-pressure noble gas, the source of low pressure gas being fluidly coupled to the chamber, a low voltage source electrically coupled between the object and a remaining portion of the instrument that is exposed to the interior of the chamber so as to maintain the object at a low voltage relative to the remaining portion, and an EUV/VUV light source adapted to direct EUV/VUV light through the low pressure gas in the chamber onto the object. In such a system, when the EUV/VUV light source is activated ions of the low-pressure gas are formed and directed to the object. The ions may be ions of Hydrogen, Oxygen or a noble gas.

  14. Integrated photonic building blocks for next-generation astronomical instrumentation II: the multimode to single mode transition.

    Science.gov (United States)

    Spaleniak, Izabela; Jovanovic, Nemanja; Gross, Simon; Ireland, Michael J; Lawrence, Jon S; Withford, Michael J

    2013-11-04

    There are numerous advantages to exploiting diffraction-limited instrumentation at astronomical observatories, which include smaller footprints, less mechanical and thermal instabilities and high levels of performance. To realize such instrumentation it is imperative to convert the atmospheric seeing-limited signal that is captured by the telescope into a diffraction-limited signal. This process can be achieved photonically by using a mode reformatting device known as a photonic lantern that performs a multimode to single-mode transition. With the aim of developing an optimized integrated photonic lantern, we undertook a systematic parameter scan of devices fabricated by the femtosecond laser direct-write technique. The devices were designed for operation around 1.55 μm. The devices showed (coupling and transition) losses of less than 5% for F/# ≥ 12 injection and the total device throughput (including substrate absorption) as high as 75-80%. Such devices show great promise for future use in astronomy.

  15. Detection of VHE gamma-ray emission from the distant blazar 1ES 1101-232 with H.E.S.S. and broadband characterisation

    CERN Document Server

    Akhperjanian, A G; Beilicke, M; Benbow, W; Berge, D; Bernlöhr, K; Boisson, C; Bolz, O; Borrel, V; Braun, I; Brion, E; Brown, A M; Buhler, R; Büsching, I; Boutelier, T; Carrigan, S; Chadwick, P M; Chounet, L M; Coignet, G; Cornils, R; Costamante, L; Degrange, B; Dickinson, H J; Djannati-Atai, A; O'Connor-Drury, L; Dubus, G; Egberts, K; Emmanoulopoulos, D; Espigat, P; Farnier, C; Feinstein, F; Ferrero, E; Fiasson, A; Fontaine, G; Funk, Seb; Funk, S; Fussling, M; Gallant, Y A; Giebels, B; Glicenstein, J F; Glück, B; Goret, P; Hadjichristidis, C; Hauser, D; Hauser, M; Heinzelmann, G; Henri, G; Hermann, G; Hinton, J A; Hoffmann, A; Hofmann, W; Holleran, M; Hoppe, S; Horns, D; Jacholkowska, A; De Jager, O C; Kendziorra, E; Kerschhaggl, M; Khelifi, B; Komin, Nu; Kosack, K; Lamanna, G; Latham, I J; Le Gallou, R; Lemiere, A; Lemoine-Goumard, M; Lohse, T; Martin, J M; Martineau-Huynh, O; Marcowith, A; Masterson, C; Maurin, G; McComb, T J L; Moulin, E; De Naurois, Mathieu; Nedbal, D; Nolan, S J; Noutsos, A; Olive, J P; Orford, K J; Osborne, J L; Panter, M; Pelletier, G; Petrucci, P O; Pita, S; Pühlhofer, G; Punch, M; Ranchon, S; Raubenheimer, B C; Raue, M; Rayner, S M; Ripken, J; Rob, L; Rolland, L; Rosier-Lees, S; Rowell, G; Sahakian, V V; Santangelo, A; Sauge, L; Schlenker, S; Schlickeiser, R; Schroder, R; Schwanke, U; Schwarzburg, S; Schwemmer, S; Shalchi, A; Sol, H; Spangler, D; Spanier, F; Steenkamp, R; Stegmann, C; Superina, G; Tam, P H; Tavernet, J P; Terrier, R; Tluczykont, M; Van Eldik, C; Vasileiadis, G; Venter, C; Vialle, J P; Vincent, P; Völk, H J; Wagner, S J; Ward, M

    2007-01-01

    The blazar 1ES 1101-232 was observed with the High Energy Stereoscopic System (H.E.S.S.) of Atmospheric Cherenkov Telescopes (ACT) in 2004 and 2005, for a live time of 43 hours. VHE (E > 10^11 eV) gamma-rays were detected for the first time from this object. VHE observations of blazars are used to investigate the inner parts of the blazar jets, and also to study the extragalactic background light (EBL) in the near-infrared band. Observations in 2005 were conducted in a multiwavelength campaign, together with the RXTE satellite and optical observations. In 2004, simultaneous observations with XMM-Newton were obtained. 1ES 1101-232 was detected with H.E.S.S. with an excess of 722 photons, at a significance of 12 sigma. The measured VHE gamma-ray flux amounts to dN/dE = (5.63 +- 0.89) x 10^-13 (E/TeV)^-(2.94 +- 0.20) cm^-2 s^-1 TeV^-1, above a spectral energy threshold of 225 GeV. No significant variation of the VHE gamma-ray flux on any time scale was found. 1ES 1101-232 exhibits a very hard spectrum, and at a ...

  16. Extended VHE $\\gamma$-ray emission towards SGR1806$-$20, LBV1806$-$20, and stellar cluster Cl*1806$-$20

    CERN Document Server

    Abdalla, H; Aharonian, F; Benkhali, F Ait; Akhperjanian, A G; Angüner, E O; Arrieta, M; Aubert, P; Backes, M; Balzer, A; Barnard, M; Becherini, Y; Tjus, J Becker; Berge, D; Bernhard, S; Bernlöhr, K; Birsin, E; Blackwell, R; Böttcher, M; Boisson, C; Bolmont, J; Bordas, P; Bregeon, J; Brun, F; Brun, P; Bryan, M; Bulik, T; Capasso, M; Carr, J; Casanova, S; Chakraborty, N; Chalme-Calvet, R; Chaves, R C G; Chen, A; Chevalier, J; Chrétien, M; Colafrancesco, S; Cologna, G; Condon, B; Conrad, J; Couturier, C; Cui, Y; Davids, I D; Degrange, B; Deil, C; deWilt, P; Djannati-Ataï, A; Domainko, W; Donath, A; Drury, L O'C; Dubus, G; Dutson, K; Dyks, J; Dyrda, M; Edwards, T; Egberts, K; Eger, P; Ernenwein, J -P; Eschbach, S; Farnier, C; Fegan, S; Fernandes, M V; Fiasson, A; Fontaine, G; Förster, A; Funk, S; Füßling, M; Gabici, S; Gajdus, M; Gallant, Y A; Garrigoux, T; Giavitto, G; Giebels, B; Glicenstein, J F; Gottschall, D; Goyal, A; Grondin, M -H; Grudzińska, M; Hadasch, D; Hahn, J; Hawkes, J; Heinzelmann, G; Henri, G; Hermann, G; Hervet, O; Hillert, A; Hinton, J A; Hofmann, W; Hoischen, C; Holler, M; Horns, D; Ivascenko, A; Jacholkowska, A; Jamrozy, M; Janiak, M; Jankowsky, D; Jankowsky, F; Jingo, M; Jogler, T; Jouvin, L; Jung-Richardt, I; Kastendieck, M A; Katarzyński, K; Katz, U; Kerszberg, D; Khélifi, B; Kieffer, M; King, J; Klepser, S; Klochkov, D; Kluźniak, W; Kolitzus, D; Komin, Nu; Kosack, K; Krakau, S; Kraus, M; Krayzel, F; Krüger, P P; Laffon, H; Lamanna, G; Lau, J; Lees, J -P; Lefaucheur, J; Lefranc, V; Lemière, A; Lemoine-Goumard, M; Lenain, J -P; Leser, E; Lohse, T; Lorentz, M; Liu, R; Lypova, I; Marandon, V; Marcowith, A; Mariaud, C; Marx, R; Maurin, G; Maxted, N; Mayer, M; Meintjes, P J; Menzler, U; Meyer, M; Mitchell, A M W; Moderski, R; Mohamed, M; Morå, K; Moulin, E; Murach, T; de Naurois, M; Niederwanger, F; Niemiec, J; Oakes, L; Odaka, H; Öttl, S; Ohm, S; Ostrowski, M; Oya, I; Padovani, M; Panter, M; Parsons, R D; Arribas, M Paz; Pekeur, N W; Pelletier, G; Petrucci, P -O; Peyaud, B; Pita, S; Poon, H; Prokhorov, D; Prokoph, H; Pühlhofer, G; Punch, M; Quirrenbach, A; Raab, S; Reimer, A; Reimer, O; Renaud, M; Reyes, R de los; Rieger, F; Romoli, C; Rosier-Lees, S; Rowell, G; Rudak, B; Rulten, C B; Sahakian, V; Salek, D; Sanchez, D A; Santangelo, A; Sasaki, M; Schlickeiser, R; Schüssler, F; Schulz, A; Schwanke, U; Schwemmer, S; Seyffert, A S; Shafi, N; Shilon, I; Simoni, R; Sol, H; Spanier, F; Spengler, G; Spies, F; Stawarz, L; Steenkamp, R; Stegmann, C; Stinzing, F; Stycz, K; Sushch, I; Tavernet, J -P; Tavernier, T; Taylor, A M; Terrier, R; Tluczykont, M; Trichard, C; Tuffs, R; van der Walt, J; van Eldik, C; van Soelen, B; Vasileiadis, G; Veh, J; Venter, C; Viana, A; Vincent, P; Vink, J; Voisin, F; Völk, H J; Vuillaume, T; Wadiasingh, Z; Wagner, S J; Wagner, P; Wagner, R M; White, R; Wierzcholska, A; Willmann, P; Wörnlein, A; Wouters, D; Yang, R; Zabalza, V; Zaborov, D; Zacharias, M; Zdziarski, A A; Zech, A; Zefi, F; Ziegler, A; Zywucka, N

    2016-01-01

    Using the High Energy Spectroscopic System (H.E.S.S.) telescopes we have discovered a steady and extended very high-energy (VHE) $\\gamma$-ray source towards the luminous blue variable candidate LBV1806$-$20, massive stellar cluster Cl*1806$-$20, and magnetar SGR1806$-$20. The new VHE source, HESSJ1808$-$204, was detected at a statistical significance of $>6\\sigma$ (post-trial) with a photon flux normalisation $(2.9 \\pm 0.4_{\\rm stat} \\pm 0.5_{\\rm sys})\\times 10^{-13}$\\,ph\\,cm$^{-2}$\\,s$^{-1}$\\,TeV$^{-1}$ at 1\\,TeV and a power-law photon index of $2.3\\pm0.2_{\\rm stat}\\pm 0.3_{\\rm sys}$. The luminosity of this source (0.2 to 10 TeV; scaled to distance $d$=8.7\\,kpc) is $L_{\\rm VHE}\\sim1.6 \\times 10^{34}(d/{\\rm 8.7\\, kpc})^2$\\,erg\\,s$^{-1}$. The VHE $\\gamma$-ray emission is extended and is well fit by a single Gaussian with statistical standard deviation of $0.095^\\circ \\pm 0.015^\\circ$. This extension is similar to that of the synchrotron radio nebula G10.0$-$0.3, which is thought to be powered by LBV1806$-$20. ...

  17. Determination of PV Generator I-V/P-V Characteristic Curves Using a DC-DC Converter Controlled by a Virtual Instrument

    Directory of Open Access Journals (Sweden)

    E. Durán

    2012-01-01

    Full Text Available A versatile measurement system for systematic testing and measurement of the evolution of the I-V characteristic curves of photovoltaic panels or arrays (PV generators is proposed in this paper. The measurement system uses a circuit solution based on DC-DC converters that involves several advantages relative to traditional methods: simple structure, scalability, fast response, and low cost. The measurement of the desired characteristics of PV generators includes high speed of response and high fidelity. The prototype system built is governed by a microcontroller, and experimental results prove the proposed measurement system useful. A virtual instrument (VI was developed for full system control from a computer. The developed system enables monitoring the suitable operation of a PV generator in real time, since it allows comparing its actual curves with those provided by the manufacturer.

  18. Virtual instrumentation of a laboratory synchronous generator with LabVIEW; Instrumentacion virtual de un generador sincrono de laboratorio con LabVIEW

    Energy Technology Data Exchange (ETDEWEB)

    Uribe Fernandez, Uriel

    2003-07-01

    On this work measurement algorithms for variables from a synchronous generator are developed and implemented, in open architecture by means of virtual instrument in real time with the Laboratory Virtual Instrument Engineering Workbench (LabBIEW) that it is a development atmosphere based on the graphic programming. The main program menu of the virtual instrumentation has three options of measurement: The first option is a program that carries out the three phase measurement of: tension RMS, current RMS, magnitude, phase angle, power factor, apparent, active and reactive power and the graphic of these signals. The second option is a program that carries out the measurement of load angle from the synchronous generator. This measurement is made through the Fast Fourier Transformed (FFT), obtaining the voltage terminal, magnitude and phase angle with respect to the rotor position reference. This measurement varies from synchronous generator, operation conditions. The speed angle measurement is obtained from the load angle changes. These measurements are presented in graphic form in the time, with a virtual instrument type needle and in digital form. The range of load angle is +/- 180 degrees. The third option is a program that carries out the measurement of the load angle against active power (curve d-W), from the synchronous machine. [Spanish] En este trabajo se desarrollan e implementan algoritmos de medicion para variables de un generador sincrono, en arquitectura abierta, por medio de la instrumentacion virtual en tiempo real con el uso del Laboratory Virtual Instrument Engineering Workbench (LabVIEW) que es un ambiente de desarrollo basado en la programacion grafica. El programa principal menu de la instrumentacion virtual tiene tres opciones de medicion: La primera opcion es un programa que realiza la medicion trifasica de tension RMS, corriente RMS, magnitud, angulo de fase, factor de potencia, potencia aparente, activa y reactiva, y la graficacion de estas

  19. Effectiveness of Student-Generated Video as a Teaching Tool for an Instrumental Technique in the Organic Chemistry Laboratory

    Science.gov (United States)

    Jordan, Jeremy T.; Box, Melinda C.; Eguren, Kristen E.; Parker, Thomas A.; Saraldi-Gallardo, Victoria M.; Wolfe, Michael I.; Gallardo-Williams, Maria T.

    2016-01-01

    Multimedia instruction has been shown to serve as an effective learning aid for chemistry students. In this study, the viability of student-generated video instruction for organic chemistry laboratory techniques and procedure was examined and its effectiveness compared to instruction provided by a teaching assistant (TA) was evaluated. After…

  20. Search for an extended VHE gamma-ray emission from Mrk 421 and Mrk 501 with the MAGIC Telescope

    CERN Document Server

    Aleksić, J; Antoranz, P; Backes, M; Baixeras, C; Barrio, J A; Bastieri, D; González, J Becerra; Bednarek, W; Berdyugin, A; Berger, K; Bernardini, E; Biland, A; Blanch, O; Bock, R K; Bonnoli, G; Bordas, P; Tridon, D Borla; Bosch-Ramon, V; Bose, D; Braun, I; Bretz, T; Britzger, D; Camara, M; Carmona, E; Carosi, A; Colin, P; Commichau, S; Contreras, J L; Cortina, J; Costado, M T; Covino, S; Dazzi, F; De Angelis, A; del Pozo, E De Cea; Reyes, R De los; De Lotto, B; De Maria, M; De Sabata, F; Mendez, C Delgado; Doert, M; Domínguez, A; Prester, D Dominis; Dorner, D; Doro, M; Elsaesser, D; Errando, M; Ferenc, D; Fonseca, M V; Font, L; López, R J García; Garczarczyk, M; Gaug, M; Godinovic, N; Hadasch, D; Herrero, A; Hildebrand, D; Höhne-Mönch, D; Hose, J; Hrupec, D; Hsu, C C; Jogler, T; Klepser, S; Krähenbühl, T; Kranich, D; La Barbera, A; Laille, A; Leonardo, E; Lindfors, E; Lombardi, S; Longo, F; López, M; Lorenz, E; Majumdar, P; Maneva, G; Mankuzhiyil, N; Mannheim, K; Maraschi, L; Mariotti, M; Martínez, M; Mazin, D; Meucci, M; Miranda, J M; Mirzoyan, R; Miyamoto, H; Moldón, J; Moles, M; Moralejo, A; Nieto, D; Nilsson, K; Ninkovic, J; Orito, R; Oya, I; Paiano, S; Paoletti, R; Paredes, J M; Partini, S; Pasanen, M; Pascoli, D; Pauss, F; Pegna, R G; Perez-Torres, M A; Persic, M; Peruzzo, L; Prada, F; Prandini, E; Puchades, N; Puljak, I; Reichardt, I; Rhode, W; Ribó, M; Rico, J; Rissi, M; Rügamer, S; Saggion, A; Saito, T Y; Salvati, M; Sánchez-Conde, M; Satalecka, K; Scalzotto, V; Scapin, V; Schultz, C; Schweizer, T; Shayduk, M; Shore, S N; Sierpowska-Bartosik, A; Sillanpää, A; Sitarek, J; Sobczynska, D; Spanier, F; Spiro, S; Stamerra, A; Steinke, B; Struebig, J C; Suric, T; Takalo, L; Tavecchio, F; Temnikov, P; Terzic, T; Tescaro, D; Teshima, M; Torres, D F; Vankov, H; Wagner, R M; Weitzel, Q; Zabalza, V; Zandanel, F; Zanin, R; Neronov, A; Semikoz, D V

    2010-01-01

    Context: Part of the very high energy $\\gamma$-ray radiation coming from extragalactic sources is absorbed through the pair production process on the extragalactic background light photons. Extragalactic magnetic fields alter the trajectories of these cascade pairs and, in turn, convert cosmic background photons to gamma-ray energies by inverse Compton scattering. These secondary photons can form an extended halo around bright VHE sources. Aims: We searched for an extended emission around the bright blazars Mrk 421 and Mrk 501 using the MAGIC telescope data. Methods: If extended emission is present, the angular distribution of reconstructed gamma-ray arrival directions around the source is broader than for a point-like source. In the analysis of a few tens of hours of observational data taken from Mrk 421 and Mrk 501 we used a newly developed method that provides better angular resolution. This method is based on the usage of multidimensional decision trees. Comparing the measured shapes of angular distributi...

  1. The Equilibrium Coefficient Kp and Petroleum Exploration:Design of the New Generation of Petroleum Exploration Instrument

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    The main reason why the application of nuclear technology in petroleum exploration has not yet been accepted by most exploration workers is that they are not clear about the homologous distribution features of oil and gas fields and radioactive radiation. The authors hold that the disequilibrium of uranium, radium and radon as a natural radioactive series is the basic feature in the use of this technology in petroleum exploration. The invention Gamma-ray Spectral Measurement of the Equilibium Coefficient Kp and Its Embodiment of the senior author now can readily solve that problem and replace the impedient measure of normalization of uranium and potassium to thorium that had to be proposed before. Application of this impedient measure has some limitations. In areas where the surface is covered by beach or river sands, thorium minerals such as monazite may be concentrated by placering. This could result in local thorium highs that would yield local uranium and potassium lows after normalization to thorium, and these would constitute false anomalies.This paper elucidates the relation between the equilibrium coefficient Kp and petroleum exploration and points out that immediately over petroleum the radioactive equilibrium is biased with uranium, while at peripheries of the petroleum reservoir the equilibrium is biased with radium; therefore, the true uranium content immediately over petroleum is not lower but higher, and by constrast the uranium content at peripheries of the petroleum reservoir is not higher but lower. This paper further introduces the main technical requirements for the instrument used in petroleum exploration with nuclear technology and the design basis and work procedure of the petroleum-field effective equilibrium coefficient ground detector and finally introduces the applicability of the detector in petroleum exploration through the distribution features of the equilibrium coefficient Kp of five types of trap-type petroleum deposits.

  2. Optical design and modelling of the QUBIC instrument, a next-generation quasi-optical bolometric interferometer for cosmology

    Science.gov (United States)

    Scully, S.; Burke, D.; O'Sullivan, C.; Gayer, D.; Gradziel, M.; Murphy, J. A.; De Petris, M.; Buzi, D.; Zannoni, M.; Mennella, A.; Gervasi, M.; Tartari, A.; Maffei, B.; Aumont, J.; Banfi, S.; Battaglia, P.; Battistelli, E. S.; Baó, A.; Bélier, B.; Bennet, D.; Bergé, L.; Bernard, J.-Ph.; Bersanelli, M.; Bigot-Sazy, M.-A.; Bleurvacq, N.; Bordier, G.; Brossard, J.; Bunn, E. F.; Cammileri, D.; Cavaliere, F.; Chanial, P.; Chapron, C.; Coppolecchia, A.; Couchot, F.; D'Alessandro, G.; De Bernardis, P.; Decourcelle, T.; Del Torto, F.; Dumoulin, L.; Franceschet, C.; Gault, A.; Ghribi, A.; Giard, M.; Giraud-Héraud, Y.; Grandsire, L.; Hamilton, J. C.; Haynes, V.; Henrot-Versillé, S.; Holtzer, N.; Kaplan, J.; Korotkov, A.; Lande, J.; Lowitz, A.; Marnieros, S.; Martino, J.; Masi, S.; McCulloch, Mark; Melhuish, Simon; Montier, L.; Néel, D.; Ng, M. W.; Pajot, F.; Passerini, A.; Perbost, C.; Perdereau, O.; Piacentini, F.; Piat, M.; Piccirillo, L.; Pisano, G.; Prêle, D.; Puddu, R.; Rambaud, D.; Rigaut, O.; Salatino, M.; Schillaci, A.; Stolpovskiy, M.; Timbie, P.; Tristram, M.; Tucker, G.; Viganò, D.; Voisin, F.; Watson, B.

    2016-07-01

    Big Bang cosmologies predict that the cosmic microwave background (CMB) contains faint temperature and polarisation anisotropies imprinted in the early universe. ESA's PLANCK satellite has already measured the temperature anisotropies1 in exquisite detail; the next ambitious step is to map the primordial polarisation signatures which are several orders of magnitude lower. Polarisation E-modes have been measured2 but the even-fainter primordial B-modes have so far eluded detection. Their magnitude is unknown but it is clear that a sensitive telescope with exceptional control over systematic errors will be required. QUBIC3 is a ground-based European experiment that aims to exploit the novel concept of bolometric interferometry in order to measure B-mode polarisation anisotropies in the CMB. Beams from an aperture array of corrugated horns will be combined to form a synthesised image of the sky Stokes parameters on two focal planes: one at 150 GHz the other at 220 GHz. In this paper we describe recent optical modelling of the QUBIC beam combiner, concentrating on modelling the instrument point-spread-function and its operation in the 220-GHz band. We show the effects of optical aberrations and truncation as successive components are added to the beam path. In the case of QUBIC, the aberrations introduced by off-axis mirrors are the dominant contributor. As the frequency of operation is increased, the aperture horns allow up to five hybrid modes to propagate and we illustrate how the beam pattern changes across the 25% bandwidth. Finally we describe modifications to the QUBIC optical design to be used in a technical demonstrator, currently being manufactured for testing in 2016.

  3. Development of non-hybridised HgCdTe detectors for the next generation of astronomical instrumentation

    Science.gov (United States)

    Dalton, Gavin B.; Dennis, Peter N.; Lees, David J.; Hall, David J.; Cairns, John W.; Gordon, Neil T.; Hails, Janet E.; Giess, Jean

    2008-07-01

    The superb image quality that is predicted, and even demanded, for the next generation of Extremely Large Telescopes (ELT) presents a potential crisis in terms of the sheer number of detectors that may be required. Developments in infrared technology have progressed dramatically in recent years, but a substantial reduction in the cost per pixel of these IR arrays will be necessary to permit full exploitation of the capabilities of these telescopes. Here we present an outline and progress report of an initiative to develop a new generation of astronomical grade Cadmium Mercury Telluride (HgCdTe) array detectors using a novel technique which enables direct growth of the sensor diodes onto the Read Out Integrated Circuit (ROIC). This technique removes the need to hybridise the detector material to a separate Silicon readout circuit and provides a route to very large monolithic arrays. We present preliminary growth and design simulation results for devices based on this technique, and discuss the prospects for deployment of this technology in the era of extremely large telescopes.

  4. Validation of the mother-generated index in Iran: A specific postnatal quality-of-life instrument

    Directory of Open Access Journals (Sweden)

    Roghayeh Khabiri

    2013-01-01

    Full Text Available Background: The mother-generated index (MGI is one of only a few existing specific questionnaires for assessing the postnatal quality of life (QoL. MGI is a single-form questionnaire that asks postnatal mothers to specify up to eight areas of their lives which have been affected by giving birth to a baby. Using this tool, it is possible to score and rank the QoL of mothers. This study aimed to validate the questionnaire for use in Iran. Methods : Forward translation was used to translate the questionnaire from English to Farsi (Persian. The questionnaire was then administered to a sample of postnatal women attending two teaching hospitals in Tehran, Iran. Face validity and criterion validity were performed to establish the validity for the Iranian version of the MGI. Face validity was assessed by asking women to indicate whether they understood the wording of the questions, how easy the questionnaire was, and so on. Criterion validity was examined using the Short Form 36-item (SF-36 Health Survey. It was hypothesized that the MGI would significantly correlate with the SF-36. Results: In all, 124 women were approached. Of these, 119 women were eligible and 96 women agreed to take part in the study. Face validity was good and all of the women found the MGI straightforward to complete; as criterion validity, the MGI scores and the subscales of the SF-36 were moderately correlated (for all subscales: Pearson r > 0.4; P < 0.001. The mean MGI primary score was 5.38 (SD = 3.05. Women who had comorbidity had significantly lower MGI scores than women without comorbidity (P = 0.04. Correlation between aggregate of comments and primary score was high (r = 0.68, P < 0.01. Conclusions: In general, the Iranian version of the MGI performed well and our data suggest that it is a valid measure to assess health-related QoL among postnatal women.

  5. Discovery of VHE γ-rays from the blazar 1ES 1215+303 with the MAGIC telescopes and simultaneous multi-wavelength observations

    Science.gov (United States)

    Aleksić, J.; Alvarez, E. A.; Antonelli, L. A.; Antoranz, P.; Ansoldi, S.; Asensio, M.; Backes, M.; Barres de Almeida, U.; Barrio, J. A.; Bastieri, D.; Becerra González, J.; Bednarek, W.; Berger, K.; Bernardini, E.; Biland, A.; Blanch, O.; Bock, R. K.; Boller, A.; Bonnoli, G.; Borla Tridon, D.; Bretz, T.; Cañellas, A.; Carmona, E.; Carosi, A.; Colin, P.; Colombo, E.; Contreras, J. L.; Cortina, J.; Cossio, L.; Covino, S.; Da Vela, P.; Dazzi, F.; De Angelis, A.; De Caneva, G.; De Cea del Pozo, E.; De Lotto, B.; Delgado Mendez, C.; Diago Ortega, A.; Doert, M.; Domínguez, A.; Dominis Prester, D.; Dorner, D.; Doro, M.; Eisenacher, D.; Elsaesser, D.; Ferenc, D.; Fonseca, M. V.; Font, L.; Fruck, C.; García López, R. J.; Garczarczyk, M.; Garrido Terrats, D.; Gaug, M.; Giavitto, G.; Godinović, N.; González Muñoz, A.; Gozzini, S. R.; Hadasch, D.; Häfner, D.; Herrero, A.; Hildebrand, D.; Hose, J.; Hrupec, D.; Huber, B.; Jankowski, F.; Jogler, T.; Kadenius, V.; Kellermann, H.; Klepser, S.; Krähenbühl, T.; Krause, J.; La Barbera, A.; Lelas, D.; Leonardo, E.; Lewandowska, N.; Lindfors, E.; Lombardi, S.; López, M.; López-Coto, R.; López-Oramas, A.; Lorenz, E.; Makariev, M.; Maneva, G.; Mankuzhiyil, N.; Mannheim, K.; Maraschi, L.; Mariotti, M.; Martínez, M.; Mazin, D.; Meucci, M.; Miranda, J. M.; Mirzoyan, R.; Moldón, J.; Moralejo, A.; Munar-Adrover, P.; Niedzwiecki, A.; Nieto, D.; Nilsson, K.; Nowak, N.; Orito, R.; Paiano, S.; Paneque, D.; Paoletti, R.; Pardo, S.; Paredes, J. M.; Partini, S.; Perez-Torres, M. A.; Persic, M.; Pilia, M.; Pochon, J.; Prada, F.; Prada Moroni, P. G.; Prandini, E.; Puerto Gimenez, I.; Puljak, I.; Reichardt, I.; Reinthal, R.; Rhode, W.; Ribó, M.; Rico, J.; Rügamer, S.; Saggion, A.; Saito, K.; Saito, T. Y.; Salvati, M.; Satalecka, K.; Scalzotto, V.; Scapin, V.; Schultz, C.; Schweizer, T.; Shore, S. N.; Sillanpää, A.; Sitarek, J.; Snidaric, I.; Sobczynska, D.; Spanier, F.; Spiro, S.; Stamatescu, V.; Stamerra, A.; Steinke, B.; Storz, J.; Strah, N.; Sun, S.; Surić, T.; Takalo, L.; Takami, H.; Tavecchio, F.; Temnikov, P.; Terzić, T.; Tescaro, D.; Teshima, M.; Tibolla, O.; Torres, D. F.; Treves, A.; Uellenbeck, M.; Vogler, P.; Wagner, R. M.; Weitzel, Q.; Zabalza, V.; Zandanel, F.; Zanin, R.; Berdyugin, A.; Buson, S.; Järvelä, E.; Larsson, S.; Lähteenmäki, A.; Tammi, J.

    2012-08-01

    Context. We present the discovery of very high energy (VHE, E > 100 GeV) γ-ray emission from the BL Lac object 1ES 1215+303 by the MAGIC telescopes and simultaneous multi-wavelength data in a broad energy range from radio to γ-rays. Aims: We study the VHE γ-ray emission from 1ES 1215+303 and its relation to the emissions in other wavelengths. Methods: Triggered by an optical outburst, MAGIC observed the source in 2011 January - February for 20.3 h. The target was monitored in the optical R-band by the KVA telescope that also performed optical polarization measurements. We triggered target of opportunity observations with the Swift satellite and obtained simultaneous and quasi-simultaneous data from the Fermi Large Area Telescope and from the Metsähovi radio telescope. We also present the analysis of older MAGIC data taken in 2010. Results: The MAGIC observations of 1ES 1215+303 carried out in 2011 January - February resulted in the first detection of the source at VHE with a statistical significance of 9.4σ. Simultaneously, the source was observed in a high optical and X-ray state. In 2010 the source was observed in a lower state in optical, X-ray, and VHE, while the GeV γ-ray flux and the radio flux were comparable in 2010 and 2011. The spectral energy distribution obtained with the 2011 data can be modeled with a simple one zone SSC model, but it requires extreme values for the Doppler factor or the electron energy distribution.

  6. Discovery of VHE gamma-ray emission from the BL Lac object B3 2247+381 with the MAGIC telescopes

    CERN Document Server

    Aleksić, J; Antonelli, L A; Antoranz, P; Asensio, M; Backes, M; Barrio, J A; Bastieri, D; González, J Becerra; Bednarek, W; Berdyugin, A; Berger, K; Bernardini, E; Biland, A; Blanch, O; Bock, R K; Boller, A; Bonnoli, G; Tridon, D Borla; Braun, I; Bretz, T; Cañellas, A; Carmona, E; Carosi, A; Colin, P; Colombo, E; Contreras, J L; Cortina, J; Cossio, L; Covino, S; Dazzi, F; De Angelis, A; De Caneva, G; del Pozo, E De Cea; De Lotto, B; Mendez, C Delgado; Ortega, A Diago; Doert, M; Domínguez, A; Prester, D Dominis; Dorner, D; Doro, M; Elsaesser, D; Ferenc, D; Fonseca, M V; Font, L; Fruck, C; López, R J García; Garczarczyk, M; Garrido, D; Giavitto, G; Godinović, N; Hadasch, D; Häfner, D; Herrero, A; Hildebrand, D; Höhne-Mönch, D; Hose, J; Hrupec, D; Huber, B; Jogler, T; Kellermann, H; Klepser, S; Krähenbühl, T; Krause, J; La Barbera, A; Lelas, D; Leonardo, E; Lindfors, E; Lombardi, S; López, M; López-Oramas, A; Lorenz, E; Makariev, M; Maneva, G; Mankuzhiyil, N; Mannheim, K; Maraschi, L; Mariotti, M; Martínez, M; Mazin, D; Meucci, M; Miranda, J M; Mirzoyan, R; Miyamoto, H; Moldón, J; Moralejo, A; Munar-Adrover, P; Nieto, D; Nilsson, K; Orito, R; Oya, I; Paneque, D; Paoletti, R; Pardo, S; Paredes, J M; Partini, S; Pasanen, M; Pauss, F; Perez-Torres, M A; Persic, M; Peruzzo, L; Pilia, M; Pochon, J; Prada, F; Moroni, P G Prada; Prandini, E; Puljak, I; Reichardt, I; Reinthal, R; Rhode, W; Ribó, M; Rico, J; Rügamer, S; Saggion, A; Saito, K; Saito, T Y; Salvati, M; Satalecka, K; Scalzotto, V; Scapin, V; Schultz, C; Schweizer, T; Shayduk, M; Shore, S N; Sillanpää, A; Sitarek, J; Snidaric, I; Sobczynska, D; Spanier, F; Spiro, S; Stamatescu, V; Stamerra, A; Steinke, B; Storz, J; Strah, N; Surić, T; Takalo, L; Takami, H; Tavecchio, F; Temnikov, P; Terzić, T; Tescaro, D; Teshima, M; Tibolla, O; Torres, D F; Treves, A; Uellenbeck, M; Vankov, H; Vogler, P; Wagner, R M; Weitzel, Q; Zabalza, V; Zandanel, F; Zanin, R; Kadenius, V; Weidinger, M; Buson, S

    2012-01-01

    We study the non-thermal jet emission of the BL Lac object B3 2247+381 during a high optical state. The MAGIC telescopes observed the source during 13 nights between September 30th and October 30th 2010, collecting a total of 14.2 hours of good quality very high energy (VHE) $\\gamma$-ray data. Simultaneous multiwavelength data was obtained with X-ray observations by the Swift satellite and optical R-band observations at the KVA-telescope. We also use high energy $\\gamma$-ray (HE, 0.1 GeV-100 GeV) data from the Fermi satellite. The BL Lac object B3 2247+381 (z=0.119) was detected, for the first time, at VHE $\\gamma$-rays at a statistical significance of 5.6 $\\sigma$. A soft VHE spectrum with a photon index of -3.2 $\\pm$ 0.6 was determined. No significant short term flux variations were found. We model the spectral energy distribution using a one-zone SSC-model, which can successfully describe our data.

  7. Discovery of VHE \\gamma-ray emission and multi-wavelength observations of the BL Lac object 1RXS J101015.9-311909

    CERN Document Server

    Abramowski, A; Aharonian, F; Akhperjanian, A G; Anton, G; Balzer, A; Barnacka, A; Becherini, Y; Becker, J; Bernlöhr, K; Birsin, E; Biteau, J; Bochow, A; Boisson, C; Bolmont, J; Bordas, P; Brucker, J; Brun, F; Brun, P; Bulik, T; Büsching, I; Carrigan, S; Casanova, S; Cerruti, M; Chadwick, P M; Charbonnier, A; Chaves, R C G; Cheesebrough, A; Cologna, G; Conrad, J; Dalton, M; Daniel, M K; Davids, I D; Degrange, B; Deil, C; Dickinson, H J; Djannati-Ataï, A; Domainko, W; Drury, L O'C; Dubus, G; Dutson, K; Dyks, J; Dyrda, M; Egberts, K; Eger, P; Espigat, P; Fallon, L; Fegan, S; Feinstein, F; Fernandes, M V; Fiasson, A; Fontaine, G; Förster, A; Füßling, M; Gallant, Y A; Gast, H; Gérard, L; Gerbig, D; Giebels, B; Glicenstein, J F; Glück, B; Göring, D; Häffner, S; Hague, J D; Hahn, J; Hampf, D; Harris, J; Hauser, M; Heinz, S; Heinzelmann, G; Henri, G; Hermann, G; Hillert, A; Hinton, J A; Hofmann, W; Hofverberg, P; Holler, M; Horns, D; Jacholkowska, A; de Jager, O C; Jahn, C; Jamrozy, M; Jung, I; Kastendieck, M A; Katarzyński, K; Katz, U; Kaufmann, S; Keogh, D; Khélifi, B; Klochkov, D; Kluźniak, W; Kneiske, T; Komin, Nu; Kosack, K; Kossakowski, R; Krayzel, F; Laffon, H; Lamanna, G; Lenain, J -P; Lennarz, D; Lohse, T; Lopatin, A; Lu, C -C; Marandon, V; Marcowith, A; Masbou, J; Maxted, N; Mayer, M; McComb, T J L; Medina, M C; Méhault, J; Moderski, R; Mohamed, M; Moulin, E; Naumann, C L; Naumann-Godo, M; de Naurois, M; Nedbal, D; Nekrassov, D; Nguyen, N; Nicholas, B; Niemiec, J; Nolan, S J; Ohm, S; Wilhelmi, E de Oña; Opitz, B; Ostrowski, M; Oya, I; Panter, M; Arribas, M Paz; Pekeur, N W; Pelletier, G; Perez, J; Petrucci, P -O; Peyaud, B; Pita, S; Pühlhofer, G; Punch, M; Quirrenbach, A; Raue, M; Rayner, S M; Reimer, A; Reimer, O; Renaud, M; Reyes, R de los; Rieger, F; Ripken, J; Rob, L; Rosier-Lees, S; Rowell, G; Rudak, B; Rulten, C B; Sahakian, V; Sanchez, D A; Santangelo, A; Schlickeiser, R; Schulz, A; Schwanke, U; Schwarzburg, S; Schwemmer, S; Sheidaei, F; Skilton, J L; Sol, H; Spengler, G; Stawarz, Ł; Steenkamp, R; Stegmann, C; Stinzing, F; Stycz, K; Sushch, I; Szostek, A; Tavernet, J -P; Terrier, R; Tluczykont, M; Valerius, K; van Eldik, C; Vasileiadis, G; Venter, C; Viana, A; Vincent, P; Völk, H J; Volpe, F; Vorobiov, S; Vorster, M; Wagner, S J; Ward, M; White, R; Wierzcholska, A; Zacharias, M; Zajczyk, A; Zdziarski, A A; Zech, A; Zechlin, H -S

    2012-01-01

    1RXS J101015.9-311909 is a galaxy located at a redshift of z=0.14 hosting an active nucleus belonging to the class of bright BL Lac objects. Observations at high (HE, E > 100 MeV) and very high (VHE, E > 100 GeV) energies provide insights into the origin of very energetic particles present in such sources and the radiation processes at work. We report on results from VHE observations performed between 2006-10 with H.E.S.S. H.E.S.S. data have been analysed with enhanced analysis methods, making the detection of faint sources more significant. VHE emission at a position coincident with 1RXS J101015.9-311909 is detected with H.E.S.S. for the first time. In a total good-quality livetime of about 49 h, we measure 263 excess counts, corresponding to a significance of 7.1\\sigma. The photon spectrum above 0.2 TeV can be described by a power-law with a photon index of \\Gamma\\ = 3.08\\pm0.42_{stat}\\pm0.20_{sys}. The integral flux above 0.2 TeV is about 0.8% of the flux of the Crab nebula and shows no significant variabi...

  8. Discovery of VHE γ-ray emission from the BL Lacertae object B3 2247+381 with the MAGIC telescopes

    Science.gov (United States)

    Aleksić, J.; Alvarez, E. A.; Antonelli, L. A.; Antoranz, P.; Asensio, M.; Backes, M.; Barrio, J. A.; Bastieri, D.; Becerra González, J.; Bednarek, W.; Berdyugin, A.; Berger, K.; Bernardini, E.; Biland, A.; Blanch, O.; Bock, R. K.; Boller, A.; Bonnoli, G.; Borla Tridon, D.; Braun, I.; Bretz, T.; Cañellas, A.; Carmona, E.; Carosi, A.; Colin, P.; Colombo, E.; Contreras, J. L.; Cortina, J.; Cossio, L.; Covino, S.; Dazzi, F.; de Angelis, A.; de Caneva, G.; de Cea Del Pozo, E.; de Lotto, B.; Delgado Mendez, C.; Diago Ortega, A.; Doert, M.; Domínguez, A.; Dominis Prester, D.; Dorner, D.; Doro, M.; Elsaesser, D.; Ferenc, D.; Fonseca, M. V.; Font, L.; Fruck, C.; García López, R. J.; Garczarczyk, M.; Garrido, D.; Giavitto, G.; Godinović, N.; Hadasch, D.; Häfner, D.; Herrero, A.; Hildebrand, D.; Höhne-Mönch, D.; Hose, J.; Hrupec, D.; Huber, B.; Jogler, T.; Kellermann, H.; Klepser, S.; Krähenbühl, T.; Krause, J.; La Barbera, A.; Lelas, D.; Leonardo, E.; Lindfors, E.; Lombardi, S.; López, M.; López-Oramas, A.; Lorenz, E.; Makariev, M.; Maneva, G.; Mankuzhiyil, N.; Mannheim, K.; Maraschi, L.; Mariotti, M.; Martínez, M.; Mazin, D.; Meucci, M.; Miranda, J. M.; Mirzoyan, R.; Miyamoto, H.; Moldón, J.; Moralejo, A.; Munar-Adrover, P.; Nieto, D.; Nilsson, K.; Orito, R.; Oya, I.; Paneque, D.; Paoletti, R.; Pardo, S.; Paredes, J. M.; Partini, S.; Pasanen, M.; Pauss, F.; Perez-Torres, M. A.; Persic, M.; Peruzzo, L.; Pilia, M.; Pochon, J.; Prada, F.; Prada Moroni, P. G.; Prandini, E.; Puljak, I.; Reichardt, I.; Reinthal, R.; Rhode, W.; Ribó, M.; Rico, J.; Rügamer, S.; Saggion, A.; Saito, K.; Saito, T. Y.; Salvati, M.; Satalecka, K.; Scalzotto, V.; Scapin, V.; Schultz, C.; Schweizer, T.; Shayduk, M.; Shore, S. N.; Sillanpää, A.; Sitarek, J.; Snidaric, I.; Sobczynska, D.; Spanier, F.; Spiro, S.; Stamatescu, V.; Stamerra, A.; Steinke, B.; Storz, J.; Strah, N.; Surić, T.; Takalo, L.; Takami, H.; Tavecchio, F.; Temnikov, P.; Terzić, T.; Tescaro, D.; Teshima, M.; Tibolla, O.; Torres, D. F.; Treves, A.; Uellenbeck, M.; Vankov, H.; Vogler, P.; Wagner, R. M.; Weitzel, Q.; Zabalza, V.; Zandanel, F.; Zanin, R.; Kadenius, V.; Weidinger, M.; Buson, S.

    2012-03-01

    Aims: We study the non-thermal jet emission of the BL Lac object B3 2247+381 during a high optical state. Methods: The MAGIC telescopes observed the source during 13 nights between September 30th and October 30th 2010, collecting a total of 14.2 h of good quality very high energy (VHE) γ-ray data. Simultaneous multiwavelength data was obtained with X-ray observations by the Swift satellite and optical R-band observations at the KVA-telescope. We also use high energy γ-ray (HE, 0.1-100 GeV) data from the Fermi satellite. Results: The BL Lac object B3 2247+381 (z = 0.119) was detected, for the first time, at VHE γ-rays at a statistical significance of 5.6σ. A soft VHE spectrum with a photon index of -3.2 ± 0.6 was determined. No significant short term flux variations were found. We model the spectral energy distribution using a one-zone SSC-model, which can successfully describe our data.

  9. Discovery of VHE gamma-rays from the blazar 1ES 1215+303 with the MAGIC Telescopes and simultaneous multi-wavelength observations

    CERN Document Server

    Aleksić, J; Antonelli, L A; Antoranz, P; Asensio, M; Backes, M; de Almeida, U Barres; Barrio, J A; Bastieri, D; González, J Becerra; Bednarek, W; Berger, K; Bernardini, E; Biland, A; Blanch, O; Bock, R K; Boller, A; Bonnoli, G; Tridon, D Borla; Bretz, T; Cañellas, A; Carmona, E; Carosi, A; Colin, P; Colombo, E; Contreras, J L; Cortina, J; Cossio, L; Covino, S; Da Vela, P; Dazzi, F; De Angelis, A; De Caneva, G; del Pozo, E De Cea; De Lotto, B; Mendez, C Delgado; Ortega, A Diago; Doert, M; Domínguez, A; Prester, D Dominis; Dorner, D; Doro, M; Eisenacher, D; Elsaesser, D; Ferenc, D; Fonseca, M V; Font, L; Fruck, C; López, R J García; Garczarczyk, M; Terrats, D Garrido; Giavitto, G; Godinović, N; Muñoz, A González; Gozzini, S R; Hadasch, D; Häfner, D; Herrero, A; Hildebrand, D; Hose, J; Hrupec, D; Huber, B; Jankowski, F; Jogler, T; Kadenius, V; Kellermann, H; Klepser, S; Krähenbühl, T; Krause, J; La Barbera, A; Lelas, D; Leonardo, E; Lewandowska, N; Lindfors, E; Lombardi, S; López, M; López-Coto, R; López-Oramas, A; Lorenz, E; Makariev, M; Maneva, G; Mankuzhiyil, N; Mannheim, K; Maraschi, L; Mariotti, M; Martínez, M; Mazin, D; Meucci, M; Miranda, J M; Mirzoyan, R; Moldón, J; Moralejo, A; Munar-Adrover, P; Niedzwiecki, A; Nieto, D; Nilsson, K; Nowak, N; Orito, R; Paiano, S; Paneque, D; Paoletti, R; Pardo, S; Paredes, J M; Partini, S; Perez-Torres, M A; Persic, M; Pilia, M; Pochon, J; Prada, F; Moroni, P G Prada; Prandini, E; Gimenez, I Puerto; Puljak, I; Reichardt, I; Reinthal, R; Rhode, W; Ribó, M; Rico, J; Rügamer, S; Saggion, A; Saito, K; Saito, T Y; Salvati, M; Satalecka, K; Scalzotto, V; Scapin, V; Schultz, C; Schweizer, T; Shore, S N; Sillanpää, A; Sitarek, J; Snidaric, I; Sobczynska, D; Spanier, F; Spiro, S; Stamatescu, V; Stamerra, A; Steinke, B; Storz, J; Strah, N; Sun, S; Surić, T; Takalo, L; Takami, H; Tavecchio, F; Temnikov, P; Terzić, T; Tescaro, D; Teshima, M; Tibolla, O; Torres, D F; Treves, A; Uellenbeck, M; Vogler, P; Wagner, R M; Weitzel, Q; Zabalza, V; Zandanel, F; Zanin, R; Berdyugin, A; Buson, S; Järvelä, E; Larsson, S; Lähteenmäki, A; Tammi, J; de Lausanne, now at: Ecole polytechnique fédérale; Lausanne,; Switzerland,; Padova, supported by INFN; Energéticas, now at: Centro de Investigaciones; Tecnológicas, Medioambientales y; Madrid,; Spain,; KIPAC, now at:; Laboratory, SLAC National Accelerator; USA,; ESO, now at: Finnish Centre for Astronomy with; Turku, University of; Finland,; Observatory, Aalto University Metsähovi Radio; Metsähovintie,; Finland,; Physics, Department of; University, Stockholm; Stockholm,; Sweden,; Physics, The Oskar Klein Centre for Cosmoparticle; Stockholm,; Sweden,; Astronomy, Department of; University, Stockholm; Stockholm,; Sweden),

    2012-01-01

    Context. We present the discovery of very high energy (VHE, E > 100GeV) gamma-ray emission from the BL Lac object 1ES 1215+303 by the MAGIC telescopes and simultaneous multi-wavelength data in a broad energy range from radio to gamma-rays. Aims. We study the VHE gamma-ray emission from 1ES 1215+303 and its relation to the emissions in other wavelengths. Methods. Triggered by an optical outburst, MAGIC observed the source in January-February 2011 for 20.3 hrs. The target was monitored in the optical R-band by the KVA telescope that also performed optical polarization measurements. We triggered target of opportunity observations with the Swift satellite and obtained simultaneous and quasi-simultaneous data from the Fermi Large Area Telescope and from the Mets\\"ahovi radio telescope. We also present the analysis of older MAGIC data taken in 2010. Results. The MAGIC observations of 1ES 1215+303 carried out in January-February 2011 resulted in the first detection of the source at VHE with a statistical significanc...

  10. Triggered searches of delayed or extended VHE GRB emissions with HAWC

    Science.gov (United States)

    Becerril, A. D.; González, M. M.; Alfaro, J. R.

    2017-01-01

    The High Altitude Water Cherenkov (HAWC) gamma-ray observatory, installed at an altitude of 4100 m asl in the state of Puebla, Mexico, has recently completed its first year of full operations. Thanks to its instantaneous field of view of 2 sr and to its high duty cycle (≥ 95%), HAWC is an ideal instrument for detecting transients such as gamma ray bursts (GRBs) with emissions in the TeV regime, thus complementing the observations by satellites. In this work we focus on triggered offline searches for high energy emission from GRBs reported by the Fermi-LAT, and Swift instruments. We show our results on searches for delayed TeV emissions, as well as for emissions longer than T90 in the HAWC data from its first year of operations.

  11. Optimization of chemical and instrumental parameters in hydride generation laser-induced breakdown spectrometry for the determination of arsenic, antimony, lead and germanium in aqueous samples.

    Science.gov (United States)

    Yeşiller, Semira Unal; Yalçın, Serife

    2013-04-03

    A laser induced breakdown spectrometry hyphenated with on-line continuous flow hydride generation sample introduction system, HG-LIBS, has been used for the determination of arsenic, antimony, lead and germanium in aqueous environments. Optimum chemical and instrumental parameters governing chemical hydride generation, laser plasma formation and detection were investigated for each element under argon and nitrogen atmosphere. Arsenic, antimony and germanium have presented strong enhancement in signal strength under argon atmosphere while lead has shown no sensitivity to ambient gas type. Detection limits of 1.1 mg L(-1), 1.0 mg L(-1), 1.3 mg L(-1) and 0.2 mg L(-1) were obtained for As, Sb, Pb and Ge, respectively. Up to 77 times enhancement in detection limit of Pb were obtained, compared to the result obtained from the direct analysis of liquids by LIBS. Applicability of the technique to real water samples was tested through spiking experiments and recoveries higher than 80% were obtained. Results demonstrate that, HG-LIBS approach is suitable for quantitative analysis of toxic elements and sufficiently fast for real time continuous monitoring in aqueous environments.

  12. Generations.

    Science.gov (United States)

    Chambers, David W

    2005-01-01

    Groups naturally promote their strengths and prefer values and rules that give them an identity and an advantage. This shows up as generational tensions across cohorts who share common experiences, including common elders. Dramatic cultural events in America since 1925 can help create an understanding of the differing value structures of the Silents, the Boomers, Gen Xers, and the Millennials. Differences in how these generations see motivation and values, fundamental reality, relations with others, and work are presented, as are some applications of these differences to the dental profession.

  13. Systematic search for VHE gamma-ray emission from X-ray bright high-frequency BL Lac objects

    CERN Document Server

    Albert, J

    2007-01-01

    Motivated by the fact that all but two (M87, BL Lac) extragalactic sources detected so far at VHE energies belong to the so-called HBL class of high-frequency peaked BL Lac objects, a systematic scan of the compilation of X-ray blazars by Donato et al. (2001) has been performed using the MAGIC telescope. The observations took place from December 2004 to March 2006 and cover sources on the northern sky visible under small zenith distances zd 2uJy) sources emitting at least the same energy flux at 200GeV as at 1keV. In order to avoid strong gamma-ray attenuation close to the energy threshold, the redshift of the sources was constrained to values z < 0.3. Of the 14 sources observed, 1ES 1218+30.4 (for the first time at very high energies) and 1ES 2344+51.4 (strong detection in a low flux state) have been detected in addition to the known bright TeV blazars Mrk 421 and Mrk 501. For the remaining sources, we present here the 99% confidence level upper limits on the integral flux above ~200GeV. A marginal exces...

  14. The FACT camera project, a novel camera type for very high energy (VHE) gamma astronomy with imaging air Cherenkov telescopes

    Energy Technology Data Exchange (ETDEWEB)

    Neise, Dominik [TU, Dortmund (Germany)

    2010-07-01

    Recent progress in the field of photon detectors allows the development of novel camera types for VHE gamma astronomy with Imaging Air Cherenkov Telescopes. We are currently constructing a first full size camera, dubbed FACT (first avalanche-photodiode camera test) based on the novel Geiger-mode avalanche photodiodes (G-APD). These semiconductor photon detectors show several advanced features compared to conventional photomultiplier tubes, such as a significantly higher photon detection efficiency (PDE), high compactness, insensitivity against magnetic fields etc. In addition an entirely embedded new type of data acquisition as well as trigger system based on the novel domino ring sampling chip (DRS4) is being developed. The camera will be integral part of the new DWARF telescope located on the Canary island La Palma using the renovated HEGRA CT3 mount. DWARF is dedicated for long-term monitoring and observations of bright active galactic nuclei. A report about the successful prototype runs as well as about the concept and current status of the camera development is given.

  15. Implications on the X-ray emission of evolved pulsar wind nebulae based on VHE gamma-ray observations

    CERN Document Server

    Mayer, Michael J; Jung, Ira; Valerius, Kathrin; Stegmann, Christian

    2012-01-01

    Energetic pulsars power winds of relativistic leptons which produce photon nebulae (so-called pulsar wind nebulae, PWNe) detectable across the electromagnetic spectrum up to energies of several TeV. The spectral energy distribution has a double-humped structure: the first hump lies in the X-ray regime, the second in the gamma-ray range. The X-ray emission is generally understood as synchrotron radiation by highly energetic electrons, the gamma-ray emission as Inverse Compton scattering of energetic electrons with ambient photon fields. The evolution of the spectral energy distribution is influenced by the time-dependent spin-down of the pulsar and the decrease of the magnetic field strength with time. Thus, the present spectral appearance of a PWN depends on the age of the pulsar: while young PWNe are bright in X-rays and gamma-rays, the X-ray emission of evolved PWNe is suppressed. Hence, evolved PWNe may offer an explanation of the nature of some of the unidentified VHE gamma-ray sources not yet associated ...

  16. Search for VHE Gamma-Ray Emission from Young SNe with H.E.S.S

    CERN Document Server

    Lennarz, D

    2013-01-01

    Supernova (SN) remnants are a well motivated candidate for the acceleration sites of cosmic rays with energies up to the knee (10^15 eV). It has been suggested that also young SNe (~10 GeV) gamma-ray radiation. The H.E.S.S. imaging air Cherenkov telescope array is an instrument sensitive to such radiation. In this contribution, the pointing directions of the H.E.S.S. telescopes are compared to a recently published, extragalactic SN catalogue to identify coincidental observations. The results of the data analysis are discussed.

  17. Radioisotope instruments

    CERN Document Server

    Cameron, J F; Silverleaf, D J

    1971-01-01

    International Series of Monographs in Nuclear Energy, Volume 107: Radioisotope Instruments, Part 1 focuses on the design and applications of instruments based on the radiation released by radioactive substances. The book first offers information on the physical basis of radioisotope instruments; technical and economic advantages of radioisotope instruments; and radiation hazard. The manuscript then discusses commercial radioisotope instruments, including radiation sources and detectors, computing and control units, and measuring heads. The text describes the applications of radioisotop

  18. Attenuation of VHE gamma rays by the Milky Way interstellar radiation field

    CERN Document Server

    Moskalenko, I V; Strong, A W

    2006-01-01

    The attenuation of very high energy gamma rays by pair production on the Galactic interstellar radiation field has long been thought of as negligible. However, a new calculation of the interstellar radiation field consistent with multi-wavelength observations by DIRBE and FIRAS indicates that the Galactic interstellar radiation field is intense. We have made a calculation of the attenuation of very high energy gamma rays in the Galaxy using this new interstellar radiation field which takes into account its nonuniform spatial and angular distributions. We find that the maximum attenuation occurs around 100 TeV at the level of about 25% for sources located at the Galactic center, within the energy range of the HESS instrument, and is important for both Galactic and extragalactic sources.

  19. DETECCIÓN DEL GENOMA DEL VIRUS DE LA HEPATITIS E (VHE EN MUESTRAS DE HECES DE CERDOS EN PLANTAS DE BENEFICIO DE ANTIOQUIA, COLOMBIA

    Directory of Open Access Journals (Sweden)

    J. E. Forero

    2014-01-01

    Full Text Available El Virus de la Hepatitis E (VHE es uno de los agentes causales de enfermedad hepáticaaguda en humanos, aunque también puede inducir hepatitis crónica en pacientes in-munocomprometidos. Existen cuatro genotipos que generan enfermedad en humanos:los genotipos 1 y 2 asociados con brotes epidémicos por consumo de aguas contami-nadas y los genotipos 3 y 4 de trasmisión zoonótica, implicados en brotes esporádicosen países desarrollados donde el cerdo es el principal reservorio. En Colombia existeevidencia serológica de la infección en humanos y cerdos: se ha detectado el genomaviral en hígados de cerdos en plantas de beneficio y expendios de carne; sin embargono se conoce lo suficiente sobre la infección en el país. Con el fin de determinar si loscerdos del departamento de Antioquia (Colombia están excretando VHE en la edad delbeneficio, se obtuvieron 152 muestras de heces de cerdos en cinco plantas de beneficiode distintas regiones del departamento en las que se determinó la presencia del genomaviral por medio RT-PCR. El porcentaje de positividad hallado fue del 26.9% (41/152;se encontró, además, que los cerdos que provenían de las subregiones Norte y Orientede Antioquia tuvieron el menor (11.6% y mayor (58.3% porcentaje de muestraspositivas, respectivamente. Estos resultados indican que los cerdos en el momento desacrificio están excretando el virus a través de sus heces y que el VHE está circulando enlas diferentes subregiones del departamento.

  20. Speciation analysis of arsenic by selective hydride generation-cryotrapping-atomic fluorescence spectrometry with flame-in-gas-shield atomizer: achieving extremely low detection limits with inexpensive instrumentation.

    Science.gov (United States)

    Musil, Stanislav; Matoušek, Tomáš; Currier, Jenna M; Stýblo, Miroslav; Dědina, Jiří

    2014-10-21

    This work describes the method of a selective hydride generation-cryotrapping (HG-CT) coupled to an extremely sensitive but simple in-house assembled and designed atomic fluorescence spectrometry (AFS) instrument for determination of toxicologically important As species. Here, an advanced flame-in-gas-shield atomizer (FIGS) was interfaced to HG-CT and its performance was compared to a standard miniature diffusion flame (MDF) atomizer. A significant improvement both in sensitivity and baseline noise was found that was reflected in improved (4 times) limits of detection (LODs). The yielded LODs with the FIGS atomizer were 0.44, 0.74, 0.15, 0.17 and 0.67 ng L(-1) for arsenite, total inorganic, mono-, dimethylated As and trimethylarsine oxide, respectively. Moreover, the sensitivities with FIGS and MDF were equal for all As species, allowing for the possibility of single species standardization with arsenate standard for accurate quantification of all other As species. The accuracy of HG-CT-AFS with FIGS was verified by speciation analysis in two samples of bottled drinking water and certified reference materials, NRC CASS-5 (nearshore seawater) and SLRS-5 (river water) that contain traces of methylated As species. As speciation was in agreement with results previously reported and sums of all quantified species corresponded with the certified total As. The feasibility of HG-CT-AFS with FIGS was also demonstrated by the speciation analysis in microsamples of exfoliated bladder epithelial cells isolated from human urine. The results for the sums of trivalent and pentavalent As species corresponded well with the reference results obtained by HG-CT-ICPMS (inductively coupled plasma mass spectrometry).

  1. VizieR Online Data Catalog: 1WHSP: VHE γ-ray blazar candidates (Arsioli+, 2015)

    Science.gov (United States)

    Arsioli, B.; Fraga, B.; Giommi, P.; Padovani, P.; Marrese, P. M.

    2015-04-01

    We assembled a sample including 992 sources, which is currently the largest existing list of confirmed and candidates HSP blazars. All objects are expected to radiate up to the highest γ-ray photon energies. In fact, 299 of these are confirmed emitters of GeV γ-ray photons (based on Fermi-LAT catalogues), and 36 have already been detected in the TeV band. The majority of sources in the sample are within reach of the upcoming Cherenkov Telescope Array (CTA), and many may be detectable even by the current generation of Cherenkov telescopes during flaring episodes. The sample includes 425 previously known blazars, 151 new identifications, and 416 HSP candidates (mostly faint sources) for which no optical spectra is available yet. The full 1WHSP catalogue is online at http://www.asdc.asi.it/1whsp/, providing a direct link to the SED building tool where multi-frequency data for each source can be easily visualised. (1 data file).

  2. Detection of VHE γ-Rays from HESS J0632+057 during the 2011 February X-Ray Outburst with the MAGIC Telescopes

    Science.gov (United States)

    Aleksić, J.; Alvarez, E. A.; Antonelli, L. A.; Antoranz, P.; Asensio, M.; Backes, M.; Barres de Almeida, U.; Barrio, J. A.; Bastieri, D.; Becerra González, J.; Bednarek, W.; Berger, K.; Bernardini, E.; Biland, A.; Blanch, O.; Bock, R. K.; Boller, A.; Bonnoli, G.; Borla Tridon, D.; Bosch-Ramon, V.; Bretz, T.; Cañellas, A.; Carmona, E.; Carosi, A.; Colin, P.; Colombo, E.; Contreras, J. L.; Cortina, J.; Cossio, L.; Covino, S.; Da Vela, P.; Dazzi, F.; De Angelis, A.; De Caneva, G.; De Cea del Pozo, E.; De Lotto, B.; Delgado Mendez, C.; Diago Ortega, A.; Doert, M.; Domínguez, A.; Dominis Prester, D.; Dorner, D.; Doro, M.; Eisenacher, D.; Elsaesser, D.; Ferenc, D.; Fonseca, M. V.; Font, L.; Fruck, C.; García López, R. J.; Garczarczyk, M.; Garrido Terrats, D.; Giavitto, G.; Godinović, N.; González Muñoz, A.; Gozzini, S. R.; Hadasch, D.; Häfner, D.; Herrero, A.; Hildebrand, D.; Hose, J.; Hrupec, D.; Huber, B.; Jankowski, F.; Jogler, T.; Kadenius, V.; Kellermann, H.; Klepser, S.; Krähenbühl, T.; Krause, J.; La Barbera, A.; Lelas, D.; Leonardo, E.; Lewandowska, N.; Lindfors, E.; Lombardi, S.; López, M.; López-Coto, R.; López-Oramas, A.; Lorenz, E.; Makariev, M.; Maneva, G.; Mankuzhiyil, N.; Mannheim, K.; Maraschi, L.; Mariotti, M.; Martínez, M.; Mazin, D.; Meucci, M.; Miranda, J. M.; Mirzoyan, R.; Moldón, J.; Moralejo, A.; Munar-Adrover, P.; Niedzwiecki, A.; Nieto, D.; Nilsson, K.; Nowak, N.; Orito, R.; Paiano, S.; Paneque, D.; Paoletti, R.; Pardo, S.; Paredes, J. M.; Partini, S.; Perez-Torres, M. A.; Persic, M.; Pilia, M.; Pochon, J.; Prada, F.; Prada Moroni, P. G.; Prandini, E.; Puerto Gimenez, I.; Puljak, I.; Reichardt, I.; Reinthal, R.; Rhode, W.; Ribó, M.; Rico, J.; Rügamer, S.; Saggion, A.; Saito, K.; Saito, T. Y.; Salvati, M.; Satalecka, K.; Scalzotto, V.; Scapin, V.; Schultz, C.; Schweizer, T.; Shore, S. N.; Sillanpää, A.; Sitarek, J.; Snidaric, I.; Sobczynska, D.; Spanier, F.; Spiro, S.; Stamatescu, V.; Stamerra, A.; Steinke, B.; Storz, J.; Strah, N.; Sun, S.; Surić, T.; Takalo, L.; Takami, H.; Tavecchio, F.; Temnikov, P.; Terzić, T.; Tescaro, D.; Teshima, M.; Tibolla, O.; Torres, D. F.; Treves, A.; Uellenbeck, M.; Vogler, P.; Wagner, R. M.; Weitzel, Q.; Zabalza, V.; Zandanel, F.; Zanin, R.

    2012-07-01

    The very high energy (VHE) γ-ray source HESS J0632+057 has recently been confirmed to be a γ-ray binary. The optical counterpart is the Be star MWC 148, and a compact object of unknown nature orbits it every ~321 days with a high eccentricity of ~0.8. We monitored HESS J0632+057 with the stereoscopic MAGIC telescopes from 2010 October to 2011 March and detected significant VHE γ-ray emission during 2011 February, when the system exhibited an X-ray outburst. We find no γ-ray signal in the other observation periods when the system did not show increased X-ray flux. Thus, HESS J0632+057 exhibits γ-ray variability on timescales of the order of one to two months possibly linked to the X-ray outburst that takes place about 100 days after the periastron passage. Furthermore, our measurements provide for the first time the γ-ray spectrum down to about 140 GeV and indicate no turnover of the spectrum at low energies. We compare the properties of HESS J0632+057 with the similar γ-ray binary LS I +61°303 and discuss the possible origin of the multi-wavelength emission of the source.

  3. New constraints on the Mid-IR EBL from the HESS discovery of VHE gamma rays from 1ES 0229+200

    CERN Document Server

    Aharonian, F; Bazer-Bachi, A R; Behera, B; Beilicke, M; Benbow, W; Bernlöhr, K; Boisson, C; Bolz, O; Borrel, V; Braun, I; Brion, E; Brown, A M; Buhler, R; Bulik, T; Büsching, I; Boutelier, T; Carrigan, S; Chadwick, P M; Chounet, L M; Clapson, A C; Coignet, G; Cornils, R; Costamante, L; Dalton, M; Degrange, B; Dickinson, H J; Djannati-Atai, A; Domainko, W; O'Connor-Drury, L; Dubois, F; Dubus, G; Dyks, J; Egberts, K; Emmanoulopoulos, D; Espigat, P; Farnier, C; Feinstein, F; Fiasson, A; Förster, A; Fontaine, G; Funk, Seb; Fussling, M; Gallant, Y A; Giebels, B; Glicenstein, J F; Glück, B; Goret, P; Hadjichristidis, C; Hauser, D; Hauser, M; Heinzelmann, G; Henri, G; Hermann, G; Hinton, J A; Hoffmann, A; Hofmann, W; Holleran, M; Hoppe, S; Horns, D; Jacholkowska, A; De Jager, O C; Jung, I; Katarzynski, K; Kendziorra, E; Kerschhaggl, M; Khelifi, B; Keogh, D; Komin, Nu; Kosack, K; Lamanna, G; Latham, I J; Lemiere, A; Lemoine-Goumard, M; Lenain, J P; Lohse, T; Martin, J M; Martineau-Huynh, O; Marcowith, A; Masterson, C; Maurin, D; Maurin, G; McComb, T J L; Moderski, R; Moulin, E; De Naurois, Mathieu; Nedbal, D; Nolan, S J; Ohm, S; Olive, J P; de Ona Wilhelmi, E; Orford, K J; Osborne, J L; Ostrowski, M; Panter, M; Pedaletti, G; Pelletier, G; Petrucci, P O; Pita, S; Pühlhofer, G; Punch, M; Ranchon, S; Raubenheimer, B C; Raue, M; Rayner, S M; Renaud, M; Ripken, J; Rob, L; Rolland, L; Rosier-Lees, S; Rowell, G; Rudak, B; Ruppel, J; Sahakian, V V; Santangelo, A; Schlickeiser, R; Schock, F; Schroder, R; Schwanke, U; Schwarzburg, S; Schwemmer, S; Shalchi, A; Sol, H; Spangler, D; Stawarz, L; Steenkamp, R; Stegmann, C; Superina, G; Tam, P H; Tavernet, J P; Terrier, R; Van Eldik, C; Vasileiadis, G; Venter, C; Vialle, J P; Vincent, P; Vivier, M; Völk, H J; Volpe, F; Wagner, S J; Ward, M; Zdziarski, A A; Zech, A

    2007-01-01

    AIMS: To investigate the very high energy (VHE: >100 GeV) gamma-ray emission from the high-frequency peaked BL Lac 1ES 0229+200. METHODS: Observations of 1ES 0229+200 at energies above 580 GeV were performed with the High Energy Stereoscopic System (HESS) in 2005 and 2006. RESULTS: 1ES 0229+200 is discovered by HESS to be an emitter of VHE photons. A signal is detected at the 6.6 sigma level in the HESS observations (41.8 h live time). The integral flux above 580 GeV is (9.4 +- 1.5 {stat} +- 1.9 {syst}) x 10^{-13} cm^{-2} s^{-1}, corresponding to ~1.8% of the flux observed from the Crab Nebula. The data show no evidence for significant variability on any time scale. The observed spectrum is characterized by a hard power law (Gamma = 2.50 +- 0.19 {stat} +- 0.10 {syst}) from 500 GeV to ~15 TeV. CONCLUSIONS: The high-energy range and hardness of the observed spectrum, coupled with the object's relatively large redshift (z=0.1396), enable the strongest constraints so far on the density of the Extragalactic Backgr...

  4. Detection of VHE \\gamma-rays from HESS J0632+057 during the 2011 February X-ray outburst with the MAGIC Telescopes

    CERN Document Server

    Aleksić, J; Antonelli, L A; Antoranz, P; Asensio, M; Backes, M; de Almeida, U Barres; Barrio, J A; Bastieri, D; González, J Becerra; Bednarek, W; Berger, K; Bernardini, E; Biland, A; Blanch, O; Bock, R K; Boller, A; Bonnoli, G; Tridon, D Borla; Bosch-Ramon, V; Bretz, T; Cañellas, A; Carmona, E; Carosi, A; Colin, P; Colombo, E; Contreras, J L; Cortina, J; Cossio, L; Covino, S; Da Vela, P; Dazzi, F; De Angelis, A; De Caneva, G; del Pozo, E De Cea; De Lotto, B; Mendez, C Delgado; Ortega, A Diago; Doert, M; Domínguez, A; Prester, D Dominis; Dorner, D; Doro, M; Eisenacher, D; Elsaesser, D; Ferenc, D; Fonseca, M V; Font, L; Fruck, C; López, R J García; Garczarczyk, M; Terrats, D Garrido; Giavitto, G; Godinović, N; Muñoz, A González; Gozzini, S R; Hadasch, D; Häfner, D; Herrero, A; Hildebrand, D; Hose, J; Hrupec, D; Huber, B; Jankowski, F; Jogler, T; Kadenius, V; Kellermann, H; Klepser, S; Krähenbühl, T; Krause, J; La Barbera, A; Lelas, D; Leonardo, E; Lewandowska, N; Lindfors, E; Lombardi, S; López, M; López-Coto, R; López-Oramas, A; Lorenz, E; Makariev, M; Maneva, G; Mankuzhiyil, N; Mannheim, K; Maraschi, L; Mariotti, M; Martínez, M; Mazin, D; Meucci, M; Miranda, J M; Mirzoyan, R; Moldón, J; Moralejo, A; Munar-Adrover, P; Niedzwiecki, A; Nieto, D; Nilsson, K; Nowak, N; Orito, R; Paiano, S; Paneque, D; Paoletti, R; Pardo, S; Paredes, J M; Partini, S; Perez-Torres, M A; Persic, M; Pilia, M; Pochon, J; Prada, F; Moroni, P G Prada; Prandini, E; Gimenez, I Puerto; Puljak, I; Reichardt, I; Reinthal, R; Rhode, W; Ribó, M; Rico, J; Rügamer, S; Saggion, A; Saito, K; Saito, T Y; Salvati, M; Satalecka, K; Scalzotto, V; Scapin, V; Schultz, C; Schweizer, T; Shore, S N; Sillanpää, A; Sitarek, J; Snidaric, I; Sobczynska, D; Spanier, F; Spiro, S; Stamatescu, V; Stamerra, A; Steinke, B; Storz, J; Strah, N; Sun, S; Surić, T; Takalo, L; Takami, H; Tavecchio, F; Temnikov, P; Terzić, T; Tescaro, D; Teshima, M; Tibolla, O; Torres, D F; Treves, A; Uellenbeck, M; Vogler, P; Wagner, R M; Weitzel, Q; Zabalza, V; Zandanel, F; Zanin, R; de Lausanne, now at: Ecole polytechnique fédérale; Lausanne,; Switzerland,; Padova, supported by INFN; Energéticas, now at: Centro de Investigaciones; Tecnológicas, Medioambientales y; Madrid,; Spain,; KIPAC, now at:; Laboratory, SLAC National Accelerator; USA,; ESO, now at: Finnish Centre for Astronomy with; Turku, University of; Finland),

    2012-01-01

    The very high energy (VHE) \\gamma-ray source HESS J0632+057 has recently been confirmed to be a \\gamma-ray binary. The optical counterpart is the Be star MWC 148, and a compact object of unknown nature orbits it every ~321 d with a high eccentricity of ~0.8. We monitored HESS J0632+057 with the stereoscopic MAGIC telescopes from 2010 October to 2011 March and detected significant VHE \\gamma-ray emission during 2011 February, when the system exhibited an X-ray outburst. We find no \\gamma-ray signal in the other observation periods when the system did not show increased X-ray flux. Thus HESS J0632+057 exhibits \\gamma-ray variability on timescales of the order of one to two months possibly linked to the X-ray outburst that takes place about 100 days after the periastron passage. Furthermore our measurements provide for the first time the \\gamma-ray spectrum down to about 140 GeV and indicate no turnover of the spectrum at low energies. We compare the properties of HESS J0632+057 with the similar \\gamma-ray binar...

  5. Discovery of VHE emission towards the Carina arm region with the H.E.S.S. telescope array: HESS J1018-589

    Science.gov (United States)

    H. E. S. S. Collaboration; Abramowski, A.; Acero, F.; Aharonian, F.; Akhperjanian, A. G.; Anton, G.; Balzer, A.; Barnacka, A.; Becherini, Y.; Becker, J.; Bernlöh, K.; Birsin, E.; Biteau, J.; Bochow, A.; Boisson, C.; Bolmont, J.; Bordas, P.; Brucker, J.; Brun, F.; Brun, P.; Bulik, T.; Büsching, I.; Carrigan, S.; Casanova, S.; Cerruti, M.; Chadwick, P. M.; Charbonnier, A.; Chaves, R. C. G.; Cheesebrough, A.; Cologna, G.; Conrad, J.; Dalton, M.; Daniel, M. K.; Davids, I. D.; Degrange, B.; Deil, C.; Dickinson, H. J.; Djannati-Ataï, A.; Domainko, W.; Drury, L. O'C.; Dubus, G.; Dutson, K.; Dyks, J.; Dyrda, M.; Egberts, K.; Eger, P.; Espigat, P.; Fallon, L.; Fegan, S.; Feinstein, F.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Förster, A.; Füßling, M.; Gallant, Y. A.; Gast, H.; Gérard, L.; Gerbig, D.; Giebels, B.; Glicenstein, J. F.; Glück, B.; Göring, D.; Häffner, S.; Hague, J. D.; Hahn, J.; Hampf, D.; Harris, J.; Hauser, M.; Heinz, S.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hillert, A.; Hinton, J. A.; Hofmann, W.; Hofverberg, P.; Holler, M.; Horns, D.; Jacholkowska, A.; de Jager, O. C.; Jahn, C.; Jamrozy, M.; Jung, I.; Kastendieck, M. A.; Katarzyński, K.; Katz, U.; Kaufmann, S.; Keogh, D.; Khélifi, B.; Klochkov, D.; Klużniak, D.; Kneiske, T.; Komin, Nu.; Kosack, K.; Kossakowski, R.; Krayzel, F.; Laffon, H.; Lamanna, G.; Lenain, J.-P.; Lennarz, D.; Lohse, T.; Lopatin, A.; Lu, C.-C.; Marandon, V.; Marcowith, A.; Masbou, J.; Maxted, N.; Mayer, M.; McComb, T. J. L.; Medina, M. C.; Méhault, J.; Moderski, R.; Mohamed, M.; Moulin, E.; Naumann, C. L.; Naumann-Godo, M.; de Naurois, M.; Nedbal, D.; Nekrassov, D.; Nguyen, N.; Nicholas, B.; Niemiec, J.; Nolan, S. J.; Ohm, S.; de Oña Wilhelmi, E.; Opitz, B.; Ostrowski, M.; Oya, I.; Panter, M.; Paz Arribas, M.; Pekeur, N. W.; Pelletier, G.; Perez, J.; Petrucci, P.-O.; Peyaud, B.; Pita, S.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raue, M.; Rayner, S. M.; Reimer, A.; Reimer, O.; Renaud, M.; de los Reyes, R.; Rieger, F.; Ripken, J.; Rob, L.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Sanchez, D. A.; Santangelo, A.; Schlickeiser, R.; Schulz, A.; Schwanke, U.; Schwarzburg, S.; Schwemmer, S.; Sheidaei, F.; Skilton, J. L.; Sol, H.; Spengler, G.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Stycz, K.; Sushch, I.; Szostek, A.; Tavernet, J.-P.; Terrier, R.; Tluczykont, M.; Valerius, K.; van Eldik, C.; Vasileiadis, G.; Venter, C.; Viana, A.; Vincent, P.; Völk, H. J.; Volpe, F.; Vorobiov, S.; Vorster, M.; Wagner, S. J.; Ward, M.; White, R.; Wierzcholska, A.; Zacharias, M.; Zajczyk, A.; Zdziarski, A. A.; Zech, A.; Zechlin, H.-S.

    2012-05-01

    The Carina arm region, containing the supernova remnant SNR G284.3-1.8, the high-energy (HE; E > 100 MeV) binary 1FGL J1018.6-5856 and the energetic pulsar PSR J1016-5857 and its nebula, has been observed with the H.E.S.S. telescope array. The observational coverage of the region in very-high-energy (VHE; E > 0.1 TeV) γ-rays benefits from deep exposure (40 h) of the neighboring open cluster Westerlund 2. The observations have revealed a new extended region of VHE γ-ray emission. The new VHE source HESS J1018-589 shows a bright, point-like emission region positionally coincident with SNR G284.3-1.8 and 1FGL J1018.6-5856 and a diffuse extension towards the direction of PSR J1016-5857. A soft (Γ = 2.7 ± 0.5stat)photon index, with a differential flux at 1 TeV of N0 = (4.2 ± 1.1) × 10-13 TeV-1 cm-2 s-1 is found for the point-like source, whereas the total emission region including the diffuse emission region is well fit by a power-law function with spectral index Γ = 2.9 ± 0.4stat and differential flux at 1 TeV of N0 = (6.8 ± 1.6) × 10-13 TeV-1 cm-2 s-1. This H.E.S.S. detection motivated follow-up X-ray observations with the XMM-Newton satellite to investigate the origin of the VHE emission. The analysis of the XMM-Newton data resulted in the discovery of a bright, non-thermal point-like source (XMMU J101855.4-58564) with a photon index of Γ = 1.65 ± 0.08 in the center of SNR G284.3-1.8, and a thermal, extended emission region coincident with its bright northern filament. The characteristics of this thermal emission are used to estimate the plasma density in the region as n ≈ 0.5 cm-3 (2.9 kpc/d)2. The position of XMMU J101855.4-58564 is compatible with the position reported by the Fermi-LAT collaboration for the binary system 1FGL J1018.6-5856 and the variable Swift XRT source identified with it. The new X-ray data are used alongside archival multi-wavelength data to investigate the relationship between the VHE γ-ray emission from HESS J1018-589 and the

  6. Instrumentation Facility

    Data.gov (United States)

    Federal Laboratory Consortium — Provides instrumentation support for flight tests of prototype weapons systems using a vast array of airborne sensors, transducers, signal conditioning and encoding...

  7. 1WHSP: An IR-based sample of ~1000 VHE γ-ray blazar candidates

    Science.gov (United States)

    Arsioli, B.; Fraga, B.; Giommi, P.; Padovani, P.; Marrese, P. M.

    2015-07-01

    Context. Blazars are the dominant type of extragalactic sources at microwave and at γ-ray energies. In the most energetic part of the electromagnetic spectrum (E ≳ 100 GeV) a high fraction of high Galactic latitude sources are blazars of the high synchrotron peaked (HSP) type, that is BL Lac objects with synchrotron power peaking in the UV or in the X-ray band. Building new large samples of HSP blazars is key to understand the properties of jets under extreme conditions, and to study the demographics and the peculiar cosmological evolution of these sources. Aims: High synchrotron peaked blazars are remarkably rare, with only a few hundreds of them expected to be above the sensitivity limits of currently available surveys, some of which include hundreds of millions of sources. To find these very uncommon objects, we have devised a method that combines ALLWISE survey data with multi-frequency selection criteria. Methods: The sample was defined starting from a primary list of infrared colour-colour selected sources from the ALLWISE all sky survey database, and applying further restrictions on IR-radio and IR-X-ray flux ratios. Using a polynomial fit to the multi-frequency data (radio to X-ray), we estimated synchrotron peak frequencies and fluxes of each object. Results: We assembled a sample including 992 sources, which is currently the largest existing list of confirmed and candidates HSP blazars. All objects are expected to radiate up to the highest γ-ray photon energies. In fact, 299 of these are confirmed emitters of GeV γ-ray photons (based on Fermi-LAT catalogues), and 36 have already been detected in the TeV band. The majority of sources in the sample are within reach of the upcoming Cherenkov Telescope Array (CTA), and many may be detectable even by the current generation of Cherenkov telescopes during flaring episodes. The sample includes 425 previously known blazars, 151 new identifications, and 416 HSP candidates (mostly faint sources) for which no

  8. Luminescence Instrumentation

    DEFF Research Database (Denmark)

    Jain, Mayank; Bøtter-Jensen, Lars

    2014-01-01

    This chapter gives an introduction to instrumentation for stimulated luminescence studies, with special focus on luminescence dating using the natural dosimeters, quartz and feldspars. The chapter covers basic concepts in luminescence detection, and thermal and optical stimulation, and reference...

  9. High Precision Isotopic Analysis of Actinide Bearing Materials: Performance of a New Generation of Purpose Built Actinide Multi-Collector ICPMS Instruments

    Energy Technology Data Exchange (ETDEWEB)

    Eiden, Gregory C.; Duffin, Andrew M.; Liezers, Martin; Ward, Jesse D.; Robinson, John W.; Hart, Garret L.; Pratt, Sandra H.; Springer, Kellen WE; Carman, April J.; Duckworth, Douglas C.

    2014-11-14

    Recently, a new class of multi-collector inductively coupled plasma mass spectrometers (MC-ICPMS) has been introduced commercially that includes detector arrays purpose built for actinide measurements. These detector arrays significantly enhance the data quality possible for applications encountered in nuclear forensics. Two such instruments are described in this paper, the NeptunePlusTM, developed by Thermo-Fisher (Bremen, Germany), and the NuPlasma2, developed by Nu Instruments (Wrexham, UK). Research results are presented that have been obtained by the authors using the first commercial NeptunePlusTM. This paper also presents performance characteristics and results for traditional liquid introduction, including a means for ultra-trace detection via electrochemical separation prior to solution nebulization, as well as solid sample introduction with femtosecond-laser ablation. We also discuss the advantages and limitations of the current systems for detection of the transient signals associated with these two methods for introducing sample into the plasma.

  10. Discovery of extended VHE gamma-ray emission from the asymmetric pulsar wind nebula in MSH 15-52 with H.E.S.S

    CERN Document Server

    Aharonian, F; Aye, K M; Bazer-Bachi, A R; Beilicke, M; Benbow, W; Berge, D; Berghaus, P; Bernlöhr, K; Boisson, C; Bolz, O; Borgmeier, C; Braun, I; Breitling, F; Brown, A M; Bussons-Gordo, J; Chadwick, P M; Chounet, L M; Cornils, R; Costamante, L; Degrange, B; Djannati-Atai, A; O'Connor-Drury, L; Dubus, G; Ergin, T; Espigat, P; Feinstein, F; Fleury, P; Fontaine, G; Fuchs, Y; Funk, S; Gallant, Y A; Giebels, B; Gillessen, S; Goret, P; Hadjichristidis, C; Hauser, M; Heinzelmann, G; Henri, G; Hermann, G; Hinton, J A; Hofmann, W; Holleran, M; Horns, D; De Jager, O C; Jung, I; Khelifi, B; Komin, Nu; Konopelko, A; Latham, I J; Le Gallou, R; Lemiere, A; Lemoine, M; Leroy, N; Lohse, T; Marcowith, A; Masterson, C; McComb, T J L; De Naurois, Mathieu; Nolan, S J; Noutsos, A; Orford, K J; Osborne, J L; Ouchrif, M; Panter, M; Pelletier, G; Pita, S; Pühlhofer, G; Punch, M; Raubenheimer, B C; Raue, M; Raux, J; Rayner, S M; Redondo, I; Reimer, A; Reimer, O; Ripken, J; Rob, L; Rolland, L; Rowell, G; Sahakian, V V; Sauge, L; Schlenker, S; Schlickeiser, R; Schuster, C; Schwanke, U; Siewert, M; Sol, H; Steenkamp, R; Stegmann, C; Tavernet, J P; Terrier, R; Theoret, C G; Tluczykont, M; Vasileiadis, G; Venter, C; Vincent, P; Visser, B; Völk, H J; Wagner, S J

    2005-01-01

    The Supernova Remnant MSH 15-52 has been observed in very high energy (VHE) gamma-rays using the H.E.S.S. 4-telescope array located in Namibia. A gamma-ray signal is detected at the 25 sigma level during an exposure of 22.1 hours live time. The image reveals an elliptically shaped emission region around the pulsar PSR B1509-58, with semi-major axis 6' in the NW-SE direction and semi-minor axis 2' approximately. This morphology coincides with the diffuse pulsar wind nebula as observed at X-ray energies by ROSAT. The overall energy spectrum from 280 GeV up to 40 TeV can be fitted by a power law with photon index Gamma = 2.27 +/- 0.03(stat.) +/- 0.20(syst.). The detected emission can be plausibly explained by inverse Compton scattering of accelerated relativistic electrons with soft photons.

  11. Instrumented SSH

    Energy Technology Data Exchange (ETDEWEB)

    Campbell, Scott; Campbell, Scott

    2009-05-27

    NERSC recently undertook a project to access and analyze Secure Shell (SSH) related data. This includes authentication data such as user names and key fingerprints, interactive session data such as keystrokes and responses, and information about noninteractive sessions such as commands executed and files transferred. Historically, this data has been inaccessible with traditional network monitoring techniques, but with a modification to the SSH daemon, this data can be passed directly to intrusion detection systems for analysis. The instrumented version of SSH is now running on all NERSC production systems. This paper describes the project, details about how SSH was instrumented, and the initial results of putting this in production.

  12. Active instruments

    DEFF Research Database (Denmark)

    Lim, Miguel Antonio; Ørberg, Jakob Williams

    2017-01-01

    ) show the dynamic nature of policy processes, and (3) consider the search for policy reference points among the different actors. We present rankers in motion, policies in motion, and finally the complex nature of the ranking device that needs to be both a relevant and malleable policy instrument...

  13. Astronomical Instrumentation System Markup Language

    Science.gov (United States)

    Goldbaum, Jesse M.

    2016-05-01

    The Astronomical Instrumentation System Markup Language (AISML) is an Extensible Markup Language (XML) based file format for maintaining and exchanging information about astronomical instrumentation. The factors behind the need for an AISML are first discussed followed by the reasons why XML was chosen as the format. Next it's shown how XML also provides the framework for a more precise definition of an astronomical instrument and how these instruments can be combined to form an Astronomical Instrumentation System (AIS). AISML files for several instruments as well as one for a sample AIS are provided. The files demonstrate how AISML can be utilized for various tasks from web page generation and programming interface to instrument maintenance and quality management. The advantages of widespread adoption of AISML are discussed.

  14. Influence of the filtering speed on the VHE filters clogging for many types of aerosols; Influence de la vitesse de filtration sur le colmatage de filtres THE plisses pour differents types d'aerosols

    Energy Technology Data Exchange (ETDEWEB)

    Briand, A.; Laborde, J.C.; Mocho, V. [CEA/Saclay, Inst. de Protection et de Surete Nucleaire, IPSN/DPEA/SERAC, 91 - Gif-sur-Yvette (France); Hurel, F. [COGEMA BCR/QS, 78 - Saint-Quentin-en-Yvelines (France)

    2000-07-01

    This paper presents results relative to a study of the IPSN in collaboration with COGEMA in order to characterize the Very High Efficiency (VHE) filters clogging by many types of aerosols. Experiments have been realized for different filtering speeds. They show a different clogging between the plan and the pleated filters. Concerning the pleated filters, the aeraulic strength increases when the filtering speed decreases. (A.L.B.)

  15. Revisiting the Impact of Atmospheric Dispersion and Differential Refraction on Widefield Multiobject Spectroscopic Observations. From VLT/VIMOS to Next Generation Instruments

    CERN Document Server

    Sánchez-Janssen, Rubén; Selman, Fernando; Bristow, Paul; Hammersley, Peter; Hilker, Michael; Rejkuba, Marina; Wolff, Burkhard

    2014-01-01

    (Abridged) Atmospheric dispersion and field differential refraction impose severe constraints on widefield MOS observations. Flux reduction and spectral distortions must be minimised by a careful planning of the observations -- which is especially true for instruments that use slits instead of fibres. This is the case of VIMOS at the VLT, where MOS observations have been restricted, since the start of operations, to a narrow two-hour range from the meridian to minimise slit losses. We revisit in detail the impact of atmospheric effects on the quality of VIMOS-MOS spectra. We model slit losses across the entire VIMOS FOV as a function of target declination. We explore two different slit orientations at the meridian: along the parallactic angle (North-South), and perpendicular to it (East-West). We show that, for fields culminating at zenith distances larger than 20 deg, slit losses are minimised with slits oriented along the parallactic angle at the meridian. The two-hour angle rule holds for these observation...

  16. SHARK (System for coronagraphy with High order Adaptive optics from R to K band): a proposal for the LBT 2nd generation instrumentation

    Science.gov (United States)

    Farinato, Jacopo; Pedichini, Fernando; Pinna, Enrico; Baciotti, Francesca; Baffa, Carlo; Baruffolo, Andrea; Bergomi, Maria; Bruno, Pietro; Cappellaro, Enrico; Carbonaro, Luca; Carlotti, Alexis; Centrone, Mauro; Close, Laird; Codona, Johanan; Desidera, Silvano; Dima, Marco; Esposito, Simone; Fantinel, Daniela; Farisato, Giancarlo; Fontana, Adriano; Gaessler, Wolfgang; Giallongo, Emanuele; Gratton, Raffaele; Greggio, Davide; Guerra, Juan Carlos; Guyon, Olivier; Hinz, Philip; Leone, Francesco; Lisi, Franco; Magrin, Demetrio; Marafatto, Luca; Munari, Matteo; Pagano, Isabella; Puglisi, Alfio; Ragazzoni, Roberto; Salasnich, Bernardo; Sani, Eleonora; Scuderi, Salvo; Stangalini, Marco; Testa, Vincenzo; Verinaud, Christophe; Viotto, Valentina

    2014-08-01

    This article presents a proposal aimed at investigating the technical feasibility and the scientific capabilities of high contrast cameras to be implemented at LBT. Such an instrument will fully exploit the unique LBT capabilities in Adaptive Optics (AO) as demonstrated by the First Light Adaptive Optics (FLAO) system, which is obtaining excellent results in terms of performance and reliability. The aim of this proposal is to show the scientific interest of such a project, together with a conceptual opto-mechanical study which shows its technical feasibility, taking advantage of the already existing AO systems, which are delivering the highest Strehl experienced in nowadays existing telescopes. Two channels are foreseen for SHARK, a near infrared channel (2.5-0.9 um) and a visible one (0.9 - 0.6 um), both providing imaging and coronagraphic modes. The visible channel is equipped with a very fast and low noise detector running at 1.0 kfps and an IFU spectroscopic port to provide low and medium resolution spectra of 1.5 x 1.5 arcsec fields. The search of extra solar giant planets is the main science case and the driver for the technical choices of SHARK, but leaving room for several other interesting scientific topics, which will be briefly depicted here.

  17. Real-Time Measurement of the Tool-Tissue Interaction in Minimally Invasive Abdominal Surgery: The First Step to Developing the Next Generation of Smart Laparoscopic Instruments.

    Science.gov (United States)

    Barrie, Jenifer; Jayne, David G; Neville, Anne; Hunter, Louise; Hood, Adrian J; Culmer, Peter R

    2016-10-01

    Introduction Analysis of force application in laparoscopic surgery is critical to understanding the nature of the tool-tissue interaction. The aim of this study is to provide real-time data about manipulations to abdominal organs. Methods An instrumented short fenestrated grasper was used in an in vivo porcine model, measuring force at the grasper handle. Grasping force and duration over 5 small bowel manipulation tasks were analyzed. Forces required to retract gallbladder, bladder, small bowel, large bowel, and rectum were measured over 30 seconds. Four parameters were calculated-T(hold), the grasp time; T(close), time taken for the jaws to close; F(max), maximum force reached; and F(rms), root mean square force (representing the average force across the grasp time). Results Mean F(max) to manipulate the small bowel was 20.5 N (±7.2) and F(rms) was 13.7 N (±5.4). Mean T(close) was 0.52 seconds (±0.26) and T(hold) was 3.87 seconds (±1.5). In individual organs, mean F(max) was 49 N (±15) to manipulate the rectum and 59 N (±13.4) for the colon. The mean F(max) for bladder and gallbladder retraction was 28.8 N (±7.4) and 50.7 N (±3.8), respectively. All organs exhibited force relaxation, the F(rms) reduced to below 25 N for all organs except the small bowel, with a mean F(rms) of less than 10 N. Conclusion This study has commenced the process of quantifying tool-tissue interaction. The static measurements discussed here should evolve to include dynamic measurements such as shear, torque, and retraction forces, and be correlated with evidence of histological damage to tissue.

  18. New isostatic mounting concept for a space born Three Mirror Anastigmat (TMA) on the Meteosat Third Generation Infrared Sounder Instrument (MTG-IRS)

    Science.gov (United States)

    Freudling, Maximilian; Klammer, Jesko; Lousberg, Gregory; Schumacher, Jean-Marc; Körner, Christian

    2016-07-01

    A novel isostatic mounting concept for a space born TMA of the Meteosat Third Generation Infrared Sounder is presented. The telescope is based on a light-weight all-aluminium design. The mounting concept accommodates the telescope onto a Carbon-Fiber-Reinforced Polymer (CRFP) structure. This design copes with the high CTE mismatch without introducing high stresses into the telescope structure. Furthermore a Line of Sight stability of a few microrads under geostationary orbit conditions is provided. The design operates with full performance at a temperature 20K below the temperature of the CFRP structure and 20K below the integration temperature. The mounting will sustain launch loads of 47g. This paper will provide the design of the Back Telescope Assembly (BTA) isostatic mounting and will summarise the consolidated technical baseline reached following a successful Preliminary Design Review (PDR).

  19. Discovery of the VHE gamma-ray source HESS J1832-093 in the vicinity of SNR G22.7-0.2

    CERN Document Server

    :,; Aharonian, F; Benkhali, F Ait; Akhperjanian, A G; Angüner, E; Anton, G; Balenderan, S; Balzer, A; Barnacka, A; Becherini, Y; Tjus, J Becker; Bernlöhr, K; Birsin, E; Bissaldi, E; Biteau, J; Böttcher, M; Boisson, C; Bolmont, J; Bordas, P; Brucker, J; Brun, F; Brun, P; Bulik, T; Carrigan, S; Casanova, S; Cerruti, M; Chadwick, P M; Chalme-Calvet, R; Chaves, R C G; Cheesebrough, A; Chrétien, M; Colafrancesco, S; Cologna, G; Conrad, J; Couturier, C; Cui, Y; Dalton, M; Daniel, M K; Davids, I D; Degrange, B; Deil, C; deWilt, P; Dickinson, H J; Djannati-Ataï, A; Domainko, W; Drury, L O'C; Dubus, G; Dutson, K; Dyks, J; Dyrda, M; Edwards, T; Egberts, K; Eger, P; Espigat, P; Farnier, C; Fegan, S; Feinstein, F; Fernandes, M V; Fernandez, D; Fiasson, A; Fontaine, G; Förster, A; Füßling, M; Gajdus, M; Gallant, Y A; Garrigoux, T; Giavitto, G; Giebels, B; Glicenstein, J F; Grondin, M -H; Grudzińska, M; Häffner, S; Hahn, J; Harris, J; Heinzelmann, G; Henri, G; Hermann, G; Hervet, O; Hillert, A; Hinton, J A; Hofmann, W; Hofverberg, P; Holler, M; Horns, D; Jacholkowska, A; Jahn, C; Jamrozy, M; Janiak, M; Jankowsky, F; Jung, I; Kastendieck, M A; Katarzyński, K; Katz, U; Kaufmann, S; Khélifi, B; Kieffer, M; Klepser, S; Klochkov, D; Kluźniak, W; Kneiske, T; Kolitzus, D; Komin, Nu; Kosack, K; Krakau, S; Krayzel, F; Krüger, P P; Laffon, H; Lamanna, G; Lefaucheur, J; Lemière, A; Lemoine-Goumard, M; Lenain, J -P; Lennarz, D; Lohse, T; Lopatin, A; Lu, C -C; Marandon, V; Marcowith, A; Marx, R; Maurin, G; Maxted, N; Mayer, M; McComb, T J L; Méhault, J; Meintjes, P J; Menzler, U; Meyer, M; Moderski, R; Mohamed, M; Moulin, E; Murach, T; Naumann, C L; de Naurois, M; Niemiec, J; Nolan, S J; Oakes, L; Ohm, S; Wilhelmi, E de O na; Opitz, B; Ostrowski, M; Oya, I; Panter, M; Parsons, R D; Arribas, M Paz; Pekeur, N W; Pelletier, G; Perez, J; Petrucci, P -O; Peyaud, B; Pita, S; Poon, H; Pühlhofer, G; Punch, M; Quirrenbach, A; Raab, S; Raue, M; Reimer, A; Reimer, O; Renaud, M; Reyes, R de los; Rieger, F; Rob, L; Romoli, C; Rosier-Lees, S; Rowell, G; Rudak, B; Rulten, C B; Sahakian, V; Sanchez, D A; Santangelo, A; Schlickeiser, R; Schüssler, F; Schulz, A; Schwanke, U; Schwarzburg, S; Schwemmer, S; Sol, H; Spengler, G; Spies, F; Stawarz, L; Steenkamp, R; Stegmann, C; Stinzing, F; Stycz, K; Sushch, I; Szostek, A; Tavernet, J -P; Tavernier, T; Taylor, A M; Terrier, R; Tluczykont, M; Trichard, C; Valerius, K; van Eldik, C; van Soelen, B; Vasileiadis, G; Venter, C; Viana, A; Vincent, P; Völk, H J; Volpe, F; Vorster, M; Vuillaume, T; Wagner, S J; Wagner, P; Ward, M; Weidinger, M; Weitzel, Q; White, R; Wierzcholska, A; Willmann, P; Wörnlein, A; Wouters, D; Zabalza, V; Zacharias, M; Zajczyk, A; Zdziarski, A A; Zech, A; Zechlin, H -S

    2014-01-01

    The region around the supernova remnant (SNR) W41 contains several TeV sources and has prompted the H.E.S.S. Collaboration to perform deep observations of this field of view. This resulted in the discovery of the new very high energy (VHE) source HESS J1832-093, at the position $\\rm RA=18^h 32^m 50^s \\pm 3^s_{stat} \\pm 2^s_{syst}, \\rm Dec=-9^\\circ 22' 36'' \\pm 32''_{stat} \\pm 20''_{syst} (J2000)$, spatially coincident with a part of the radio shell of the neighboring remnant G22.7-0.2. The photon spectrum is well described by a power-law of index $\\Gamma = 2.6 \\pm 0.3_{\\rm stat} \\pm 0.1_{\\rm syst}$ and a normalization at 1 TeV of $\\Phi_0=(4.8 \\pm 0.8_{\\rm stat}\\pm 1.0_{\\rm syst})\\,\\times\\,10^{-13}\\,\\rm{cm} ^{-2}\\,s^{-1}\\,TeV^{-1}$. The location of the gamma-ray emission on the edge of the SNR rim first suggested a signature of escaping cosmic-rays illuminating a nearby molecular cloud. Then a dedicated XMM-Newton observation led to the discovery of a new X-ray point source spatially coincident with the TeV ex...

  20. A Musical instrument in MEMS

    NARCIS (Netherlands)

    Engelen, Johannes Bernardus Charles; de Boer, Hans L.; de Boer, H.; Beekman, J.G.; Been, A.J.; Folkertsma, Gerrit Adriaan; Folkertsma, G.A.; Fortgens, L.; de Graaf, D.; Vocke, S.; Woldering, L.A.; Abelmann, Leon; Elwenspoek, Michael Curt

    In this work we describe a MEMS instrument that resonates at audible frequencies, and with which music can be made. The sounds are generated by mechanical resonators and capacitive displacement sensors. Damping by air scales unfavourably for generating audible frequencies with small devices.

  1. Optical Instruments

    Science.gov (United States)

    1990-01-01

    Precision Lapping and Optical Co. has developed a wide variety of hollow retroreflector systems for applications involving the entire optical spectrum; they are, according to company literature, cheaper, more accurate, lighter and capable of greater size than solid prisms. Precision Lapping's major customers are aerospace and defense companies, government organizations, R&D and commercial instrument companies. For example, Precision Lapping supplies hollow retroreflectors for the laser fire control system of the Army's Abrams tank, and retroreflectors have been and are being used in a number of space tests relative to the Air Force's Strategic Defense Initiative research program. An example of a customer/user is Chesapeake Laser Systems, producer of the Laser Tracker System CMS-2000, which has applications in SDI research and industrial robotics. Another customer is MDA Scientific, Inc., manufacturer of a line of toxic gas detection systems used to monitor hazardous gases present in oil fields, refineries, offshore platforms, chemical plants, waste storage sites and other locations where gases are released into the environment.

  2. New-generation NASA Aura Ozone Monitoring Instrument (OMI) volcanic SO2 dataset: algorithm description, initial results, and continuation with the Suomi-NPP Ozone Mapping and Profiler Suite (OMPS)

    Science.gov (United States)

    Li, Can; Krotkov, Nickolay A.; Carn, Simon; Zhang, Yan; Spurr, Robert J. D.; Joiner, Joanna

    2017-02-01

    Since the fall of 2004, the Ozone Monitoring Instrument (OMI) has been providing global monitoring of volcanic SO2 emissions, helping to understand their climate impacts and to mitigate aviation hazards. Here we introduce a new-generation OMI volcanic SO2 dataset based on a principal component analysis (PCA) retrieval technique. To reduce retrieval noise and artifacts as seen in the current operational linear fit (LF) algorithm, the new algorithm, OMSO2VOLCANO, uses characteristic features extracted directly from OMI radiances in the spectral fitting, thereby helping to minimize interferences from various geophysical processes (e.g., O3 absorption) and measurement details (e.g., wavelength shift). To solve the problem of low bias for large SO2 total columns in the LF product, the OMSO2VOLCANO algorithm employs a table lookup approach to estimate SO2 Jacobians (i.e., the instrument sensitivity to a perturbation in the SO2 column amount) and iteratively adjusts the spectral fitting window to exclude shorter wavelengths where the SO2 absorption signals are saturated. To first order, the effects of clouds and aerosols are accounted for using a simple Lambertian equivalent reflectivity approach. As with the LF algorithm, OMSO2VOLCANO provides total column retrievals based on a set of predefined SO2 profiles from the lower troposphere to the lower stratosphere, including a new profile peaked at 13 km for plumes in the upper troposphere. Examples given in this study indicate that the new dataset shows significant improvement over the LF product, with at least 50 % reduction in retrieval noise over the remote Pacific. For large eruptions such as Kasatochi in 2008 (˜ 1700 kt total SO2) and Sierra Negra in 2005 (> 1100 DU maximum SO2), OMSO2VOLCANO generally agrees well with other algorithms that also utilize the full spectral content of satellite measurements, while the LF algorithm tends to underestimate SO2. We also demonstrate that, despite the coarser spatial and

  3. New-Generation NASA Aura Ozone Monitoring Instrument (OMI) Volcanic SO2 Dataset: Algorithm Description, Initial Results, and Continuation with the Suomi-NPP Ozone Mapping and Profiler Suite (OMPS)

    Science.gov (United States)

    Li, Can; Krotkov, Nickolay A.; Carn, Simon; Zhang, Yan; Spurr, Robert J. D.; Joiner, Joanna

    2017-01-01

    Since the fall of 2004, the Ozone Monitoring Instrument (OMI) has been providing global monitoring of volcanic SO2 emissions, helping to understand their climate impacts and to mitigate aviation hazards. Here we introduce a new-generation OMI volcanic SO2 dataset based on a principal component analysis (PCA) retrieval technique. To reduce retrieval noise and artifacts as seen in the current operational linear fit (LF) algorithm, the new algorithm, OMSO2VOLCANO, uses characteristic features extracted directly from OMI radiances in the spectral fitting, thereby helping to minimize interferences from various geophysical processes (e.g., O3 absorption) and measurement details (e.g., wavelength shift). To solve the problem of low bias for large SO2 total columns in the LF product, the OMSO2VOLCANO algorithm employs a table lookup approach to estimate SO2 Jacobians (i.e., the instrument sensitivity to a perturbation in the SO2 column amount) and iteratively adjusts the spectral fitting window to exclude shorter wavelengths where the SO2 absorption signals are saturated. To first order, the effects of clouds and aerosols are accounted for using a simple Lambertian equivalent reflectivity approach. As with the LF algorithm, OMSO2VOLCANO provides total column retrievals based on a set of predefined SO2 profiles from the lower troposphere to the lower stratosphere, including a new profile peaked at 13 km for plumes in the upper troposphere. Examples given in this study indicate that the new dataset shows significant improvement over the LF product, with at least 50% reduction in retrieval noise over the remote Pacific. For large eruptions such as Kasatochi in 2008 (approximately 1700 kt total SO2/ and Sierra Negra in 2005 (greater than 1100DU maximum SO2), OMSO2VOLCANO generally agrees well with other algorithms that also utilize the full spectral content of satellite measurements, while the LF algorithm tends to underestimate SO2. We also demonstrate that, despite the

  4. Technical presentation - KEITHLEY Instruments - CANCELLED

    CERN Multimedia

    FI Department

    2009-01-01

    10 March 2009 13:30 – 15:30, Council Chamber, Bldg. 503 Keithley markets highly accurate instruments and data acquisition products, as well as complete system solutions for high-volume production and assembly testing. Keithley Instruments, Inc. designs, develops, manufactures and markets complex electronic instruments and systems geared to the specialized needs of electronics manufacturers for high-performance production testing, process monitoring, product development and research. Products and Services: Digital Multimeters and Data Acquisition Systems Current / Voltage Source and Measure Products Low Current / High Resistance Measurement Products Function/Pulse/Arbitrary/Pattern Generators Low Voltage/Low Resistance Measurement Products RF Spectrum Analyzer / RF Signal Generator / RF Switching Semiconductor Device Characterization Program: Topic 1: Welcome and short overview of new Products SMU 26XXA / ARB Generator 3390 / DMM 3706 / E-Meter 6517B Topic 2a: Te...

  5. Beam Instrument Development System

    Energy Technology Data Exchange (ETDEWEB)

    2016-01-08

    Beam Instrumentation Development System (BIDS) is a collection of common support libraries and modules developed during a series of Low-Level Radio Frequency (LLRF) control and timing/synchronization projects. BIDS includes a collection of Hardware Description Language (HDL) libraries and software libraries. The BIDS can be used for the development of any FPGA-based system, such as LLRF controllers. HDL code in this library is generic and supports common Digital Signal Processing (DSP) functions, FPGA-specific drivers (high-speed serial link wrappers, clock generation, etc.), ADC/DAC drivers, Ethernet MAC implementation, etc.

  6. Development of Human Physiological Signals Generator Based on Virtual Instrument%基于虚拟仪器的人体生理信号发生器的研制

    Institute of Scientific and Technical Information of China (English)

    陆宏伟; 王春芳; 花有园; 田佳佳; 刘世海

    2013-01-01

    目的:基于虚拟仪器技术构建人体生理信号发生器.方法:利用MIT-BIH等标准数据库中大量免费的人体生理数据,通过NI公司的PCI数据采集卡(可实现模-数/数-模转换,本研究利用其数-模转换功能),利用LabVIEW编程实现模拟信号输出.采用NI-PCI 6221 DAQ卡,插入电脑PCI插槽构成系统硬件.系统软件先读入头文件,根据头文件各个字段设置相应变量,然后读入数据文件,根据文件格式进行解码,计算出相应数值发送给DAQ卡,输出模拟信号.DAQ卡的配置可通过LabVIEW自带的DAQ Assistant助手.结果:可准确输出心电、脑电、肌电、体温、呼吸、血压等多种人体生理信号,信号的幅值等参数可调.结论:利用虚拟仪器技术可简单灵活地输出多种人体生理参数,与其他只能重复输出相同波形且价格昂贵的模拟仪比,本研究的人体生理信号发生器具有很高的性价比.%Objective: A human physiological signals generator based on virtual instrument is developed. Methods: We utilize the PCI data acquisition card by NI corporation (which has both AD and DA functions, in this study we only use the DA function) and the PC as system's hardware, the master machine program developed with Lab VIEW environment as system's software. By utilizing the huge amount of freely accessible digital human physiological signals provided by MIT-BIH and other databases, the system can generate analog human physiological signals. The system's hardware is composed of NI-PCI 6221 DAQ card and the PC. Firstly, the software read the head file, and several variables were set according to the fields of the head file. Secondly, data file was read into the computer by decoding the file format. The configuration of the DAQ card was made by utilizing the DAQ assistant. Lastly, a figure was computed and sent to the DAQ card to output the analog signal. Results: The system can precisely generate many kinds of human physiological

  7. Observations of the supernova remnant SNR G284.3-1.8 from X-rays to VHE gamma-rays with XMM-Newton, Fermi and H.E.S.S.

    Science.gov (United States)

    de Ona Wilhelmi, Emma; Terrier, Regis; Chaves, Ryan; de Jager, Ocker; Djannati-Ataï, Arache; Abramowski, A.; Acero, F.; Aharonian, F.; Akhperjanian, A. G.; Anton, G.; Barres de Almeida, U.; Bazer-Bachi, A. R.; Becherini, Y.; Behera, B.; Bernlühr, K.; Bochow, A.; Boisson, C.; Bolmont, J.; Borrel, V.; Brucker, J.; Brun, F.; Brun, P.; Bühler, R.; Bulik, T.; Büsching, I.; Boutelier, T.; Chadwick, P. M.; Charbonnier, A.; Chaves, R. C. G.; Cheesebrough, A.; Conrad, J.; Chounet, L.-M.; Clapson, A. C.; Coignet, G.; Dalton, M.; Daniel, M. K.; Davids, I. D.; Degrange, B.; Deil, C.; Dickinson, H. J.; Domainko, A. Djannati-Ataü W.; Drury, L. O'c.; Dubois, F.; Dubus, G.; Dyks, J.; Dyrda, M.; Egberts, K.; Eger, P.; Espigat, P.; Fallon, L.; Farnier, C.; Fegan, S.; Feinstein, F.; Fernandes, M. V.; Fiasson, A.; Fürster, A.; Fontaine, G.; Füssling, M.; Gabici, S.; Gallant, Y. A.; Gérard, L.; Gerbig, D.; Giebels, B.; Glicenstein, J. F.; Glück, B.; Goret, P.; Güring, D.; Hampf, D.; Hauser, M.; Heinz, S.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hoffmann, A.; Hofmann, W.; Hofverberg, P.; Holleran, M.; Hoppe, S.; Horns, D.; Jacholkowska, A.; de Jager, O. C.; Jahn, C.; Jung, I.; Katarzynski, K.; Katz, U.; Kaufmann, S.; Kerschhaggl, M.; Khangulyan, D.; Khálifi, B.; Keogh, D.; Klochkov, D.; Kluzniak, W.; Kneiske, T.; Komin, Nu.; Kosack, K.; Kossakowski, R.; Lamanna, G.; Lenain, J.-P.; Lohse, T.; Lu, C.-C.; Marandon, V.; Marcowith, A.; Masbou, J.; Maurin, D.; McComb, T. J. L.; Medina, M. C.; Méhault, J.; Moderski, R.; Moulin, E.; Naumann-Godo, M.; de Naurois, M.; Nedbal, D.; Nekrassov, D.; Nguyen, N.; Nicholas, B.; Niemiec, J.; Nolan, S. J.; Ohm, S.; Olive, J.-F.; de Ona Wilhelmi, E.; Opitz, B.; Orford, K. J.; Ostrowski, M.; Panter, M.; Paz Arribas, M.; Pedaletti, G.; Pelletier, G.; Petrucci, P.-O.; Pita, S.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raubenheimer, B. C.; Raue, M.; Rayner, S. M.; Reimer, O.; Renaud, M.; de Los Reyes, R.; Rieger, F.; Ripken, J.; Rob, L.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Ruppel, J.; Ryde, F.; Sahakian, V.; Santangelo, A.; Schlickeiser, R.; Schück, F. M.; Schünwald, A.; Schwanke, U.; Schwarzburg, S.; Schwemmer, S.; Shalchi, A.; Sushch, I.; Sikora, M.; Skilton, J. L.; Sol, H.; Stawarz, L.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Szostek, A.; Tam, P. H.; Tavernet, J.-P.; Terrier, R.; Tibolla, O.; Tluczykont, M.; Valerius, K.; van Eldik, C.; Vasileiadis, G.; Venter, C.; Venter, L.; Vialle, J. P.; Viana, A.; Vincent, P.; Vivier, M.; Vülk, H. J.; Volpe, F.; Vorobiov, S.; Wagner, S. J.; Ward, M.; Zdziarski, A. A.; Zech, A.; Zechlin, H.-S.

    SNR G284.3-1.8 is an incomplete radio shell with nonthermal spectrum, interacting with molec-ular clouds. It has been associated with the Vela-like pulsar PSR J1016-5857 in a search for a counterpart of the unidentified source 3EG J1013-5915 with the Parkes telescope. However, to make such an association one has to reconcile distance measurements of the SNR (CO line; 3 kpc) and the pulsar (dispersion measure; 8 or 9 kpc) as well as the large offset between the center of the shell and the pulsar. We have found an X-ray hotspot inside the shell thanks to archival Einstein observations. We present the result of XMM-Newton observations of the SNR and discuss the nature of this central object and its possible association with the SNR. Recently, the release of the Fermi-LAT telescope 11-month catalog has confirmed a bright high-energy (HE) source (1FGL J1018.6-5856) coincident with both the SNR and its central X-ray object. Finally, we report on the results of 40h of very-high-energy (VHE) gamma-rays observations of the region performed with the H.E.S.S. telescope array. This extensive multi-wavelength coverage of SNR G284.3-1.8 and its likely PSR/PWN system from radio to VHE gamma-rays allow us to shed light on the origin of the HE and VHE emission as well as to help to resolve the association between the SNR and PSR/PWN candidate.

  8. Multi-pollutants sensors based on near-IR telecom lasers and mid-IR difference frequency generation: development and applications; Instruments de mesure multi-polluants par spectroscopie infrarouge bases sur des lasers fibres et par generation de difference de frequences: developpement et applications

    Energy Technology Data Exchange (ETDEWEB)

    Cousin, J

    2006-12-15

    At present the detection of VOC and other anthropic trace pollutants is an important challenge in the measurement of air quality. Infrared spectroscopy, allowing spectral regions rich in molecular absorption to be probed, is a suitable technique for in-situ monitoring of the air pollution. Thus the aim of this work was to develop instruments capable of detecting multiple pollutants for in-situ monitoring by IR spectroscopy. A first project benefited from the availability of the telecommunications lasers emitting in near-IR. This instrument was based on an external cavity diode laser (1500 - 1640 nm) in conjunction with a multipass cell (100 m). The detection sensitivity was optimised by employing a balanced detection and a sweep integration procedure. The instrument developed is deployable for in-situ measurements with a sensitivity of < 10{sup -8} cm{sup -1} Hz{sup -1/2} and allowed the quantification of chemical species such as CO{sub 2}, CO, C{sub 2}H{sub 2}, CH{sub 4} and the determination of the isotopic ratio {sup 13}CO{sub 2}/{sup 12}CO{sub 2} in combustion environment The second project consisted in mixing two near-IR fiber lasers in a non-linear crystal (PPLN) in order to produce a laser radiation by difference frequency generation in the middle-IR (3.15 - 3.43 {mu}m), where the absorption bands of the molecules are the most intense. The first studies with this source were carried out on detection of ethylene (C{sub 2}H{sub 4}) and benzene (C{sub 6}H{sub 6}). Developments, characterizations and applications of these instruments in the near and middle IR are detailed and the advantages of the 2 spectral ranges is highlighted. (author)

  9. The ESO Paranal instrumentation program

    Science.gov (United States)

    Pasquini, Luca

    2016-08-01

    The Paranal Instrumentation Programme is responsible for planning and delivering the instruments and the associated infrastructure needed to keep the VLT and La Silla Observatories at the forefront of ground-based astronomy. The VLT second generation instruments KMOS, MUSE and SPHERE have been delivered and are in operations, GRAVITY is under commissioning at the renewed VLTI facility. The Adapative Optics Facility is moving towards completion, as well as the high resolution spectrograph ESPRESSO and the VLTI second generation instrument MATISSE. The mid-IR imager and spectrograph VISIR has been upgraded, and a major upgrade of the CRIRES spectrograph is under way. Finally, two new Multi Object Spectrographs projects have started, one for the VLT (MOONS), one for the 4M VISTA telescope (4MOST), and two new instruments for La Silla, (SOXS and NIRPS) fully funded by the community, are being agreed. The Programme follows a roadmap that foresees one new instrument/project or one upgrade starting every year. Active management, cost to completion and risk policy are in place.

  10. Feasibility of VHE gamma ray detection by an array of imaging atmospheric Cherenkov telescopes using the fluorescence technique

    CERN Document Server

    Contreras, J L; Arqueros, F; López, M; Barrio, J A; Nievas, M

    2015-01-01

    The last 20 years have seen the development of new techniques in Astroparticle Physics providing access to the highest end of the electromagnetic spectrum. It has been shown that some sources emit photons up to energies close to 100 TeV. Yet the fluxes of these photons are incredibly low and new detection techniques are needed to go higher in energy. A new technique that would use the new generation of Cherenkov Telescopes, i.e., the Cherenkov Telescope Array (CTA), is proposed to push further the energy frontier. It is based on the detection of the fluorescence radiation emitted in extensive air showers, a successful method used in ultra-high-energy cosmic ray experiments, like the Pierre Auger Observatory. It would complement the standard imaging atmospheric Cherenkov technique with only minor modifications of the hardware currently being developed for the CTA and would not imply significant extra costs during its planned operation.

  11. Information system for data management of civil buildings instrumentation in generating power stations; Sistema de informacion para el manejo de datos de la instrumentacion de las obras civiles de las centrales generadoras

    Energy Technology Data Exchange (ETDEWEB)

    Alvarado, Alonso; Escamilla, Juan Carlos; Alaniz, Felipe de Jesus [Instituto de Investigaciones Electricas, Cuernavaca (Mexico); Gonzalez, Francisco; Mena, Enrique [Comision Federal de Electricidad, Mexico, D. F. (Mexico)

    1997-12-31

    A relevant task performed by Comision Federal de Electricidad (CFE) is the analysis of the structural behavior and safety assessment of the country`s large electric energy generating stations. This task is performed capturing, revising an analyzing the information generated by measuring instruments installed in the power station civil structures. Such activity generates a large amount of data and the collection, analysis and assessment is a long and tiresome process; additionally, the generated information is kept in plain isolated files, that causes sluggishness in the process and delays in the access to the information. This article describes the characteristics of the Information System for Structure Measurements (Sistema de Informacion de Medicion de Estructuras) (SIME), developed by the Instituto de Investigaciones Electricas (IIE) for CFE in order to enhance the opportunity for the information management. SIME captures, arranges, stores and reports the data obtained from the measurements at the works with great efficiency and flexibility. This system is part of another of greater scope with which CFE will ensure an optimum operation condition of its civil buildings. [Espanol] Una tarea relevante que realiza la Comision Federal de Electricidad (CFE) es analizar el comportamiento estructural y evaluar la seguridad de las grandes obras generadoras de energia electrica del pais. Esta tarea la realiza capturando, revisando y analizando la informacion que generan instrumentos de medicion instalados en las estructuras civiles de las centrales. Tal actividad genera gran cantidad de datos y el proceso de recopilacion, analisis y evaluacion es tardado y tedioso; ademas, la informacion que se genera se guarda en archivos planos aislados, lo que ocasiona lentitud en el proceso y retraso en el acceso a la informacion. Este articulo describe las caracteristicas del Sistema de Informacion de Medicion de Estructuras (SIME) desarrollado por el Instituto de Investigaciones

  12. Experiences in the instrumentation of power generators with the on-line analysis of generators AnGel system, for the internal insulation condition diagnosis; Experiencias en la instrumentacion de generadores de potencia con el sistema de analisis de generadores en linea AnGeL, para el diagnostico del estado del aislamiento interno

    Energy Technology Data Exchange (ETDEWEB)

    Carrillo C, Jaime; Ramirez N, Jose T. [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)

    2009-07-01

    The instrumentation of power generators with monitoring systems on-line, allows the personnel responsible for its operation to determine the stator and rotor windings insulation condition, as well as to emit an opportune diagnosis of possible anomalies, to implant programs of predictive maintenance, to reduce costs and to increase its reliability. The experiences of the last five years in the commissioning of the AnGel System; the problematic to which these equipment is subjected to, is described within the intrinsic atmosphere of the area where they are installed in the turbo-generators and hydro-generators, and finally, the experiences in the commissioning of the monitoring systems are revised and analyzed. [Spanish] La instrumentacion de los generadores de potencia con sistemas de monitoreo en linea, permite al personal responsable de su operacion determinar el estado del aislamiento de los devanados del estator y rotor, asi como emitir un diagnostico oportuno de posibles anomalias, implantar programas de mantenimiento predictivo, reducir costos e incrementar su confiabilidad. Se presentan las experiencias de los ultimos cinco anos en la puesta en operacion del Sistema AnGeL; se describe la problematica a la que son sometidos estos equipos dentro del ambiente intrinseco del area donde se instalan en los turbogeneradores e hidrogeneradores, y por ultimo, se analizan y discuten las experiencias en la puesta en servicio de los sistemas de monitoreo.

  13. CARMENES instrument overview

    Science.gov (United States)

    Quirrenbach, A.; Amado, P. J.; Caballero, J. A.; Mundt, R.; Reiners, A.; Ribas, I.; Seifert, W.; Abril, M.; Aceituno, J.; Alonso-Floriano, F. J.; Ammler-von Eiff, M.; Antona Jiménez, R.; Anwand-Heerwart, H.; Azzaro, M.; Bauer, F.; Barrado, D.; Becerril, S.; Béjar, V. J. S.; Benítez, D.; Berdiñas, Z. M.; Cárdenas, M. C.; Casal, E.; Claret, A.; Colomé, J.; Cortés-Contreras, M.; Czesla, S.; Doellinger, M.; Dreizler, S.; Feiz, C.; Fernández, M.; Galadí, D.; Gálvez-Ortiz, M. C.; García-Piquer, A.; García-Vargas, M. L.; Garrido, R.; Gesa, L.; Gómez Galera, V.; González Álvarez, E.; González Hernández, J. I.; Grözinger, U.; Guàrdia, J.; Guenther, E. W.; de Guindos, E.; Gutiérrez-Soto, J.; Hagen, H.-J.; Hatzes, A. P.; Hauschildt, P. H.; Helmling, J.; Henning, T.; Hermann, D.; Hernández Castaño, L.; Herrero, E.; Hidalgo, D.; Holgado, G.; Huber, A.; Huber, K. F.; Jeffers, S.; Joergens, V.; de Juan, E.; Kehr, M.; Klein, R.; Kürster, M.; Lamert, A.; Lalitha, S.; Laun, W.; Lemke, U.; Lenzen, R.; López del Fresno, Mauro; López Martí, B.; López-Santiago, J.; Mall, U.; Mandel, H.; Martín, E. L.; Martín-Ruiz, S.; Martínez-Rodríguez, H.; Marvin, C. J.; Mathar, R. J.; Mirabet, E.; Montes, D.; Morales Muñoz, R.; Moya, A.; Naranjo, V.; Ofir, A.; Oreiro, R.; Pallé, E.; Panduro, J.; Passegger, V.-M.; Pérez-Calpena, A.; Pérez Medialdea, D.; Perger, M.; Pluto, M.; Ramón, A.; Rebolo, R.; Redondo, P.; Reffert, S.; Reinhardt, S.; Rhode, P.; Rix, H.-W.; Rodler, F.; Rodríguez, E.; Rodríguez-López, C.; Rodríguez-Pérez, E.; Rohloff, R.-R.; Rosich, A.; Sánchez-Blanco, E.; Sánchez Carrasco, M. A.; Sanz-Forcada, J.; Sarmiento, L. F.; Schäfer, S.; Schiller, J.; Schmidt, C.; Schmitt, J. H. M. M.; Solano, E.; Stahl, O.; Storz, C.; Stürmer, J.; Suárez, J. C.; Ulbrich, R. G.; Veredas, G.; Wagner, K.; Winkler, J.; Zapatero Osorio, M. R.; Zechmeister, M.; Abellán de Paco, F. J.; Anglada-Escudé, G.; del Burgo, C.; Klutsch, A.; Lizon, J. L.; López-Morales, M.; Morales, J. C.; Perryman, M. A. C.; Tulloch, S. M.; Xu, W.

    2014-07-01

    This paper gives an overview of the CARMENES instrument and of the survey that will be carried out with it during the first years of operation. CARMENES (Calar Alto high-Resolution search for M dwarfs with Exoearths with Near-infrared and optical Echelle Spectrographs) is a next-generation radial-velocity instrument under construction for the 3.5m telescope at the Calar Alto Observatory by a consortium of eleven Spanish and German institutions. The scientific goal of the project is conducting a 600-night exoplanet survey targeting ~ 300 M dwarfs with the completed instrument. The CARMENES instrument consists of two separate echelle spectrographs covering the wavelength range from 0.55 to 1.7 μm at a spectral resolution of R = 82,000, fed by fibers from the Cassegrain focus of the telescope. The spectrographs are housed in vacuum tanks providing the temperature-stabilized environments necessary to enable a 1 m/s radial velocity precision employing a simultaneous calibration with an emission-line lamp or with a Fabry-Perot etalon. For mid-M to late-M spectral types, the wavelength range around 1.0 μm (Y band) is the most important wavelength region for radial velocity work. Therefore, the efficiency of CARMENES has been optimized in this range. The CARMENES instrument consists of two spectrographs, one equipped with a 4k x 4k pixel CCD for the range 0.55 - 1.05 μm, and one with two 2k x 2k pixel HgCdTe detectors for the range from 0.95 - 1.7μm. Each spectrograph will be coupled to the 3.5m telescope with two optical fibers, one for the target, and one for calibration light. The front end contains a dichroic beam splitter and an atmospheric dispersion corrector, to feed the light into the fibers leading to the spectrographs. Guiding is performed with a separate camera; on-axis as well as off-axis guiding modes are implemented. Fibers with octagonal cross-section are employed to ensure good stability of the output in the presence of residual guiding errors. The

  14. IOT Overview: IR Instruments

    Science.gov (United States)

    Mason, E.

    In this instrument review chapter the calibration plans of ESO IR instruments are presented and briefly reviewed focusing, in particular, on the case of ISAAC, which has been the first IR instrument at VLT and whose calibration plan served as prototype for the coming instruments.

  15. Efficacy of the third-generation instrumentation for treatment of adult scoliosis%第三代脊柱内固定系统在成人脊柱侧凸中应用的疗效评价

    Institute of Scientific and Technical Information of China (English)

    李明; 刘洋; 倪春鸿; 朱晓东; 白玉树; 赵新刚; 侯铁胜

    2005-01-01

    目的:回顾分析TSRH、CD、Isola等第三代脊柱内固定系统在成人脊柱侧凸矫治中的应用并评价其疗效.方法:分析运用TSRH、CD、Isola脊柱内固定系统治疗的35例成人脊柱侧凸患者.术前冠状面主弯Cobb角平均58.1° (42°~95°),采用前后路联合矫形或单纯后路矫形手术方法.平均随访20个月(10~48个月).通过影像学资料对术前术后冠状面和矢状面的矫形效果对比分析并通过C7椎体中点距骶中线(CVSL)的距离来分析躯干平衡的重建,通过关于自我评估的问卷调查来获得患者主观治疗效果评价. 结果:所有患者术后外观矫形效果明显(P<0.05).总体冠状面主弯平均Cobb角矫正53.2%.末次随访冠状面Cobb角平均丢失4.3°.C7中点距CVSL由术前的平均2.6 cm矫正为术后的0.24 cm.通过随访期间的问卷调查89.3%以上的患者对外观改善、疼痛的缓解表示满意,2例术气胸、血胸,3例术后随访1年后仍主诉腰背部疼痛,其中2例为临近节段退变,1例为假关节形成. 结论:对于成人脊柱侧凸,第三代脊柱内固定系统能得到冠状面上较高的矫正率、重建躯干平衡,并且可以获得患者较高的满意度,并发症较少.%Objective: To evaluate the efficacy of the third-generation instrumentation including TSRH, CD and ISOLA in the treatment of adult scoliosis. Methods:Thirty-five adult patients with idiopathic or degenerative scoliosis who received treatment with third-generation instrumentation (TSRH,CD and ISOLA) between July 1999 to January 2003 were retrospectively reviewed. The mean preoperative cobb angle of major curves of the frontal plane was 58.1°(42°-95°). The patients received a combined anteroposterior approach or a single posterior procedure. The mean follow-up time was 20 months(10-48 months). Preoperative and postoperative Cobb angles of the frontal plane and sagittal plane and the distance between C7 and CVLS were measured. The subjective

  16. Instrumentation for multi-detector arrays

    Indian Academy of Sciences (India)

    R K Bhowmik

    2001-07-01

    The new generation of detector arrays require complex instrumentation and data acquisition system to ensure increased reliability of operation, high degree of integration, software control and faster data handling capability. The main features of some of the existing multi-detector arrays like MSU 4 array, Gammasphere and Eurogam are summarized. The instrumentation for the proposed INGA array in India is discussed.

  17. The Micronium-A Musical MEMS instrument

    NARCIS (Netherlands)

    Engelen, Johannes Bernardus Charles; de Boer, Hans L.; de Boer, Hylco; Beekman, Jethro G.; Fortgens, Laurens C.; de Graaf, Derk B.; Vocke, Sander; Abelmann, Leon

    The Micronium is a musical instrument fabricated from silicon using microelectromechanical system (MEMS) technology. It is—to the best of our knowledge—the first musical micro-instrument fabricated using MEMS technology, where the actual sound is generated by mechanical microstructures. The

  18. The 2010 very high energy gamma-ray flare & 10 years of multi-wavelength observations of M 87

    CERN Document Server

    Abramowski, A; Aharonian, F; Akhperjanian, A G; Anton, G; Balzer, A; Barnacka, A; de Almeida, U Barres; Becherini, Y; Becker, J; Behera, B; Bernlöhr, K; Birsin, E; Biteau, J; Bochow, A; Boisson, C; Bolmont, J; Bordas, P; Brucker, J; Brun, F; Brun, P; Bulik, T; Büsching, I; Carrigan, S; Casanova, S; Cerruti, M; Chadwick, P M; Charbonnier, A; Chaves, R C G; Cheesebrough, A; Clapson, A C; Coignet, G; Cologna, G; Conrad, J; Dalton, M; Daniel, M K; Davids, I D; Degrange, B; Deil, C; Dickinson, H J; Djannati-Ataï, A; Domainko, W; Drury, L O'C; Dubus, G; Dutson, K; Dyks, J; Dyrda, M; Egberts, K; Eger, P; Espigat, P; Fallon, L; Farnier, C; Fegan, S; Feinstein, F; Fernandes, M V; Fiasson, A; Fontaine, G; Förster, A; Füßling, M; Gallant, Y A; Gast, H; Gérard, L; Gerbig, D; Giebels, B; Glicenstein, J F; Glück, B; Goret, P; Göring, D; Häffner, S; Hague, J D; Hampf, D; Hauser, M; Heinz, S; Heinzelmann, G; Henri, G; Hermann, G; Hinton, J A; Hoffmann, A; Hofmann, W; Hofverberg, P; Holler, M; Horns, D; Jacholkowska, A; de Jager, O C; Jahn, C; Jamrozy, M; Jung, I; Kastendieck, M A; Katarzyński, K; Katz, U; Kaufmann, S; Keogh, D; Khangulyan, D; Khélifi, B; Klochkov, D; Kluźniak, W; Kneiske, T; Komin, Nu; Kosack, K; Kossakowski, R; Laffon, H; Lamanna, G; Lennarz, D; Lohse, T; Lopatin, A; Lu, C -C; Marandon, V; Marcowith, A; Masbou, J; Maurin, D; Maxted, N; Mayer, M; McComb, T J L; Medina, M C; Méhault, J; Moderski, R; Moulin, E; Naumann, C L; Naumann-Godo, M; de Naurois, M; Nedbal, D; Nekrassov, D; Nguyen, N; Nicholas, B; Niemiec, J; Nolan, S J; Ohm, S; Wilhelmi, E de Oña; Opitz, B; Ostrowski, M; Oya, I; Panter, M; Arribas, M Paz; Pedaletti, G; Pelletier, G; Petrucci, P -O; Pita, S; Pühlhofer, G; Punch, M; Quirrenbach, A; Raue, M; Rayner, S M; Reimer, A; Reimer, O; Renaud, M; Reyes, R de los; Rieger, F; Ripken, J; Rob, L; Rosier-Lees, S; Rowell, G; Rudak, B; Rulten, C B; Ruppel, J; Sahakian, V; Sanchez, D A; Santangelo, A; Schlickeiser, R; Schöck, F M; Schulz, A; Schwanke, U; Schwarzburg, S; Schwemmer, S; Sheidaei, F; Skilton, J L; Sol, H; Spengler, G; Stawarz, Ł; Steenkamp, R; Stegmann, C; Stinzing, F; Stycz, K; Sushch, I; Szostek, A; Tavernet, J -P; Terrier, R; Tluczykont, M; Valerius, K; van Eldik, C; Vasileiadis, G; Venter, C; Vialle, J P; Viana, A; Vincent, P; Völk, H J; Volpe, F; Vorobiov, S; Vorster, M; Wagner, S J; Ward, M; White, R; Wierzcholska, A; Zacharias, M; Zajczyk, A; Zdziarski, A A; Zech, A; Zechlin, H -S; Aleksić, J; Antonelli, L A; Antoranz, P; Backes, M; Barrio, J A; Bastieri, D; González, J Becerra; Bednarek, W; Berdyugin, A; Berger, K; Bernardini, E; Biland, A; Blanch, O; Bock, R K; Boller, A; Bonnoli, G; Tridon, D Borla; Braun, I; Bretz, T; Cañellas, A; Carmona, E; Carosi, A; Colin, P; Colombo, E; Contreras, J L; Cortina, J; Cossio, L; Covino, S; Dazzi, F; De Angelis, A; del Pozo, E De Cea; De Lotto, B; Mendez, C Delgado; Ortega, A Diago; Doert, M; Domínguez, A; Prester, D Dominis; Dorner, D; Doro, M; Elsaesser, D; Ferenc, D; Fonseca, M V; Font, L; Fruck, C; López, R J García; Garczarczyk, M; Garrido, D; Giavitto, G; Godinović, N; Hadasch, D; Häfner, D; Herrero, A; Hildebrand, D; Höhne-Mönch, D; Hose, J; Hrupec, D; Huber, B; Jogler, T; Klepser, S; Krähenbühl, T; Krause, J; La Barbera, A; Lelas, D; Leonardo, E; Lindfors, E; Lombardi, S; López, M; Lorenz, E; Makariev, M; Maneva, G; Mankuzhiyil, N; Mannheim, K; Maraschi, L; Mariotti, M; Martínez, M; Mazin, D; Meucci, M; Miranda, J M; Mirzoyan, R; Miyamoto, H; Moldón, J; Moralejo, A; Munar, P; Nieto, D; Nilsson, K; Orito, R; Oya, I; Paneque, D; Paoletti, R; Pardo, S; Paredes, J M; Partini, S; Pasanen, M; Pauss, F; Perez-Torres, M A; Persic, M; Peruzzo, L; Pilia, M; Pochon, J; Prada, F; Moroni, P G Prada; Prandini, E; Puljak, I; Reichardt, I; Reinthal, R; Rhode, W; Ribó, M; Rico, J; Rügamer, S; Saggion, A; Saito, K; Saito, T Y; Salvati, M; Satalecka, K; Scalzotto, V; Scapin, V; Schultz, C; Schweizer, T; Shayduk, M; Shore, S N; Sillanpää, A; Sitarek, J; Sobczynska, D; Spanier, F; Spiro, S; Stamerra, A; Steinke, B; Storz, J; Strah, N; Surić, T; Takalo, L; Takami, H; Tavecchio, F; Temnikov, P; Terzić, T; Tescaro, D; Teshima, M; Thom, M; Tibolla, O; Torres, D F; Treves, A; Vankov, H; Vogler, P; Wagner, R M; Weitzel, Q; Zabalza, V; Zandanel, F; Zanin, R; Arlen, T; Aune, T; Beilicke, M; Benbow, W; Bouvier, A; Bradbury, S M; Buckley, J H; Bugaev, V; Byrum, K; Cannon, A; Cesarini, A; Ciupik, L; Connolly, M P; Cui, W; Dickherber, R; Duke, C; Errando, M; Falcone, A; Finley, J P; Finnegan, G; Fortson, L; Furniss, A; Galante, N; Gall, D; Godambe, S; Griffin, S; Grube, J; Gyuk, G; Hanna, D; Holder, J; Huan, H; Hui, C M; Kaaret, P; Karlsson, N; Kertzman, M; Khassen, Y; Kieda, D; Krawczynski, H; Krennrich, F; Lang, M J; LeBohec, S; Maier, G; McArthur, S; McCann, A; Moriarty, P; Mukherjee, R; Nuñez, P D; Ong, R A; Orr, M; Otte, A N; Park, N; Perkins, J S; Pichel, A; Pohl, M; Prokoph, H; Ragan, K; Reyes, L C; Reynolds, P T; Roache, E; Rose, H J; Ruppel, J; Schroedter, M; Sembroski, G H; Şentürk, G D; Telezhinsky, I; Tešić, G; Theiling, M; Thibadeau, S; Varlotta, A; Vassiliev, V V; Vivier, M; Wakely, S P; Weekes, T C; Williams, D A; Zitzer, B; de Almeida, U Barres; Cara, M; Casadio, C; Cheung, C C; McConville, W; Davies, F; Doi, A; Giovannini, G; Giroletti, M; Hada, K; Hardee, P; Harris, D E; Junor, W; Kino, M; Lee, N P; Ly, C; Madrid, J; Massaro, F; Mundell, C G; Nagai, H; Perlman, E S; Steele, I A; Walker, R C; Wood, D L

    2011-01-01

    Abridged: The giant radio galaxy M 87 with its proximity, famous jet, and very massive black hole provides a unique opportunity to investigate the origin of very high energy (VHE; E>100 GeV) gamma-ray emission generated in relativistic outflows and the surroundings of super-massive black holes. M 87 has been established as a VHE gamma-ray emitter since 2006. The VHE gamma-ray emission displays strong variability on timescales as short as a day. In this paper, results from a joint VHE monitoring campaign on M 87 by the MAGIC and VERITAS instruments in 2010 are reported. During the campaign, a flare at VHE was detected triggering further observations at VHE (H.E.S.S.), X-rays (Chandra), and radio (43 GHz VLBA). The excellent sampling of the VHE gamma-ray light curve enables one to derive a precise temporal characterization of the flare: the single, isolated flare is well described by a two-sided exponential function with significantly different flux rise and decay times. While the overall variability pattern of...

  19. Detectors for Tomorrow's Instruments

    Science.gov (United States)

    Moseley, Harvey

    2009-01-01

    Cryogenically cooled superconducting detectors have become essential tools for a wide range of measurement applications, ranging from quantum limited heterodyne detection in the millimeter range to direct searches for dark matter with superconducting phonon detectors operating at 20 mK. Superconducting detectors have several fundamental and practical advantages which have resulted in their rapid adoption by experimenters. Their excellent performance arises in part from reductions in noise resulting from their low operating temperatures, but unique superconducting properties provide a wide range of mechanisms for detection. For example, the steep dependence of resistance with temperature on the superconductor/normal transition provides a sensitive thermometer for calorimetric and bolometric applications. Parametric changes in the properties of superconducting resonators provides a mechanism for high sensitivity detection of submillimeter photons. From a practical point of view, the use of superconducting detectors has grown rapidly because many of these devices couple well to SQUID amplifiers, which are easily integrated with the detectors. These SQUID-based amplifiers and multiplexers have matured with the detectors; they are convenient to use, and have excellent noise performance. The first generation of fully integrated large scale superconducting detection systems are now being deployed. I will discuss the prospects for a new generation of instruments designed to take full advantage of the revolution in detector technology.

  20. Instrument Modeling and Synthesis

    Science.gov (United States)

    Horner, Andrew B.; Beauchamp, James W.

    During the 1970s and 1980s, before synthesizers based on direct sampling of musical sounds became popular, replicating musical instruments using frequency modulation (FM) or wavetable synthesis was one of the “holy grails” of music synthesis. Synthesizers such as the Yamaha DX7 allowed users great flexibility in mixing and matching sounds, but were notoriously difficult to coerce into producing sounds like those of a given instrument. Instrument design wizards practiced the mysteries of FM instrument design.

  1. Performing the Super Instrument

    DEFF Research Database (Denmark)

    Kallionpaa, Maria

    2016-01-01

    The genre of contemporary classical music has seen significant innovation and research related to new super, hyper, and hybrid instruments, which opens up a vast palette of expressive potential. An increasing number of composers, performers, instrument designers, engineers, and computer programmers...... provides the performer extensive virtuoso capabilities in terms of instrumental range, harmony, timbre, or spatial, textural, acoustic, technical, or technological qualities. The discussion will be illustrated by a composition case study involving augmented musical instrument electromagnetic resonator...

  2. Performing the Super Instrument

    DEFF Research Database (Denmark)

    Kallionpaa, Maria

    2016-01-01

    provides the performer extensive virtuoso capabilities in terms of instrumental range, harmony, timbre, or spatial, textural, acoustic, technical, or technological qualities. The discussion will be illustrated by a composition case study involving augmented musical instrument electromagnetic resonator......The genre of contemporary classical music has seen significant innovation and research related to new super, hyper, and hybrid instruments, which opens up a vast palette of expressive potential. An increasing number of composers, performers, instrument designers, engineers, and computer programmers...

  3. Aeroacoustics of Musical Instruments

    NARCIS (Netherlands)

    Fabre, B.; Gilbert, J.; Hirschberg, A.; Pelorson, X.

    2012-01-01

    We are interested in the quality of sound produced by musical instruments and their playability. In wind instruments, a hydrodynamic source of sound is coupled to an acoustic resonator. Linear acoustics can predict the pitch of an instrument. This can significantly reduce the trial-and-error process

  4. VIRUS instrument enclosures

    Science.gov (United States)

    Prochaska, T.; Allen, R.; Mondrik, N.; Rheault, J. P.; Sauseda, M.; Boster, E.; James, M.; Rodriguez-Patino, M.; Torres, G.; Ham, J.; Cook, E.; Baker, D.; DePoy, Darren L.; Marshall, Jennifer L.; Hill, G. J.; Perry, D.; Savage, R. D.; Good, J. M.; Vattiat, Brian L.

    2014-08-01

    The Visible Integral-Field Replicable Unit Spectrograph (VIRUS) instrument will be installed at the Hobby-Eberly Telescope† in the near future. The instrument will be housed in two enclosures that are mounted adjacent to the telescope, via the VIRUS Support Structure (VSS). We have designed the enclosures to support and protect the instrument, to enable servicing of the instrument, and to cool the instrument appropriately while not adversely affecting the dome environment. The system uses simple HVAC air handling techniques in conjunction with thermoelectric and standard glycol heat exchangers to provide efficient heat removal. The enclosures also provide power and data transfer to and from each VIRUS unit, liquid nitrogen cooling to the detectors, and environmental monitoring of the instrument and dome environments. In this paper, we describe the design and fabrication of the VIRUS enclosures and their subsystems.

  5. Gemini Instrument Upgrade Program

    Science.gov (United States)

    Diaz, Ruben; Goodsell, Stephen; Kleinman, Scot

    2016-08-01

    The Gemini Observatory* remains committed to keeping its operational instrumentation competitive and serving the needs of its user community. Currently the observatory operates a 4 instruments + 1 AO system at each site. At Gemini North the GMOS-N, GNIRS, NIFS and NIRI instruments are offered supported by the ALTAIR AO system. In the south, GMOS-S, F-2, GPI and GSAOI are offered instrumentation and GeMS is the provided AO System. This paper reviews our strategy to keep our instrumentation suite competitive, examines both our current funded upgrade projects and our potential future enhancements. We summarize the work done and the results so far obtained within the instrument upgrade program.

  6. Instrumentation a reader

    CERN Document Server

    Pope, P

    1990-01-01

    This book contains a selection of papers and articles in instrumentation previously pub­ lished in technical periodicals and journals of learned societies. Our selection has been made to illustrate aspects of current practice and applications of instrumentation. The book does not attempt to be encyclopaedic in its coverage of the subject, but to provide some examples of general transduction techniques, of the sensing of particular measurands, of components of instrumentation systems and of instrumentation practice in two very different environments, the food industry and the nuclear power industry. We have made the selection particularly to provide papers appropriate to the study of the Open University course T292 Instrumentation. The papers have been chosen so that the book covers a wide spectrum of instrumentation techniques. Because of this, the book should be of value not only to students of instrumen­ tation, but also to practising engineers and scientists wishing to glean ideas from areas of instrumen...

  7. Aircrew Screening Instruments Review

    Science.gov (United States)

    2007-09-01

    available tools . Several vendors indicated that they will have new selection instruments available within a few months. These are not listed. As noted...AFCAPS-FR-2011-0012 AIRCREW SCREENING INSTRUMENTS REVIEW Diane L. Damos Damos Aviation Services, Inc...June 2007 – August 2007 4. TITLE AND SUBTITLE Aircrew Screening Instruments Review 5a. CONTRACT NUMBER FA3089-06-F-0385 5b. GRANT NUMBER 5c

  8. Instrumentation in Earthquake Seismology

    Science.gov (United States)

    Havskov, Jens; Alguacil, Gerardo

    Here is unique and comprehensive coverage of modern seismic instrumentation, based on the authors' practical experience of a quarter-century in seismology and geophysics. Their goal is to provide not only detailed information on the basics of seismic instruments but also to survey equipment on the market, blending this with only the amount of theory needed to understand the basic principles. Seismologists and technicians working with seismological instruments will find here the answers to their practical problems.

  9. [Controlling instruments in radiology].

    Science.gov (United States)

    Maurer, M

    2013-10-01

    Due to the rising costs and competitive pressures radiological clinics and practices are now facing, controlling instruments are gaining importance in the optimization of structures and processes of the various diagnostic examinations and interventional procedures. It will be shown how the use of selected controlling instruments can secure and improve the performance of radiological facilities. A definition of the concept of controlling will be provided. It will be shown which controlling instruments can be applied in radiological departments and practices. As an example, two of the controlling instruments, material cost analysis and benchmarking, will be illustrated.

  10. Ocean Optics Instrumentation Systems

    Data.gov (United States)

    Federal Laboratory Consortium — FUNCTION: Provides instrumentation suites for a wide variety of measurements to characterize the ocean’s optical environment. These packages have been developed to...

  11. Networked Instrumentation Element

    Data.gov (United States)

    National Aeronautics and Space Administration — Armstrong researchers have developed a networked instrumentation system that connects modern experimental payloads to existing analog and digital communications...

  12. Satellite oceanography - The instruments

    Science.gov (United States)

    Stewart, R. H.

    1981-01-01

    It is pointed out that no instrument is sensitive to only one oceanographic variable; rather, each responds to a combination of atmospheric and oceanic phenomena. This complicates data interpretation and usually requires that a number of observations, each sensitive to somewhat different phenomena, be combined to provide unambiguous information. The distinction between active and passive instruments is described. A block diagram illustrating the steps necessary to convert data from satellite instruments into oceanographic information is included, as is a diagram illustrating the operation of a radio-frequency radiometer. Attention is also given to the satellites that carry the various oceanographic instruments.

  13. Instrumentation and test gear circuits manual

    CERN Document Server

    Marston, R M

    2013-01-01

    Instrumentation and Test Gear Circuits Manual provides diagrams, graphs, tables, and discussions of several types of practical circuits. The practical circuits covered in this book include attenuators, bridges, scope trace doublers, timebases, and digital frequency meters. Chapter 1 discusses the basic instrumentation and test gear principles. Chapter 2 deals with the design of passive attenuators, and Chapter 3 with passive and active filter circuits. The subsequent chapters tackle 'bridge' circuits, analogue and digital metering techniques and circuitry, signal and waveform generation, and p

  14. Neural network signal understanding for instrumentation

    DEFF Research Database (Denmark)

    Pau, L. F.; Johansen, F. S.

    1990-01-01

    A report is presented on the use of neural signal interpretation theory and techniques for the purpose of classifying the shapes of a set of instrumentation signals, in order to calibrate devices, diagnose anomalies, generate tuning/settings, and interpret the measurement results. Neural signal......, and an explanation facility designed to help neural signal understanding is described. The results are compared to those obtained with a knowledge-based signal interpretation system using the same instrument and data...

  15. Instrumentation Design and Development Facilities

    Data.gov (United States)

    Federal Laboratory Consortium — RTTC has facilities for design, development and fabrication of: custominstrumentation, mobile instrumentation, miniaturized instrumentation, wirelessinstrumentation,...

  16. Data reduction for the MATISSE instrument

    CERN Document Server

    Millour, Florentin; Heininger, M; Hofmann, K -H; Schertl, D; Weigelt, G; Guitton, F; Jaffe, W; Beckmann, U; Petrov, R; Allouche, F; Robbe-Dubois, S; Lagarde, S; Soulain, A; Meilland, A; Matter, A; Cruzalèbes, P; Lopez, B

    2016-01-01

    We present in this paper the general formalism and data processing steps used in the MATISSE data reduction software, as it has been developed by the MATISSE consortium. The MATISSE instrument is the mid-infrared new generation interferometric instrument of the Very Large Telescope Interferometer (VLTI). It is a 2-in-1 instrument with 2 cryostats and 2 detectors: one 2k x 2k Rockwell Hawaii 2RG detector for L&M-bands, and one 1k x 1k Raytheon Aquarius detector for N-band, both read at high framerates, up to 30 frames per second. MATISSE is undergoing its first tests in laboratory today.

  17. Development of the physician satisfaction survey instrument.

    Science.gov (United States)

    Soo Hoo, W E; Ramer, L

    1998-01-01

    Continuous quality improvement (CQI) activities depend on valid and reliable instruments to generate data. An evaluation of internal and external customer satisfaction is one of the pillars of the CQI process. This article describes the development of a valid and reliable instrument for measuring physicians' satisfaction with the orthopedic nursing units at a major medical trauma center. The physician satisfaction survey instrument was found to be internally consistent (alpha = .95). Confirmatory factor analysis revealed that 68% of the variance in physician satisfaction scores (eigenvalue = 8.14) was explained by using a single-factor model.

  18. Particle size distribution instrument. Topical report 13

    Energy Technology Data Exchange (ETDEWEB)

    Okhuysen, W.; Gassaway, J.D.

    1995-04-01

    The development of an instrument to measure the concentration of particles in gas is described in this report. An in situ instrument was designed and constructed which sizes individual particles and counts the number of occurrences for several size classes. Although this instrument was designed to detect the size distribution of slag and seed particles generated at an experimental coal-fired magnetohydrodynamic power facility, it can be used as a nonintrusive diagnostic tool for other hostile industrial processes involving the formation and growth of particulates. Two of the techniques developed are extensions of the widely used crossed beam velocimeter, providing simultaneous measurement of the size distribution and velocity of articles.

  19. Seroprevalence for hepatitis E virus (HEV infection among volunteer blood donors of the Regional Blood Bank of Londrina, State of Paraná , Brazil Soroprevalência da infecção pelo virus da hepatite E (VHE em candidatos a doadores de sangue voluntários do Hemocentro Regional de Londrina, Londrina, Estado do Paraná, Brasil

    Directory of Open Access Journals (Sweden)

    André Luiz Bortoliero

    2006-04-01

    Full Text Available A cross-sectional study was carried out among 996 volunteer blood donors enrolled from May 1999 to December 1999 to determine the seroprevalence of hepatitis E virus (HEV infection among volunteer blood donors of the Regional Blood Bank of Londrina, State of Paraná, Brazil, and to evaluate whether the rate of seroprevalence of IgG anti-HEV antibodies is associated with sociodemographic variables and with seropositivity for hepatitis A virus (HAV infection. All participants answered the questionnaire regarding the sociodemographic characterisitcs. Serum samples were tested for IgG antibodies to HEV (anti-HEV by an enzyme linked immunoassay (ELISA. All serum samples positive for anti-HEV IgG and 237 serum samples negative for anti-HEV were also assayed for IgG anti-HAV antibodies by ELISA. Anti-HEV IgG was confirmed in 23/996 samples, resulting in a seroprevalence of 2.3% for HEV infection, similar to previous results obtained in developed countries. No significant association was found between the presence of anti-HEV IgG antibodies and the sociodemographic variables including gender, age, educational level, rural or urban areas, source of water, and sewer system (p > 0.05. Also, no association with seropositivity for anti-HAV IgG antibodies was observed (p > 0.05. Although this study revealed a low seroprevalence of HEV infection in the population evaluated, the results showed that this virus is circulating among the population from Londrina, South Brazil, and point out the need of further studies to define the clinical and epidemiological importance of HEV infection and to identify additional risk factors involved in the epidemiology and pathogenesis of this infection in this population.Os objetivos do estudo foram determinar a soroprevalência da infecção pelo vírus da hepatite E (VHE em candidatos a doadores de sangue voluntários do Hemocentro Regional de Londrina, Paraná, e avaliar se essa soroprevalência está associada com vari

  20. BAA instrument no. 93

    Science.gov (United States)

    Marriott, R. A.

    2006-12-01

    Instrument no. 93 has been in almost continual use for more than a hundred years. Since it left the workshop of its maker, George Calver, it has kept company with several other notable instruments and has been used by many eminent astronomers. It was added to the Association's collection in 1945.

  1. Instrumentation in endourology

    OpenAIRE

    Khanna, Rakesh; Monga,Manoj

    2011-01-01

    Success with endourological procedures requires expertise and instrumentation. This review focuses on the instrumentation required for ureteroscopy and percutaneous nephrolithotomy, and provides a critical assessment of in vitro and clinical studies that have evaluated the comparative effectiveness of these medical devices.

  2. Molecular characterization of swine hepatitis E virus from Southeastern Brazil Caracterização molecular do vírus suíno da hepatite E (vhe encontrado no Sudeste do Brasil

    Directory of Open Access Journals (Sweden)

    Helder Henrique Paiva

    2007-12-01

    Full Text Available Despite serological evidences of presence of hepatitis E virus (HEV in humans or other animals, until this study the virus had not been detected and molecular characterization of the isolate that circulates in Brazil had not been described. Thus, we collected stool samples of young pigs and tested for presence of HEV RNA by RT-PCR, using primers for partial amplification of ORF2 sequence. Phylogenetic analysis with sequence obtained from the amplified products revealed that the HEV isolate identified here was most closely related to HEV isolates of genotype 3, which is commonly detected in HEV infected pigs. Nucleotide sequence analyses carried out with the entire amplified fragment, ORF2/ORF3 overlapping and ORF2 non-overlapping sequences showed highest identities with the US isolate of genotype 3. Similarly, amino acid sequence analyses done with the entire amplified fragment, ORF2 non-overlapping, ORF2 and ORF3 overlapping sequences also showed highest identities with the genotype 3 isolate. Presence, in Brazil, of HEV of genotype 4, which also infects pigs, as well as HEV strains that infect humans still remain to be detected and characterized.Apesar de evidências sorológicas da presença do vírus da hepatite E (VHE em humanos ou outros animais, até o presente estudo o vírus não havia sido detectado e a caracterização molecular da cepa que circula no Brasil não havia sido descrita. Assim, amostras de fezes de porcos jovens foram colhidas e analizadas quanto a presença do ARN do VHE por RT-PCR, utilizando-se oligonucleotídeos para amplificação da seqüência parcial do ORF2 viral. Análise filogenética realizada com a seqüência obtida dos produtos amplificados revelou que a cepa encontrada apresentou relação próxima com cepas do genótipo 3 que são detectadas com freqüência em porcos. Análises das seqüências nucleotídicas realizadas com todo o segmento amplificado, com somente o segmento sobreposto do ORF2/ORF3 e

  3. Policy Instruments towards a Sustainable Waste Management

    Directory of Open Access Journals (Sweden)

    Tomas Forsfält

    2013-02-01

    Full Text Available The aim of this paper is to suggest and discuss policy instruments that could lead towards a more sustainable waste management. The paper is based on evaluations from a large scale multi-disciplinary Swedish research program. The evaluations focus on environmental and economic impacts as well as social acceptance. The focus is on the Swedish waste management system but the results should be relevant also for other countries. Through the assessments and lessons learned during the research program we conclude that several policy instruments can be effective and possible to implement. Particularly, we put forward the following policy instruments: “Information”; “Compulsory recycling of recyclable materials”; “Weight-based waste fee in combination with information and developed recycling systems”; “Mandatory labeling of products containing hazardous chemicals”, “Advertisements on request only and other waste minimization measures”; and “Differentiated VAT and subsidies for some services”. Compulsory recycling of recyclable materials is the policy instrument that has the largest potential for decreasing the environmental impacts with the configurations studied here. The effects of the other policy instruments studied may be more limited and they typically need to be implemented in combination in order to have more significant impacts. Furthermore, policy makers need to take into account market and international aspects when implementing new instruments. In the more long term perspective, the above set of policy instruments may also need to be complemented with more transformational policy instruments that can significantly decrease the generation of waste.

  4. The Power of Optical/IR Interferometry: Recent Scientific Results and 2nd Generation Instrumentation Proceedings of the ESO Workshop held in Garching, Germany, 4-8 April 2005

    CERN Document Server

    Richichi, A; Paresce, F; Chelli, A

    2008-01-01

    Long-baseline interferometry has been traditionally regarded as a very technical method with a limited number of applications. At the turn of the millennium, with the introduction of large community-oriented facilities such as the VLTI, we are seeing a transformation into a major astronomical technique, with a corresponding dramatic increase in the number of publications. This book marks this transition, by providing a wide and deep insight into a large number of diverse and compelling results recently obtained by long-baseline interferometers. It also provides an insight into concepts which form the basis of future instruments and further developments in this technique.

  5. 一种基于虚拟仪器技术的任意波形发生器%Design of arbitrary waveform generator based on virtual instrument technology

    Institute of Scientific and Technical Information of China (English)

    王水鱼; 冯晓靖

    2013-01-01

    Using the advanced technology of virtual instrument , this paper designs an FPGA-based DDS signal source , so that it can output several fixed waveforms and arbitrary waveforms based on FPGA and on LabVIEW host-computer .%结合虚拟仪器技术,设计了一个基于 FPGA 的DDS 信号源。通过基于 FPGA 的下位机和LabVIEW 的上位机配合,使之能够输出几种固定波形和任意波形。

  6. Development of pulsed neutron uranium logging instrument

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Xin-guang, E-mail: wangxg@upc.edu.cn [School of Geosciences, China University of Petroleum, Qingdao 266580 (China); Engineering Research Center of Nuclear Technology Application (East China Institute of Technology), Ministry of Education, Nanchang 330013 (China); Liu, Dan [China Institute of Atomic Energy, Beijing 102413 (China); Zhang, Feng [School of Geosciences, China University of Petroleum, Qingdao 266580 (China)

    2015-03-15

    This article introduces a development of pulsed neutron uranium logging instrument. By analyzing the temporal distribution of epithermal neutrons generated from the thermal fission of {sup 235}U, we propose a new method with a uranium-bearing index to calculate the uranium content in the formation. An instrument employing a D-T neutron generator and two epithermal neutron detectors has been developed. The logging response is studied using Monte Carlo simulation and experiments in calibration wells. The simulation and experimental results show that the uranium-bearing index is linearly correlated with the uranium content, and the porosity and thermal neutron lifetime of the formation can be acquired simultaneously.

  7. Instrumentation reference book

    CERN Document Server

    Boyes, Walt

    2002-01-01

    Instrumentation is not a clearly defined subject, having a 'fuzzy' boundary with a number of other disciplines. Often categorized as either 'techniques' or 'applications' this book addresses the various applications that may be needed with reference to the practical techniques that are available for the instrumentation or measurement of a specific physical quantity or quality. This makes it of direct interest to anyone working in the process, control and instrumentation fields where these measurements are essential.* Comprehensive and authoritative collection of technical information* Writte

  8. Jones' instrument technology

    CERN Document Server

    Jones, Ernest Beachcroft; Kingham, Edward G; Radnai, Rudolf

    1985-01-01

    Jones' Instrument Technology, Volume 5: Automatic Instruments and Measuring Systems deals with general trends in automatic instruments and measuring systems. Specific examples are provided to illustrate the principles of such devices. A brief review of a considerable number of standards is undertaken, with emphasis on the IEC625 Interface System. Other relevant standards are reviewed, including the interface and backplane bus standards. This volume is comprised of seven chapters and begins with a short introduction to the principles of automatic measurements, classification of measuring system

  9. Medical instruments in museums

    DEFF Research Database (Denmark)

    Söderqvist, Thomas; Arnold, Ken

    2011-01-01

    This essay proposes that our understanding of medical instruments might benefit from adding a more forthright concern with their immediate presence to the current historical focus on simply decoding their meanings and context. This approach is applied to the intriguingly tricky question of what...... actually is meant by a "medical instrument." It is suggested that a pragmatic part of the answer might lie simply in reconsidering the holdings of medical museums, where the significance of the physical actuality of instruments comes readily to hand....

  10. Mass spectrometers: instrumentation

    Science.gov (United States)

    Cooks, R. G.; Hoke, S. H., II; Morand, K. L.; Lammert, S. A.

    1992-09-01

    Developments in mass spectrometry instrumentation over the past three years are reviewed. The subject is characterized by an enormous diversity of designs, a high degree of competition between different laboratories working with either different or similar techniques and by extremely rapid progress in improving analytical performance. Instruments can be grouped into genealogical charts based on their physical and conceptual interrelationships. This is illustrated using mass analyzers of different types. The time course of development of particular instrumental concepts is illustrated in terms of the s-curves typical of cell growth. Examples are given of instruments which are at the exponential, linear and mature growth stages. The prime examples used are respectively: (i) hybrid instruments designed to study reactive collisions of ions with surfaces: (ii) the Paul ion trap; and (iii) the triple quadrupole mass spectrometer. In the area of ion/surface collisions, reactive collisions such as hydrogen radical abstraction from the surface by the impinging ion are studied. They are shown to depend upon the chemical nature of the surface through the use of experiments which utilize self-assembled monolayers as surfaces. The internal energy deposited during surface-induced dissociation upon collision with different surfaces in a BEEQ instrument is also discussed. Attention is also given to a second area of emerging instrumentation, namely technology which allows mass spectrometers to be used for on-line monitoring of fluid streams. A summary of recent improvements in the performance of the rapidly developing quadrupole ion trap instrument illustrates this stage of instrument development. Improvements in resolution and mass range and their application to the characterization of biomolecules are described. The interaction of theory with experiment is illustrated through the role of simulations of ion motion in the ion trap. It is emphasized that mature instruments play a

  11. Manual of Surgical Instruments

    Directory of Open Access Journals (Sweden)

    Olga Lidia Sánchez Sarría

    2014-10-01

    Full Text Available Surgical instruments are the group of tools used in surgical procedures. They are very expensive and sophisticated. Consequently, a standardized and meticulous care is essential; they should go through the decontamination, cleaning and sterilization process. These instruments are designed in order to provide surgeons with tools that help them to perform a basic surgical procedure; there are multiple variations and the design depends on their function. This paper aims at showing all surgical instruments that can be used in an operating room during surgery and are not generally included in the medical literature.

  12. Biomedical Sensors and Instruments

    CERN Document Server

    Tagawa, Tatsuo

    2011-01-01

    The living body is a difficult object to measure: accurate measurements of physiological signals require sensors and instruments capable of high specificity and selectivity that do not interfere with the systems under study. As a result, detailed knowledge of sensor and instrument properties is required to be able to select the "best" sensor from one of the many designed to meet these challenges. From the underlying principles to practical applications, this updated edition of Biomedical Sensors and Instruments provides an easy-to-understand introduction to the various kinds of biome

  13. Economic instruments for water management

    Directory of Open Access Journals (Sweden)

    Jaime Echeverría

    2013-06-01

    Full Text Available Problems related to water management in Costa Rica have an economic origin. Partly, as a consequence of a natural condition of water richness, as well as the concept of public service with fees that don´t promote neither investment nor efficiency of water resource use. Solutions must be targeted toward the economic conditions generating pollution, little efficiency, and lesser infiltration area. Water social cost regarding its use and pollution must be recognized and paid. The water user fee and pollution fee represent a step forward. A higher application of this kind of instruments will generate profit-benefit to the economy and might encourage the protection of the environment and natural resources.

  14. Challenges in marine instrumentation

    Digital Repository Service at National Institute of Oceanography (India)

    Afzulpurkar, S.; Desa, E.; Joseph, A.; Chakraborty, B.; Nayak, M.R.; Ranade, G.

    . Acoustic and optical instrumentation combined on the same platform would be able to address these problems. For this autonomous vehicles with extremely low power requirements, long term deployment and data transmission capability via satellites after...

  15. UV and EUV Instruments

    CERN Document Server

    Werner, K

    2010-01-01

    We describe telescopes and instruments that were developed and used for astronomical research in the ultraviolet (UV) and extreme ultraviolet (EUV) regions of the electromagnetic spectrum. The wavelength ranges covered by these bands are not uniquely defined. We use the following convention here: The EUV and UV span the regions ~100-912 and 912-3000 Angstroem respectively. The limitation between both ranges is a natural choice, because the hydrogen Lyman absorption edge is located at 912 Angstroem. At smaller wavelengths, astronomical sources are strongly absorbed by the interstellar medium. It also marks a technical limit, because telescopes and instruments are of different design. In the EUV range, the technology is strongly related to that utilized in X-ray astronomy, while in the UV range the instruments in many cases have their roots in optical astronomy. We will, therefore, describe the UV and EUV instruments in appropriate conciseness and refer to the respective chapters of this volume for more technic...

  16. Fiber Optics Instrumentation Development

    Science.gov (United States)

    Chan, Patrick Hon Man; Parker, Allen R., Jr.; Richards, W. Lance

    2010-01-01

    This is a general presentation of fiber optics instrumentation development work being conducted at NASA Dryden for the past 10 years and recent achievements in the field of fiber optics strain sensors.

  17. Instrumentation for Materials Research

    Science.gov (United States)

    Claassen, Richard S.

    1976-01-01

    Discusses how sophisticated instrumentation techniques yield practical results in three typical materials problems: fracture analysis, joining, and compatibility. Describes techniques such as scanning and transmission electron microscopy, and Auger spectroscopy. (MLH)

  18. Hetdex: Virus Instrument

    Science.gov (United States)

    Lee, Hanshin; Hill, G. J.; DePoy, D. L.; Tuttle, S.; Marshall, J. L.; Vattiat, B. L.; Prochaska, T.; Chonis, T. S.; Allen, R.; HETDEX Collaboration

    2012-01-01

    The Visible Integral-field-unit Replicable Unit Spectrograph (VIRUS) instrument is made up of 150+ individually compact and identical spectrographs, each fed by a fiber integral-field unit. The instrument provides integral field spectroscopy at wavelengths between 350nm and 550nm of over 33,600 spatial elements per observation, each 1.8 sq. arcsec on the sky, at R 700. The instrument will be fed by a new wide-field corrector (WFC) of the Hobby-Eberly Telescope (HET) with increased science field of view as large as 22arcmin diameter and telescope aperture of 10m. This will enable the HETDEX, a large area blind survey of Lyman-alpha emitting galaxies at redshift z VIRUS instrument construction is summarized.

  19. VIRUS instrument collimator assembly

    Science.gov (United States)

    Marshall, Jennifer L.; DePoy, Darren L.; Prochaska, Travis; Allen, Richard D.; Williams, Patrick; Rheault, Jean-Philippe; Li, Ting; Nagasawa, Daniel Q.; Akers, Christopher; Baker, David; Boster, Emily; Campbell, Caitlin; Cook, Erika; Elder, Alison; Gary, Alex; Glover, Joseph; James, Michael; Martin, Emily; Meador, Will; Mondrik, Nicholas; Rodriguez-Patino, Marisela; Villanueva, Steven; Hill, Gary J.; Tuttle, Sarah; Vattiat, Brian; Lee, Hanshin; Chonis, Taylor S.; Dalton, Gavin B.; Tacon, Mike

    2014-07-01

    The Visual Integral-Field Replicable Unit Spectrograph (VIRUS) instrument is a baseline array 150 identical fiber fed optical spectrographs designed to support observations for the Hobby-Eberly Telescope Dark Energy Experiment (HETDEX). The collimator subassemblies of the instrument have been assembled in a production line and are now complete. Here we review the design choices and assembly practices used to produce a suite of identical low-cost spectrographs in a timely fashion using primarily unskilled labor.

  20. Modeling of Musical Instruments

    Science.gov (United States)

    Bader, Rolf; Hansen, Uwe

    Signal processing techniques in acoustics address many concerns. Included are such things as wave propagation variables, amplitude considerations, spectral content, wavelength, and phase. Phase is primarily of concern when waves interact with each other, as well as with a medium, and the imposition of boundary conditions leads to normal mode vibrations. Such conditions are prevalent in all musical instruments, and thus relevant signal processing techniques are essential to both understanding and modeling the structure of musical instruments and the sound radiated.

  1. 30万t/aPVC装置乙炔站自控仪表改造%Modifications on automatic control instruments of acetylene generating station for 30 000 t/a PVC production facility

    Institute of Scientific and Technical Information of China (English)

    张春严

    2012-01-01

    Modifications were made on the DCS power supply system, automatic control sys- tems for the nitrogen replacement of upper hopper and acetylene generator feeding, and the sodium hypochlorite preparation system in the acetylene generating station for 30 000 t/a PVC production facility. Thus, the production reliability of acetylene generating station was improved, the hidden hazards were eliminated, and the labour intensity was reduced.%对30万t/aPVC装置乙炔站的DCS供电系统、发生器上储斗充氮置换及加料自控系统、次氯酸钠配制系统进行了改造,通过改造提高了乙炔站生产的可靠性,消除了安全隐患,降低了劳动强度。

  2. Intraoral Pressure in Ethnic Wind Instruments

    CERN Document Server

    Goss, Clinton F

    2013-01-01

    High intraoral pressure generated when playing some wind instruments has been linked to a variety of health issues. Prior research has focused on Western classical instruments, but no work has been published on ethnic wind instruments. This study measured intraoral pressure when playing six classes of ethnic wind instruments (N = 149): Native American flutes (n = 71) and smaller samples of ethnic duct flutes, reed instruments, reedpipes, overtone whistles, and overtone flutes. Results are presented in the context of a survey of prior studies, providing a composite view of the intraoral pressure requirements of a broad range of wind instruments. Mean intraoral pressure was 8.37 mBar across all ethnic wind instruments and 5.21 +/- 2.16 mBar for Native American flutes. The range of pressure in Native American flutes closely matches pressure reported in other studies for normal speech, and the maximum intraoral pressure, 20.55 mBar, is below the highest subglottal pressure reported in other studies during singing...

  3. Robust Instrumentation[Water treatment for power plant]; Robust Instrumentering

    Energy Technology Data Exchange (ETDEWEB)

    Wik, Anders [Vattenfall Utveckling AB, Stockholm (Sweden)

    2003-08-01

    Cementa Slite Power Station is a heat recovery steam generator (HRSG) with moderate steam data; 3.0 MPa and 420 deg C. The heat is recovered from Cementa, a cement industry, without any usage of auxiliary fuel. The Power station commenced operation in 2001. The layout of the plant is unusual, there are no similar in Sweden and very few world-wide, so the operational experiences are limited. In connection with the commissioning of the power plant a R and D project was identified with the objective to minimise the manpower needed for chemistry management of the plant. The lean chemistry management is based on robust instrumentation and chemical-free water treatment plant. The concept with robust instrumentation consists of the following components; choice of on-line instrumentation with a minimum of O and M and a chemical-free water treatment. The parameters are specific conductivity, cation conductivity, oxygen and pH. In addition to that, two fairly new on-line instruments were included; corrosion monitors and differential pH calculated from specific and cation conductivity. The chemical-free water treatment plant consists of softening, reverse osmosis and electro-deionisation. The operational experience shows that the cycle chemistry is not within the guidelines due to major problems with the operation of the power plant. These problems have made it impossible to reach steady state and thereby not viable to fully verify and validate the concept with robust instrumentation. From readings on the panel of the online analysers some conclusions may be drawn, e.g. the differential pH measurements have fulfilled the expectations. The other on-line analysers have been working satisfactorily apart from contamination with turbine oil, which has been noticed at least twice. The corrosion monitors seem to be working but the lack of trend curves from the mainframe computer system makes it hard to draw any clear conclusions. The chemical-free water treatment has met all

  4. The keyboard instruments.

    Science.gov (United States)

    Manchester, Ralph A

    2014-06-01

    Now that the field of performing arts medicine has been in existence for over three decades, we are approaching a key point: we should start to see more articles that bring together the data that have been collected from several studies in order to draw more robust conclusions. Review articles and their more structured relative, the meta-analysis, can help to improve our understanding of a particular topic, comparing and synthesizing the results of previous research that has been done on that subject area. One way this could be done would be to review the research that has been carried out on the performance-related problems associated with playing a particular instrument or group of instruments. While I am not going to do that myself, I hope that others will. In this editorial, I will do a very selective review of the playing-related musculoskeletal disorders (PRMDs) associated with one instrument group (the keyboard instruments), focusing on the most played instrument in that group (the piano;).

  5. Sample Analysis at Mars Instrument Simulator

    Science.gov (United States)

    Benna, Mehdi; Nolan, Tom

    2013-01-01

    , and thus validates, complex command scripts prior to their up-linking to the SAM instrument. As an output, this module generates synthetic data and message logs at a rate that is similar to the actual instrument.

  6. Biochemistry Instrumentation Core Technology Center

    Data.gov (United States)

    Federal Laboratory Consortium — The UCLA-DOE Biochemistry Instrumentation Core Facility provides the UCLA biochemistry community with easy access to sophisticated instrumentation for a wide variety...

  7. Heat Flux Instrumentation Laboratory (HFIL)

    Data.gov (United States)

    Federal Laboratory Consortium — Description: The Heat Flux Instrumentation Laboratory is used to develop advanced, flexible, thin film gauge instrumentation for the Air Force Research Laboratory....

  8. Aethalometer™ Instrument Handbook

    Energy Technology Data Exchange (ETDEWEB)

    Sedlacek, Arthur J [Brookhaven National Lab. (BNL), Upton, NY (United States)

    2016-04-01

    The Aethalometer is an instrument that provides a real-time readout of the concentration of “Black” or “Elemental” carbon aerosol particles (BC or E) in an air stream (see Figure 1 and Figure 2). It is a self-contained instrument that measures the rate of change of optical transmission through a spot on a filter where aerosol is being continuously collected and uses the information to calculate the concentration of optically absorbing material in the sampled air stream. The instrument measures the transmitted light intensities through the “sensing” portion of the filter, on which the aerosol spot is being collected, and a “reference” portion of the filter as a check on the stability of the optical source. A mass flowmeter monitors the sample air flow rate. The data from these three measurements is used to determine the mean BC content of the air stream.

  9. 3D Spectroscopic Instrumentation

    CERN Document Server

    Bershady, Matthew A

    2009-01-01

    In this Chapter we review the challenges of, and opportunities for, 3D spectroscopy, and how these have lead to new and different approaches to sampling astronomical information. We describe and categorize existing instruments on 4m and 10m telescopes. Our primary focus is on grating-dispersed spectrographs. We discuss how to optimize dispersive elements, such as VPH gratings, to achieve adequate spectral resolution, high throughput, and efficient data packing to maximize spatial sampling for 3D spectroscopy. We review and compare the various coupling methods that make these spectrographs ``3D,'' including fibers, lenslets, slicers, and filtered multi-slits. We also describe Fabry-Perot and spatial-heterodyne interferometers, pointing out their advantages as field-widened systems relative to conventional, grating-dispersed spectrographs. We explore the parameter space all these instruments sample, highlighting regimes open for exploitation. Present instruments provide a foil for future development. We give an...

  10. Micro mushroom instrumentation system

    Science.gov (United States)

    Davidson, W. F.

    1986-01-01

    An electronics circuit which provides for the recording of instrumentation data on an optical disk is disclosed. The optical disk is formatted in a spiral format instead of concentric tracks. The spiral format allows data to be recorded without the gaps that would be associated with concentric tracks. The instrumentation system provides each channel with a program instrumentation amplifier, a six pole lowpass switched capacitor filter, a sample and hold amplifier, and a digital to analog converter to provide automatic offset capability. Since each channel has its own components, simultaneous samples of every channel can be captured. All of the input signal's channel variables can be captured. All of the input signal's channel variables can be changed under software control without hardware changes. A single board computer is used for a system controller.

  11. ISSUERS OF FINANCIAL INSTRUMENTS

    Directory of Open Access Journals (Sweden)

    Cristian GHEORGHE

    2016-05-01

    Full Text Available The rules laid down by Romanian Capital Market Law and the regulations put in force for its implementation apply to issuers of financial instruments admitted to trading on the regulated market established in Romania. But the issuers remain companies incorporated under Company Law of 1990. Such dual regulations need increased attention in order to observe the legal status of the issuers/companies and financial instruments/shares. Romanian legislator has chosen to implement in Capital Market Law special rules regarding the administration of the issuers of financial instruments, not only rules regarding admitting and maintaining to a regulated market. Thus issuers are, in Romanian Law perspective, special company that should comply special rule regarding board of administration and general shareholders meeting.

  12. Calibration of Geodetic Instruments

    Directory of Open Access Journals (Sweden)

    Marek Bajtala

    2005-06-01

    Full Text Available The problem of metrology and security systems of unification, correctness and standard reproducibilities belong to the preferred requirements of theory and technical practice in geodesy. Requirements on the control and verification of measured instruments and equipments increase and the importance and up-to-date of calibration get into the foreground. Calibration possibilities of length-scales (of electronic rangefinders and angle-scales (of horizontal circles of geodetic instruments. Calibration of electronic rangefinders on the linear comparative baseline in terrain. Primary standard of planar angle – optical traverse and its exploitation for calibration of the horizontal circles of theodolites. The calibration equipment of the Institute of Slovak Metrology in Bratislava. The Calibration process and results from the calibration of horizontal circles of selected geodetic instruments.

  13. Virtual Sensor Test Instrumentation

    Science.gov (United States)

    Wang, Roy

    2011-01-01

    Virtual Sensor Test Instrumentation is based on the concept of smart sensor technology for testing with intelligence needed to perform sell-diagnosis of health, and to participate in a hierarchy of health determination at sensor, process, and system levels. A virtual sensor test instrumentation consists of five elements: (1) a common sensor interface, (2) microprocessor, (3) wireless interface, (4) signal conditioning and ADC/DAC (analog-to-digital conversion/ digital-to-analog conversion), and (5) onboard EEPROM (electrically erasable programmable read-only memory) for metadata storage and executable software to create powerful, scalable, reconfigurable, and reliable embedded and distributed test instruments. In order to maximize the efficient data conversion through the smart sensor node, plug-and-play functionality is required to interface with traditional sensors to enhance their identity and capabilities for data processing and communications. Virtual sensor test instrumentation can be accessible wirelessly via a Network Capable Application Processor (NCAP) or a Smart Transducer Interlace Module (STIM) that may be managed under real-time rule engines for mission-critical applications. The transducer senses the physical quantity being measured and converts it into an electrical signal. The signal is fed to an A/D converter, and is ready for use by the processor to execute functional transformation based on the sensor characteristics stored in a Transducer Electronic Data Sheet (TEDS). Virtual sensor test instrumentation is built upon an open-system architecture with standardized protocol modules/stacks to interface with industry standards and commonly used software. One major benefit for deploying the virtual sensor test instrumentation is the ability, through a plug-and-play common interface, to convert raw sensor data in either analog or digital form, to an IEEE 1451 standard-based smart sensor, which has instructions to program sensors for a wide variety of

  14. Detecting extended gamma-ray emission with the next generation Cherenkov telescopes

    CERN Document Server

    Alonso, M Fernandez; Rovero, A C

    2015-01-01

    Very high energy (VHE $>$100 GeV) gamma rays coming from blazars can produce pairs when interacting with the Extragalactic Background Light (EBL) and the Cosmic Microwave Background, generating an electromagnetic cascade. Depending on the Intergalactic Magnetic Field (IGMF) intensity, this cascade may result in an extended isotropic emission of photons around the source (halo), or in a broadening of the emission beam. The detection of these effects might lead to important constrains both on the IGMF intensity and the EBL density, quantities of great relevance in cosmological models. Using a Monte Carlo program, we simulate electromagnetic cascades for different values of the IGMF intensities and coming from a source similar to 1ES0229+200, a blazar with hard intrinsic spectrum at redshift $z=0.14$, which is an ideal distance for potentially observing the effect. We study the possible response of a generic future Cherenkov telescope using a simplified model for the sensitivity, effective area and angular resol...

  15. Standard NIM instrumentation system

    CERN Document Server

    1990-01-01

    NIM is a standard modular instrumentation system that is in wide use throughout the world. As the NIM system developed and accommodations were made to a dynamic instrumentation field and a rapidly advancing technology, additions, revisions and clarifications were made. These were incorporated into the standard in the form of addenda and errata. This standard is a revision of the NIM document, AEC Report TID- 20893 (Rev 4) dated July 1974. It includes all the addenda and errata items that were previously issued as well as numerous additional items to make the standard current with modern technology and manufacturing practice.

  16. Animation of MARDI Instrument

    Science.gov (United States)

    2008-01-01

    [figure removed for brevity, see original site] Click on image to view the animation This animation shows a zoom into the Mars Descent Imager (MARDI) instrument onboard NASA's Phoenix Mars Lander. The Phoenix team will soon attempt to use a microphone on the MARDI instrument to capture sounds of Mars. The Phoenix Mission is led by the University of Arizona, Tucson, on behalf of NASA. Project management of the mission is by NASA's Jet Propulsion Laboratory, Pasadena, Calif. Spacecraft development is by Lockheed Martin Space Systems, Denver.

  17. Virtual Reality Musical Instruments

    DEFF Research Database (Denmark)

    Serafin, Stefania; Erkut, Cumhur; Kojs, Juraj

    2016-01-01

    The rapid development and availability of low-cost technologies have created a wide interest in virtual reality. In the field of computer music, the term “virtual musical instruments” has been used for a long time to describe software simulations, extensions of existing musical instruments......, and ways to control them with new interfaces for musical expression. Virtual reality musical instruments (VRMIs) that include a simulated visual component delivered via a head-mounted display or other forms of immersive visualization have not yet received much attention. In this article, we present a field...

  18. Spectroelectrochemical Instrument Measures TOC

    Science.gov (United States)

    Kounaves, Sam

    2011-01-01

    A spectroelectrochemical instrument has been developed for measuring the total organic carbon (TOC) content of an aqueous solution. Measurements of TOC are frequently performed in environmental, clinical, and industrial settings. Until now, techniques for performing such measurements have included, various ly, the use of hazardous reagents, ultraviolet light, or ovens, to promote reactions in which the carbon contents are oxidized. The instrument now being developed is intended to be a safer, more economical means of oxidizing organic carbon and determining the TOC levels of aqueous solutions and for providing a low power/mass unit for use in planetary missions.

  19. [Hardening of dental instruments].

    Science.gov (United States)

    Gerasev, G P

    1981-01-01

    The possibility of prolonging the service life of stomatological instruments by the local hardening of their working parts is discussed. Such hardening should be achieved by using hard and wear-resistant materials. The examples of hardening dental elevators and hard-alloy dental drills are given. New trends in the local hardening of instruments are the treatment of their working parts with laser beams, the application of coating on their surface by the gas-detonation method. The results of research work and trials are presented.

  20. Celadon Figurines Play Instruments

    Institute of Scientific and Technical Information of China (English)

    1995-01-01

    This group of figurines, each 0.15m tall, were unearthed from a Tang Dynasty tomb in Changsha in 1977. Music was very developed in the Tang Dynasty. Colorful musical instruments and dances were popular both among the people and in the palace. These vivid-looking figurines wear pleated skirts with small sleeves and open chest, a style influenced by the non-Han nationalities living in the north and west of China. Some of the musical instruments were brought from the Western Regions. The figurines are playing the xiao (a vertical bamboo flute), the konghou (an

  1. Virtual Reality Musical Instruments

    DEFF Research Database (Denmark)

    Serafin, Stefania; Erkut, Cumhur; Kojs, Juraj

    2016-01-01

    The rapid development and availability of low-cost technologies have created a wide interest in virtual reality. In the field of computer music, the term “virtual musical instruments” has been used for a long time to describe software simulations, extensions of existing musical instruments......, and ways to control them with new interfaces for musical expression. Virtual reality musical instruments (VRMIs) that include a simulated visual component delivered via a head-mounted display or other forms of immersive visualization have not yet received much attention. In this article, we present a field...

  2. Programmable pulse generator

    CERN Document Server

    Xue Zhi Hua; Duan Xiao Hui

    2002-01-01

    The author introduces the design of programmable pulse generator that is based on a micro-controller and controlled by RS232 interface of personal computer. The whole system has good stability. The pulse generator can produce TTL pulse and analog pulse. The pulse frequency can be selected by EPLD. The voltage amplitude and pulse width of analog pulse can be adjusted by analog switches and digitally-controlled potentiometers. The software development tools of computer is National Instruments LabView5.1. The front panel of this virtual instrumentation is intuitive and easy-to-use. Parameters can be selected and changed conveniently by knob and slide

  3. Economic Policy Instruments

    DEFF Research Database (Denmark)

    Klemmensen, Børge

    2007-01-01

    Økonomiske instrumenter begrundes med behovet for politiske indgreb, der muliggør internaliseringen af omkostningerne ved de miljøpåvirkninger, produktion and levevis afstedkommer, således at hensyntagen til miljøet bliver en del af virksomheders og husholdningers omkostninger og dermed en tilsky...

  4. The ozone monitoring instrument

    NARCIS (Netherlands)

    Levelt, P.F.; Oord, G.H.J. van den; Dobber, M.R.; Mälkki, A.; Visser, H.; Vries, J. de; Stammes, P.; Lundell, J.O.V.; Saari, H.

    2006-01-01

    The Ozone Monitoring Instrument (OMI) flies on the National Aeronautics and Space Adminsitration's Earth Observing System Aura satellite launched in July 2004. OMI is a ultraviolet/visible (UV/VIS) nadir solar backscatter spectrometer, which provides nearly global coverage in one day with a spatial

  5. Creating a Super Instrument

    DEFF Research Database (Denmark)

    Kallionpää, Maria; Gasselseder, Hans-Peter

    2015-01-01

    Thanks to the development of new technology, musical instruments are no more tied to their existing acoustic or technical limitations as almost all parameters can be augmented or modified in real time. An increasing number of composers, performers, and computer programmers have thus become intere...

  6. Neutron instrumentation for biology

    Energy Technology Data Exchange (ETDEWEB)

    Mason, S.A. [Institut Laue-Langevin, Grenoble (France)

    1994-12-31

    In the October 1994 round of proposals at the ILL, the external biology review sub- committee was asked to allocate neutron beam time to a wide range of experiments, on almost half the total number of scheduled neutron instruments: on 3 diffractometers, on 3 small angle scattering instruments, and on some 6 inelastic scattering spectrometers. In the 3.5 years since the temporary reactor shutdown, the ILL`s management structure has been optimized, budgets and staff have been trimmed, the ILL reactor has been re-built, and many of the instruments up-graded, many powerful (mainly Unix) workstations have been introduced, and the neighboring European Synchrotron Radiation Facility has established itself as the leading synchrotron radiation source and has started its official user program. The ILL reactor remains the world`s most intense dedicated neutron source. In this challenging context, it is of interest to review briefly the park of ILL instruments used to study the structure and energetics of small and large biological systems. A brief summary will be made of each class of experiments actually proposed in the latest ILL proposal round.

  7. Advanced instrumentation and teleoperation

    Energy Technology Data Exchange (ETDEWEB)

    Decreton, M

    1998-07-01

    SCK-CEN's advanced instrumentation and teleoperation project aims at evaluating the potential of a telerobotic approach in a nuclear environment and, in particular, the use of remote-perception systems. Main achievements in 1997 in the areas of R and D on radiation tolerance for remote sensing, optical fibres and optical-fibre sensors, and computer-aided teleoperation are reported.

  8. Economic Policy Instruments

    DEFF Research Database (Denmark)

    Klemmensen, Børge

    2007-01-01

    Økonomiske instrumenter begrundes med behovet for politiske indgreb, der muliggør internaliseringen af omkostningerne ved de miljøpåvirkninger, produktion and levevis afstedkommer, således at hensyntagen til miljøet bliver en del af virksomheders og husholdningers omkostninger og dermed en...

  9. Instrument for assaying radiation

    Energy Technology Data Exchange (ETDEWEB)

    Coleman, Jody Rustyn; Farfan, Eduardo B.

    2016-03-22

    An instrument for assaying radiation includes a flat panel detector having a first side opposed to a second side. A collimated aperture covers at least a portion of the first side of the flat panel detector. At least one of a display screen or a radiation shield may cover at least a portion of the second side of the flat panel detector.

  10. Integrating Nephelometer Instrument Handbook

    Energy Technology Data Exchange (ETDEWEB)

    Uin, J. [Brookhaven National Lab. (BNL), Upton, NY (United States)

    2016-03-01

    The Integrating Nephelometer (Figure 1) is an instrument that measures aerosol light scattering. It measures aerosol optical scattering properties by detecting (with a wide angular integration – from 7 to 170°) the light scattered by the aerosol and subtracting the light scattered by the carrier gas, the instrument walls and the background noise in the detector (zeroing). Zeroing is typically performed for 5 minutes every day at midnight UTC. The scattered light is split into red (700 nm), green (550 nm), and blue (450 nm) wavelengths and captured by three photomultiplier tubes. The instrument can measure total scatter as well as backscatter only (from 90 to 170°) (Heintzenberg and Charlson 1996; Anderson et al. 1996; Anderson and Ogren 1998; TSI 3563 2015) At ARM (Atmospheric Radiation Measurement), two identical Nephelometers are usually run in series with a sample relative humidity (RH) conditioner between them. This is possible because Nephelometer sampling is non-destructive and the sample can be passed on to another instrument. The sample RH conditioner scans through multiple RH values in cycles, treating the sample. This kind of setup allows to study how aerosol particles’ light scattering properties are affected by humidification (Anderson et al. 1996). For historical reasons, the two Nephelometers in this setup are labeled “wet” and “dry”, with the “dry” Nephelometer usually being the one before the conditioner and sampling ambient air (the names are switched for the MAOS measurement site due to the high RH of the ambient air).

  11. Instruments of Transformative Governance

    DEFF Research Database (Denmark)

    Borrás, Susana

    production and distribution channels. PDPs aim at overcoming current market and government failures by pooling resources in the attempt to solve this global social challenge. Thus, PDPs are a case of instruments of transformative research and innovation, operating in a transnational governance context...

  12. The tropospheric monitoring instrument

    NARCIS (Netherlands)

    Voert, M.J. te; Brakel, R. van; Witvoet, G.

    2014-01-01

    Thermal and opto-mechanical design and analysis work has been done on the Tropospheric Monitoring Instrument (TROPOMI), a spectrometer on the Copernicus Sentinel 5 Precursor satellite. To verify compliance with the stringent opto-mechanical stability requirements, detailed thermal and thermo-mechani

  13. Virtual reality musical instruments

    DEFF Research Database (Denmark)

    Serafin, Stefania; Erkut, Cumhur; Kojs, Juraj

    2016-01-01

    The rapid development and availability of low cost technologies has created a wide interest in virtual reality (VR), but how to design and evaluate multisensory interactions in VR remains as a challenge. In this paper, we focus on virtual reality musical instruments, present an overview of our...

  14. The ozone monitoring instrument

    NARCIS (Netherlands)

    Levelt, P.F.; Oord, G.H.J. van den; Dobber, M.R.; Mälkki, A.; Visser, H.; Vries, J. de; Stammes, P.; Lundell, J.O.V.; Saari, H.

    2006-01-01

    The Ozone Monitoring Instrument (OMI) flies on the National Aeronautics and Space Adminsitration's Earth Observing System Aura satellite launched in July 2004. OMI is a ultraviolet/visible (UV/VIS) nadir solar backscatter spectrometer, which provides nearly global coverage in one day with a spatial

  15. Payment Instrument Characteristics

    DEFF Research Database (Denmark)

    Holst, Jacques; Kjeldsen, Martin; Hedman, Jonas

    2015-01-01

    payment innovations. Using the Repertory Grid technique to explore 15 payers’ perception of six payment instruments, including coins, banknotes, debit cards, credit cards, mobile payments, and on-line banking, we identify 16 payment characteristics. The characteristics aggregate seventy-six unique...

  16. Specification for Instrumentation

    DEFF Research Database (Denmark)

    Margheritini, Lucia; Kofoed, Jens Peter

    This paper is intended to give an overview on instrumentation for monitoring the efficiency of the Converter and the performance of the device. Real-time control of plant and data monitoring and storage are the main objectives of the control system....

  17. Human factors aspects of advanced instrumentation in the nuclear industry

    Energy Technology Data Exchange (ETDEWEB)

    Carter, R.J.

    1989-01-01

    An important consideration in regards to the use of advanced instrumentation in the nuclear industry is the interface between the instrumentation system and the human. A survey, oriented towards identifying the human factors aspects of digital instrumentation, was conducted at a number of United States (US) and Canadian nuclear vendors and utilities. Human factors issues, subsumed under the categories of computer-generated displays, controls, organizational support, training, and related topics were identified. 20 refs., 2 tabs.

  18. Instrumenting the Intelligence Analysis Process

    Energy Technology Data Exchange (ETDEWEB)

    Hampson, Ernest; Cowley, Paula J.

    2005-05-02

    The Advanced Research and Development Activity initiated the Novel Intelligence from Massive Data (NIMD) program to develop advanced analytic technologies and methodologies. In order to support this objective, researchers and developers need to understand what analysts do and how they do it. In the past, this knowledge generally was acquired through subjective feedback from analysts. NIMD established the innovative Glass Box Analysis (GBA) Project to instrument a live intelligence mission and unobtrusively capture and objectively study the analysis process. Instrumenting the analysis process requires tailor-made software hooks that grab data from a myriad of disparate application operations and feed into a complex relational database and hierarchical file store to collect, store, retrieve, and distribute analytic data in a manner that maximizes researchers’ understanding. A key to success is determining the correct data to collect and aggregate low-level data into meaningful analytic events. This paper will examine how the GBA team solved some of these challenges, continues to address others, and supports a growing user community in establishing their own GBA environments and/or studying the data generated by GBA analysts working in the Glass Box.

  19. The Science of String Instruments

    CERN Document Server

    Rossing, Thomas D

    2010-01-01

    Many performing musicians, as well as instrument builders, are coming to realize the importance of understanding the science of musical instruments. This book explains how string instruments produce sound. It presents basic ideas in simple language, and it also translates some more sophisticated ideas in non-technical language. It should be of interest to performers, researchers, and instrument makers alike.

  20. AWARE: mobile context instrumentation framework

    Directory of Open Access Journals (Sweden)

    Denzil eFerreira

    2015-04-01

    Full Text Available We present a mobile instrumentation toolkit, AWARE, an open-source effort to develop an extensible and reusable platform for capturing, inferring, and generating context on mobile devices. Mobile phones are sensor-rich but resource-constrained, and therefore several considerations need to be addressed when creating a research tool that ensures problem-free context collection. We demonstrate how AWARE can mitigate researchers’ effort when building mobile data-logging tools and context-aware applications, with minimal battery impact. By encapsulating implementation details of sensor data retrieval and exposing the sensed context as higher-level abstractions, AWARE shifts the focus from software development to data analysis, both quantitative and qualitative. We have evaluated AWARE in several case studies and discuss its use, power consumption, and scalability.

  1. The 2010 Very High Energy γ-Ray Flare and 10 Years of Multi-wavelength Observations of M 87

    Science.gov (United States)

    Abramowski, A.; Acero, F.; Aharonian, F.; Akhperjanian, A. G.; Anton, G.; Balzer, A.; Barnacka, A.; Barres de Almeida, U.; Becherini, Y.; Becker, J.; Behera, B.; Bernlöhr, K.; Birsin, E.; Biteau, J.; Bochow, A.; Boisson, C.; Bolmont, J.; Bordas, P.; Brucker, J.; Brun, F.; Brun, P.; Bulik, T.; Büsching, I.; Carrigan, S.; Casanova, S.; Cerruti, M.; Chadwick, P. M.; Charbonnier, A.; Chaves, R. C. G.; Cheesebrough, A.; Clapson, A. C.; Coignet, G.; Cologna, G.; Conrad, J.; Dalton, M.; Daniel, M. K.; Davids, I. D.; Degrange, B.; Deil, C.; Dickinson, H. J.; Djannati-Ataï, A.; Domainko, W.; Drury, L. O'C.; Dubus, G.; Dutson, K.; Dyks, J.; Dyrda, M.; Egberts, K.; Eger, P.; Espigat, P.; Fallon, L.; Farnier, C.; Fegan, S.; Feinstein, F.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Förster, A.; Füßling, M.; Gallant, Y. A.; Gast, H.; Gérard, L.; Gerbig, D.; Giebels, B.; Glicenstein, J. F.; Glück, B.; Goret, P.; Göring, D.; Häffner, S.; Hague, J. D.; Hampf, D.; Hauser, M.; Heinz, S.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hoffmann, A.; Hofmann, W.; Hofverberg, P.; Holler, M.; Horns, D.; Jacholkowska, A.; de Jager, O. C.; Jahn, C.; Jamrozy, M.; Jung, I.; Kastendieck, M. A.; Katarzyński, K.; Katz, U.; Kaufmann, S.; Keogh, D.; Khangulyan, D.; Khélifi, B.; Klochkov, D.; Kluźniak, W.; Kneiske, T.; Komin, Nu.; Kosack, K.; Kossakowski, R.; Laffon, H.; Lamanna, G.; Lennarz, D.; Lohse, T.; Lopatin, A.; Lu, C.-C.; Marandon, V.; Marcowith, A.; Masbou, J.; Maurin, D.; Maxted, N.; Mayer, M.; McComb, T. J. L.; Medina, M. C.; Méhault, J.; Moderski, R.; Moulin, E.; Naumann, C. L.; Naumann-Godo, M.; de Naurois, M.; Nedbal, D.; Nekrassov, D.; Nguyen, N.; Nicholas, B.; Niemiec, J.; Nolan, S. J.; Ohm, S.; de Oña Wilhelmi, E.; Opitz, B.; Ostrowski, M.; Oya, I.; Panter, M.; Paz Arribas, M.; Pedaletti, G.; Pelletier, G.; Petrucci, P.-O.; Pita, S.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raue, M.; Rayner, S. M.; Reimer, A.; Reimer, O.; Renaud, M.; de los Reyes, R.; Rieger, F.; Ripken, J.; Rob, L.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Ruppel, J.; Sahakian, V.; Sanchez, D. A.; Santangelo, A.; Schlickeiser, R.; Schöck, F. M.; Schulz, A.; Schwanke, U.; Schwarzburg, S.; Schwemmer, S.; Sheidaei, F.; Skilton, J. L.; Sol, H.; Spengler, G.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Stycz, K.; Sushch, I.; Szostek, A.; Tavernet, J.-P.; Terrier, R.; Tluczykont, M.; Valerius, K.; van Eldik, C.; Vasileiadis, G.; Venter, C.; Vialle, J. P.; Viana, A.; Vincent, P.; Völk, H. J.; Volpe, F.; Vorobiov, S.; Vorster, M.; Wagner, S. J.; Ward, M.; White, R.; Wierzcholska, A.; Zacharias, M.; Zajczyk, A.; Zdziarski, A. A.; Zech, A.; Zechlin, H.-S.; H.E.S.S. Collaboration; Aleksić, J.; Antonelli, L. A.; Antoranz, P.; Backes, M.; Barrio, J. A.; Bastieri, D.; Becerra González, J.; Bednarek, W.; Berdyugin, A.; Berger, K.; Bernardini, E.; Biland, A.; Blanch, O.; Bock, R. K.; Boller, A.; Bonnoli, G.; Borla Tridon, D.; Braun, I.; Bretz, T.; Cañellas, A.; Carmona, E.; Carosi, A.; Colin, P.; Colombo, E.; Contreras, J. L.; Cortina, J.; Cossio, L.; Covino, S.; Dazzi, F.; De Angelis, A.; De Cea del Pozo, E.; De Lotto, B.; Delgado Mendez, C.; Diago Ortega, A.; Doert, M.; Domínguez, A.; Dominis Prester, D.; Dorner, D.; Doro, M.; Elsaesser, D.; Ferenc, D.; Fonseca, M. V.; Font, L.; Fruck, C.; García López, R. J.; Garczarczyk, M.; Garrido, D.; Giavitto, G.; Godinović, N.; Hadasch, D.; Häfner, D.; Herrero, A.; Hildebrand, D.; Höhne-Mönch, D.; Hose, J.; Hrupec, D.; Huber, B.; Jogler, T.; Klepser, S.; Krähenbühl, T.; Krause, J.; La Barbera, A.; Lelas, D.; Leonardo, E.; Lindfors, E.; Lombardi, S.; López, M.; Lorenz, E.; Makariev, M.; Maneva, G.; Mankuzhiyil, N.; Mannheim, K.; Maraschi, L.; Mariotti, M.; Martínez, M.; Mazin, D.; Meucci, M.; Miranda, J. M.; Mirzoyan, R.; Miyamoto, H.; Moldón, J.; Moralejo, A.; Munar, P.; Nieto, D.; Nilsson, K.; Orito, R.; Oya, I.; Paneque, D.; Paoletti, R.; Pardo, S.; Paredes, J. M.; Partini, S.; Pasanen, M.; Pauss, F.; Perez-Torres, M. A.; Persic, M.; Peruzzo, L.; Pilia, M.; Pochon, J.; Prada, F.; Prada Moroni, P. G.; Prandini, E.; Puljak, I.; Reichardt, I.; Reinthal, R.; Rhode, W.; Ribó, M.; Rico, J.; Rügamer, S.; Saggion, A.; Saito, K.; Saito, T. Y.; Salvati, M.; Satalecka, K.; Scalzotto, V.; Scapin, V.; Schultz, C.; Schweizer, T.; Shayduk, M.; Shore, S. N.; Sillanpää, A.; Sitarek, J.; Sobczynska, D.; Spanier, F.; Spiro, S.; Stamerra, A.; Steinke, B.; Storz, J.; Strah, N.; Surić, T.; Takalo, L.; Takami, H.; Tavecchio, F.; Temnikov, P.; Terzić, T.; Tescaro, D.; Teshima, M.; Thom, M.; Tibolla, O.; Torres, D. F.; Treves, A.; Vankov, H.; Vogler, P.; Wagner, R. M.; Weitzel, Q.; Zabalza, V.; Zandanel, F.; Zanin, R.; MAGIC Collaboration; Arlen, T.; Aune, T.; Beilicke, M.; Benbow, W.; Bouvier, A.; Bradbury, S. M.; Buckley, J. H.; Bugaev, V.; Byrum, K.; Cannon, A.; Cesarini, A.; Ciupik, L.; Connolly, M. P.; Cui, W.; Dickherber, R.; Duke, C.; Errando, M.; Falcone, A.; Finley, J. P.; Finnegan, G.; Fortson, L.; Furniss, A.; Galante, N.; Gall, D.; Godambe, S.; Griffin, S.; Grube, J.; Gyuk, G.; Hanna, D.; Holder, J.; Huan, H.; Hui, C. M.; Kaaret, P.; Karlsson, N.; Kertzman, M.; Khassen, Y.; Kieda, D.; Krawczynski, H.; Krennrich, F.; Lang, M. J.; LeBohec, S.; Maier, G.; McArthur, S.; McCann, A.; Moriarty, P.; Mukherjee, R.; Nuñez, P. D.; Ong, R. A.; Orr, M.; Otte, A. N.; Park, N.; Perkins, J. S.; Pichel, A.; Pohl, M.; Prokoph, H.; Ragan, K.; Reyes, L. C.; Reynolds, P. T.; Roache, E.; Rose, H. J.; Ruppel, J.; Schroedter, M.; Sembroski, G. H.; Şentürk, G. D.; Telezhinsky, I.; Tešić, G.; Theiling, M.; Thibadeau, S.; Varlotta, A.; Vassiliev, V. V.; Vivier, M.; Wakely, S. P.; Weekes, T. C.; Williams, D. A.; Zitzer, B.; VERITAS Collaboration; Barres de Almeida, U.; Cara, M.; Casadio, C.; Cheung, C. C.; McConville, W.; Davies, F.; Doi, A.; Giovannini, G.; Giroletti, M.; Hada, K.; Hardee, P.; Harris, D. E.; Junor, W.; Kino, M.; Lee, N. P.; Ly, C.; Madrid, J.; Massaro, F.; Mundell, C. G.; Nagai, H.; Perlman, E. S.; Steele, I. A.; Walker, R. C.; Wood, D. L.

    2012-02-01

    The giant radio galaxy M 87 with its proximity (16 Mpc), famous jet, and very massive black hole ((3 - 6) × 109 M ⊙) provides a unique opportunity to investigate the origin of very high energy (VHE; E > 100 GeV) γ-ray emission generated in relativistic outflows and the surroundings of supermassive black holes. M 87 has been established as a VHE γ-ray emitter since 2006. The VHE γ-ray emission displays strong variability on timescales as short as a day. In this paper, results from a joint VHE monitoring campaign on M 87 by the MAGIC and VERITAS instruments in 2010 are reported. During the campaign, a flare at VHE was detected triggering further observations at VHE (H.E.S.S.), X-rays (Chandra), and radio (43 GHz Very Long Baseline Array, VLBA). The excellent sampling of the VHE γ-ray light curve enables one to derive a precise temporal characterization of the flare: the single, isolated flare is well described by a two-sided exponential function with significantly different flux rise and decay times of τrise d = (1.69 ± 0.30) days and τdecay d = (0.611 ± 0.080) days, respectively. While the overall variability pattern of the 2010 flare appears somewhat different from that of previous VHE flares in 2005 and 2008, they share very similar timescales (~day), peak fluxes (Φ>0.35 TeV ~= (1-3) × 10-11 photons cm-2 s-1), and VHE spectra. VLBA radio observations of 43 GHz of the inner jet regions indicate no enhanced flux in 2010 in contrast to observations in 2008, where an increase of the radio flux of the innermost core regions coincided with a VHE flare. On the other hand, Chandra X-ray observations taken ~3 days after the peak of the VHE γ-ray emission reveal an enhanced flux from the core (flux increased by factor ~2; variability timescale <2 days). The long-term (2001-2010) multi-wavelength (MWL) light curve of M 87, spanning from radio to VHE and including data from Hubble Space Telescope, Liverpool Telescope, Very Large Array, and European VLBI Network

  2. UC Merced NMR Instrumentation Acquisition

    Science.gov (United States)

    2015-06-18

    UC Merced NMR Instrumentation Acquisition For the UC Merced NMR Instrumentation Acquisition proposal, a new 400 MHz and an upgraded 500 MHz NMR ...UC Merced NMR Instrumentation Acquisition Report Title For the UC Merced NMR Instrumentation Acquisition proposal, a new 400 MHz and an upgraded 500...MHz NMR have been delivered, installed, and incorporated into research and two lab courses. While no results from these instruments have been

  3. netherland hydrological modeling instrument

    Science.gov (United States)

    Hoogewoud, J. C.; de Lange, W. J.; Veldhuizen, A.; Prinsen, G.

    2012-04-01

    Netherlands Hydrological Modeling Instrument A decision support system for water basin management. J.C. Hoogewoud , W.J. de Lange ,A. Veldhuizen , G. Prinsen , The Netherlands Hydrological modeling Instrument (NHI) is the center point of a framework of models, to coherently model the hydrological system and the multitude of functions it supports. Dutch hydrological institutes Deltares, Alterra, Netherlands Environmental Assessment Agency, RWS Waterdienst, STOWA and Vewin are cooperating in enhancing the NHI for adequate decision support. The instrument is used by three different ministries involved in national water policy matters, for instance the WFD, drought management, manure policy and climate change issues. The basis of the modeling instrument is a state-of-the-art on-line coupling of the groundwater system (MODFLOW), the unsaturated zone (metaSWAP) and the surface water system (MOZART-DM). It brings together hydro(geo)logical processes from the column to the basin scale, ranging from 250x250m plots to the river Rhine and includes salt water flow. The NHI is validated with an eight year run (1998-2006) with dry and wet periods. For this run different parts of the hydrology have been compared with measurements. For instance, water demands in dry periods (e.g. for irrigation), discharges at outlets, groundwater levels and evaporation. A validation alone is not enough to get support from stakeholders. Involvement from stakeholders in the modeling process is needed. There fore to gain sufficient support and trust in the instrument on different (policy) levels a couple of actions have been taken: 1. a transparent evaluation of modeling-results has been set up 2. an extensive program is running to cooperate with regional waterboards and suppliers of drinking water in improving the NHI 3. sharing (hydrological) data via newly setup Modeling Database for local and national models 4. Enhancing the NHI with "local" information. The NHI is and has been used for many

  4. Developments in analytical instrumentation

    Science.gov (United States)

    Petrie, G.

    The situation regarding photogrammetric instrumentation has changed quite dramatically over the last 2 or 3 years with the withdrawal of most analogue stereo-plotting machines from the market place and their replacement by analytically based instrumentation. While there have been few new developments in the field of comparators, there has been an explosive development in the area of small, relatively inexpensive analytical stereo-plotters based on the use of microcomputers. In particular, a number of new instruments have been introduced by manufacturers who mostly have not been associated previously with photogrammetry. Several innovative concepts have been introduced in these small but capable instruments, many of which are aimed at specialised applications, e.g. in close-range photogrammetry (using small-format cameras); for thematic mapping (by organisations engaged in environmental monitoring or resources exploitation); for map revision, etc. Another innovative and possibly significant development has been the production of conversion kits to convert suitable analogue stereo-plotting machines such as the Topocart, PG-2 and B-8 into fully fledged analytical plotters. The larger and more sophisticated analytical stereo-plotters are mostly being produced by the traditional mainstream photogrammetric systems suppliers with several new instruments and developments being introduced at the top end of the market. These include the use of enlarged photo stages to handle images up to 25 × 50 cm format; the complete integration of graphics workstations into the analytical plotter design; the introduction of graphics superimposition and stereo-superimposition; the addition of correlators for the automatic measurement of height, etc. The software associated with this new analytical instrumentation is now undergoing extensive re-development with the need to supply photogrammetric data as input to the more sophisticated G.I.S. systems now being installed by clients, instead

  5. Instrumentation problems for physicians.

    Science.gov (United States)

    Turner, G O

    1980-01-01

    The physician has, for whatever reasons, diminished his or her level of involvement on the team dedicated to developing, refining, and evaluating medical technology. As a result, the challenge confronting the physician and the technology development team today is to orchestrate a team structure that will ensure the greatest input and commitment from physicians and other professionals during current and future technology development. The charges of cost escalation and dehumanization in our system of health care delivery will also be discussed, as will the lack of, or confusion about, access to data concerning cost of a given instrument, and fuzzy semantics and perspectives on technology and instrumentation. The author suggests answers to, or means to ameliorate, the problems.

  6. KEKB beam instrumentation systems

    Science.gov (United States)

    Arinaga, M.; Flanagan, J.; Hiramatsu, S.; Ieiri, T.; Ikeda, H.; Ishii, H.; Kikutani, E.; Mimashi, T.; Mitsuhashi, T.; Mizuno, H.; Mori, K.; Tejima, M.; Tobiyama, M.

    2003-02-01

    For the stable high-luminosity operation and luminosity increase, the electron and positron storage rings of the KEK B-Factory (KEKB) is equipped with various beam instrumentations, which have been working well since the start of the commissioning in December, 1998. Details and performance of the beam-position monitor system based on the spectrum analysis using DSPs, the turn-by-turn BPM with four-dimensional function available for measurements of the individual bunch position, phase and intensity, the parametric beam-DCCTs designed so as to avoid the magnetic-core-selection problems for the parametric flux modulation, the bunch-by-bunch feedback system indispensable to suppress the strong multibunch instabilities in KEKB, the various optical beam diagnostic systems, such as synchrotron radiation interferometers for precise beam-size measurement, the tune meters, the bunch length monitors and the beam-loss monitors are described. Delicate machine tuning of KEKB is strongly supported by these instrumentations.

  7. Data acquisition instruments: Psychopharmacology

    Energy Technology Data Exchange (ETDEWEB)

    Hartley, D.S. III

    1998-01-01

    This report contains the results of a Direct Assistance Project performed by Lockheed Martin Energy Systems, Inc., for Dr. K. O. Jobson. The purpose of the project was to perform preliminary analysis of the data acquisition instruments used in the field of psychiatry, with the goal of identifying commonalities of data and strategies for handling and using the data in the most advantageous fashion. Data acquisition instruments from 12 sources were provided by Dr. Jobson. Several commonalities were identified and a potentially useful data strategy is reported here. Analysis of the information collected for utility in performing diagnoses is recommended. In addition, further work is recommended to refine the commonalities into a directly useful computer systems structure.

  8. An ice lithography instrument

    Science.gov (United States)

    Han, Anpan; Chervinsky, John; Branton, Daniel; Golovchenko, J. A.

    2011-06-01

    We describe the design of an instrument that can fully implement a new nanopatterning method called ice lithography, where ice is used as the resist. Water vapor is introduced into a scanning electron microscope (SEM) vacuum chamber above a sample cooled down to 110 K. The vapor condenses, covering the sample with an amorphous layer of ice. To form a lift-off mask, ice is removed by the SEM electron beam (e-beam) guided by an e-beam lithography system. Without breaking vacuum, the sample with the ice mask is then transferred into a metal deposition chamber where metals are deposited by sputtering. The cold sample is then unloaded from the vacuum system and immersed in isopropanol at room temperature. As the ice melts, metal deposited on the ice disperses while the metals deposited on the sample where the ice had been removed by the e-beam remains. The instrument combines a high beam-current thermal field emission SEM fitted with an e-beam lithography system, cryogenic systems, and a high vacuum metal deposition system in a design that optimizes ice lithography for high throughput nanodevice fabrication. The nanoscale capability of the instrument is demonstrated with the fabrication of nanoscale metal lines.

  9. Impact dynamics instrumentation

    Science.gov (United States)

    Mccormck, R. F.

    1986-01-01

    One of the tasks specified in the NASA Langley controlled impact demonstration (CID) work package was to furnish dynamic instrumentation sensors. The types of instrumentation sensors required were accelerometers for aircraft structural loads measurements, seat belt load cells to measure anthropomorphic dummy responses to the aircraft impact, and strain gage bending bridges to measure the aircraft fuselage and wing bending during impact. The objective in the selection of dynamic instrumentation for the CID was to provide 352 of the highest quality transducers and remain within budget allocation. The transducers that were selected for the CID evaluation process were each subjected to rigorous laboratory acceptance tests and to aircraft fuselage section drop tests at the LaRC Impact Dynamics Research Facility. Data compiled from this series of tests showed the selected transducers to be best suited for the CID mission requirement. The transducers installation technique on the airframe proved successful. The transducer quality assurance was guaranteed through rigorous acceptance testing. Data acquired was 97.0%.

  10. First Experience with the LHC Cryogenic Instrumentation

    CERN Document Server

    Vauthier, N; Balle, Ch; Casas-Cubillos, J; Ciechanowski, M; Fernandez-Penacoba, G; Fortescue-Beck, E; Gomes, P; Jeanmonod, N; Lopez-Lorente, A; Suraci, A

    2008-01-01

    The LHC under commissioning at CERN will be the world's largest superconducting accelerator and therefore makes extensive use of cryogenic instruments. These instruments are installed in the tunnel and therefore have to withstand the LHC environment that imposes radiation-tolerant design and construction. Most of the instruments require individual calibration; some of them exhibit several variants as concerns measuring span; all relevant data are therefore stored in an Oracle® database. Those data are used for the various quality assurance procedures defined for installation and commissioning, as well as for generating tables used by the control system to configure automatically the input/output channels. This paper describes the commissioning of the sensors and the corresponding electronics, the first measurement results during the cool-down of one machine sector; it discusses the different encountered problems and their corresponding solutions.

  11. Advancements in Actuated Musical Instruments

    DEFF Research Database (Denmark)

    Overholt, Daniel; Berdahl, Edgar; Hamilton, Robert

    2011-01-01

    This article presents recent developments in actuated musical instruments created by the authors, who also describe an ecosystemic model of actuated performance activities that blur traditional boundaries between the physical and virtual elements of musical interfaces. Actuated musical instrument...... that these instruments enable. We look at some of the conceptual and perceptual issues introduced by actuated musical instruments, and finally we propose some directions in which such research may be headed in the future.......This article presents recent developments in actuated musical instruments created by the authors, who also describe an ecosystemic model of actuated performance activities that blur traditional boundaries between the physical and virtual elements of musical interfaces. Actuated musical instruments...... are physical instruments that have been endowed with virtual qualities controlled by a computer in real-time but which are nevertheless tangible. These instruments provide intuitive and engaging new forms of interaction. They are different from traditional (acoustic) and fully automated (robotic) instruments...

  12. FHR Process Instruments

    Energy Technology Data Exchange (ETDEWEB)

    Holcomb, David Eugene [ORNL

    2015-01-01

    Fluoride salt-cooled High temperature Reactors (FHRs) are entering into early phase engineering development. Initial candidate technologies have been identified to measure all of the required process variables. The purpose of this paper is to describe the proposed measurement techniques in sufficient detail to enable assessment of the proposed instrumentation suite and to support development of the component technologies. This paper builds upon the instrumentation chapter of the recently published FHR technology development roadmap. Locating instruments outside of the intense core radiation and high-temperature fluoride salt environment significantly decreases their environmental tolerance requirements. Under operating conditions, FHR primary coolant salt is a transparent, low-vapor-pressure liquid. Consequently, FHRs can employ standoff optical measurements from above the salt pool to assess in-vessel conditions. For example, the core outlet temperature can be measured by observing the fuel s blackbody emission. Similarly, the intensity of the core s Cerenkov glow indicates the fission power level. Short-lived activation of the primary coolant provides another means for standoff measurements of process variables. The primary coolant flow and neutron flux can be measured using gamma spectroscopy along the primary coolant piping. FHR operation entails a number of process measurements. Reactor thermal power and core reactivity are the most significant variables for process control. Thermal power can be determined by measuring the primary coolant mass flow rate and temperature rise across the core. The leading candidate technologies for primary coolant temperature measurement are Au-Pt thermocouples and Johnson noise thermometry. Clamp-on ultrasonic flow measurement, that includes high-temperature tolerant standoffs, is a potential coolant flow measurement technique. Also, the salt redox condition will be monitored as an indicator of its corrosiveness. Both

  13. Instrumentation, Control, and Intelligent Systems

    Energy Technology Data Exchange (ETDEWEB)

    2005-09-01

    Abundant and affordable energy is required for U.S. economic stability and national security. Advanced nuclear power plants offer the best near-term potential to generate abundant, affordable, and sustainable electricity and hydrogen without appreciable generation of greenhouse gases. To that end, Idaho National Laboratory (INL) has been charged with leading the revitalization of nuclear power in the U.S. The INL vision is to become the preeminent nuclear energy laboratory with synergistic, world-class, multi-program capabilities and partnerships by 2015. The vision focuses on four essential destinations: (1) Be the preeminent internationally-recognized nuclear energy research, development, and demonstration laboratory; (2) Be a major center for national security technology development and demonstration; (3) Be a multi-program national laboratory with world-class capabilities; (4) Foster academic, industry, government, and international collaborations to produce the needed investment, programs, and expertise. Crucial to that effort is the inclusion of research in advanced instrumentation, control, and intelligent systems (ICIS) for use in current and advanced power and energy security systems to enable increased performance, reliability, security, and safety. For nuclear energy plants, ICIS will extend the lifetime of power plant systems, increase performance and power output, and ensure reliable operation within the system's safety margin; for national security applications, ICIS will enable increased protection of our nation's critical infrastructure. In general, ICIS will cost-effectively increase performance for all energy security systems.

  14. Tool – Material, Metaphor – Metonymy, Instrument(ness)

    DEFF Research Database (Denmark)

    Bertelsen, Olav Wedege; Breinbjerg, Morten; Pold, Søren

    2008-01-01

    This paper, presents in an abbreviated form the argument presented in an earlier paper[1], and tries to relate it to the theme, "retro in the interface". We introduce the concept instrumentness as a quality of human-computer interfaces. Instrumentness points to the way musical instruments are con...

  15. ZBLAN Viscosity Instrumentation

    Science.gov (United States)

    Kaukler, William

    2001-01-01

    The past year's contribution from Dr. Kaukler's experimental effort consists of these 5 parts: a) Construction and proof-of-concept testing of a novel shearing plate viscometer designed to produce small shear rates and operate at elevated temperatures; b) Preparing nonlinear polymeric materials to serve as standards of nonlinear Theological behavior; c) Measurements and evaluation of above materials for nonlinear rheometric behavior at room temperature using commercial spinning cone and plate viscometers available in the lab; d) Preparing specimens from various forms of pitch for quantitative comparative testing in a Dynamic Mechanical Analyzer, Thermal Mechanical Analyzer; and Archeological Analyzer; e) Arranging to have sets of pitch specimens tested using the various instruments listed above, from different manufacturers, to form a baseline of the viscosity variation with temperature using the different test modes offered by these instruments by compiling the data collected from the various test results. Our focus in this project is the shear thinning behavior of ZBLAN glass over a wide range of temperature. Experimentally, there are no standard techniques to perform such measurements on glasses, particularly at elevated temperatures. Literature reviews to date have shown that shear thinning in certain glasses appears to occur, but no data is available for ZBLAN glass. The best techniques to find shear thinning behavior require the application of very low rates of shear. In addition, because the onset of the thinning behavior occurs at an unknown elevated temperature, the instruments used in this study must provide controlled low rates of shear and do so for temperatures approaching 600 C. In this regard, a novel shearing parallel plate viscometer was designed and a prototype built and tested.

  16. Payment Instrument Characteristics

    DEFF Research Database (Denmark)

    Holst, Jacques; Kjeldsen, Martin; Hedman, Jonas;

    2015-01-01

    Over the last decade, we have witnessed payment innovations that fundamentally have changed the ways we pay. Payment innovations, such as mobile payments and on-line banking, include characteristics or features that are essential to understand if we want to know how and why payers choose among...... payment innovations. Using the Repertory Grid technique to explore 15 payers’ perception of six payment instruments, including coins, banknotes, debit cards, credit cards, mobile payments, and on-line banking, we identify 16 payment characteristics. The characteristics aggregate seventy-six unique...

  17. Beam Instrumentation and Diagnostics

    CERN Document Server

    Strehl, Peter

    2006-01-01

    This treatise covers all aspects of the design and the daily operations of a beam diagnostic system for a large particle accelerator. A very interdisciplinary field, it involves contributions from physicists, electrical and mechanical engineers and computer experts alike so as to satisfy the ever-increasing demands for beam parameter variability for a vast range of operation modi and particles. The author draws upon 40 years of research and work, most of them spent as the head of the beam diagnostics group at GSI. He has illustrated the more theoretical aspects with many real-life examples that will provide beam instrumentation designers with ideas and tools for their work.

  18. Pesticide reducing instruments

    DEFF Research Database (Denmark)

    Jacobsen, Lars-Bo; Jensen, Jørgen Dejgård; Andersen, Martin

    2005-01-01

    the cost and to calculate general economic and sectoral consequences. This CGE model is linked to an agricultural sector model calculating the optimal use of land, and the agricultural sector model is then linked to a biological agent based simulation model (ABM) calculating changes in the population...... for improving bio-diversity and securing drinking water. That is, combining economic modeling with physical biological modeling and geological evaluation allows us to select unsprayed field margins as the most effective instrument. Sensitivity analysis conducted on bio-diversity suggest that this result...

  19. Program Instrumentation and Trace Analysis

    Science.gov (United States)

    Havelund, Klaus; Goldberg, Allen; Filman, Robert; Rosu, Grigore; Koga, Dennis (Technical Monitor)

    2002-01-01

    aspect and compiles it into the original program using the instrumentation. Another core element of JPaX is an observation package that supports the analysis of the generated event stream. Two kinds of analysis are currently supported. In temporal analysis the execution trace is evaluated against formulae written in temporal logic. We have implemented a temporal logic evaluator on finite traces using the Maude rewriting system from SRI International, USA. Temporal logic is defined in Maude by giving its syntax as a signature and its semantics as rewrite equations. The resulting semantics is extremely efficient and can handle event streams of hundreds of millions events in few minutes. Furthermore, the implementation is very succinct. The second form of even stream analysis supported is error pattern analysis where an execution trace is analyzed using various error detection algorithms that can identify error-prone programming practices that may potentially lead to errors in some different executions. Two such algorithms focusing on concurrency errors have been implemented in JPaX, one for deadlocks and the other for data races. It is important to note, that a deadlock or data race potential does not need to occur in order for its potential to be detected with these algorithms. This is what makes them very scalable in practice. The data race algorithm implemented is the Eraser algorithm from Compaq, however adopted to Java. The tool is currently being applied to a code base for controlling a spacecraft by the developers of that software in order to evaluate its applicability.

  20. Calibration of "Babyline" RP instruments

    CERN Multimedia

    2015-01-01

      If you have old RP instrumentation of the “Babyline” type, as shown in the photo, please contact the Radiation Protection Group (Joffrey Germa, 73171) to have the instrument checked and calibrated. Thank you. Radiation Protection Group

  1. MC and A instrumentation catalog

    Energy Technology Data Exchange (ETDEWEB)

    Neymotin, L. [ed.] [Brookhaven National Lab., Upton, NY (United States); Sviridova, V. [ed.] [All-Russian Research Inst. of Automatics, Moscow (Russian Federation)

    1998-06-01

    In 1981 and 1985, two editions of a catalog of non-destructive nuclear measurement instrumentation, and material control and surveillance equipment, were published by Brookhaven National Laboratory (BNL). The last edition of the catalog included one hundred and twenty-five entries covering a wide range of devices developed in the US and abroad. More than ten years have elapsed since the publication of the more recent Catalog. Devices described in it have undergone significant modifications, and new devices have been developed. Therefore, in order to assist specialists in the field of Material Control and Accounting (MC and A), a new catalog has been created. Work on this instrumentation catalog started in 1997 as a cooperative effort of Brookhaven National Laboratory (BNL), operated by Brookhaven Science Associates under contract to the US Department of Energy, and the All-Russian Research Institute of Automatics (VNIIA), subordinate institute of the Atomic Energy Ministry of the Russian Federation, within the collaborative US-Russia Material Protection, Control, and Accounting (MPC and A) Program. Most of the equipment included in the Catalog are non-destructive assay (NDA) measurement devices employed for purposes of accounting, confirmation, and verification of nuclear materials. Other devices also included in the Catalog are employed in the detection and deterrence of unauthorized access to or removal of nuclear materials (material control: containment and surveillance). Equipment found in the Catalog comprises either: (1) complete devices or systems that can be used for MC and A applications; or (2) parts or components of complete systems, such as multi-channel analyzers, detectors, neutron generators, and software. All devices are categorized by their status of development--from prototype to serial production.

  2. Keyboard Emulation For Computerized Instrumentation

    Science.gov (United States)

    Wiegand, P. M.; Crouch, S. R.

    1989-01-01

    Keyboard emulator has interface at same level as manual keyboard entry. Since communication and control take place at high intelligence level in instrument, all instrument circuitry fully utilized. Little knowledge of instrument circuitry necessary, since only task interface performs is key closure. All existing logic and error checking still performed by instrument, minimizing workload of laboratory microcomputer. Timing constraints for interface operation minimal at keyboard entry level.

  3. Advancements in Actuated Musical Instruments

    DEFF Research Database (Denmark)

    Overholt, Daniel; Berdahl, Edgar; Hamilton, Robert

    2011-01-01

    are physical instruments that have been endowed with virtual qualities controlled by a computer in real-time but which are nevertheless tangible. These instruments provide intuitive and engaging new forms of interaction. They are different from traditional (acoustic) and fully automated (robotic) instruments...

  4. Electronic Instruments -- Played or Used?

    Science.gov (United States)

    Ulveland, Randall Dana

    1998-01-01

    Compares the experience of playing an acoustic instrument to an electronic instrument by analyzing the constant structures and relationships between the experiences. Concludes that students' understanding of the physical experience of making music increases when experiences with acoustic instruments precede their exposure to electronic…

  5. Mallet Instruments Challenge Beginning Percussionists.

    Science.gov (United States)

    Grumley, Fred

    1983-01-01

    Orff mallet instruments should be used in beginning band classes. Adding mallet instruments would expand a beginner's concept of percussion instruments. Just as important, the percussion section would provide a solid melodic and harmonic foundation to assist beginning wind instrumentalists with their insecurities about pitch. (RM)

  6. An Instrumental Innovation

    Science.gov (United States)

    1978-01-01

    Think of guitars and you think of rock and country music, or the vigorous rhythms of the gypsy flamenco, or perhaps the classical strumming of a Segovia. About the last thing you would associate with guitars is aerospace technology. Yet there is a connection. A whole family of quality guitars is an outgrowth of helicopter rotor research conducted for the military services and NASA by an aerospace contractor. These musical spinoffs, commercially available and rapidly gaining in popularity, are the Ovation guitar line, manufactured by Ovation Instruments, Inc., Bloomfield, Connecticut. Ovation Instruments is a subsidiary of Kaman Corporation, a diversified company originally formed to develop and build helicopters. A helicopter's rotor system, with thousands of moving parts, is highly susceptible to vibration. For rotor efficiency, vibration must be "dampened," or reduced. Like other helicopter builders, Kaman Corporation spent years of research toward that end. The technology thus developed, together with the availability of staff experts in vibration engineering, sparked an idea in the mind of the company's president and founder, Charles H. Karnan. A guitarist of professional caliber, Kaman reasoned that vibration-dampening technology could be turned around to enhance vibration and thereby produce a guitar with superior sound.

  7. The QUIET Instrument

    Energy Technology Data Exchange (ETDEWEB)

    Bischoff, C.; et al.

    2012-07-01

    The Q/U Imaging ExperimenT (QUIET) is designed to measure polarization in the Cosmic Microwave Background, targeting the imprint of inflationary gravitational waves at large angular scales ({approx}1{sup o}). Between 2008 October and 2010 December, two independent receiver arrays were deployed sequentially on a 1.4m side-fed Dragonian telescope. The polarimeters which form the focal planes use a highly compact design based on High Electron Mobility Transistors (HEMTs) that provides simultaneous measurements of the Stokes parameters Q, U, and I in a single module. The 17-element Q-band polarimeter array, with a central frequency of 43.1 GHz, has the best sensitivity (69 {mu}Ks{sup 1/2}) and the lowest instrumental systematic errors ever achieved in this band, contributing to the tensor-to-scalar ratio at r < 0:1. The 84-element W-band polarimeter array has a sensitivity of 87 {mu}Ks{sup 1/2} at a central frequency of 94.5 GHz. It has the lowest systematic errors to date, contributing at r < 0:01. The two arrays together cover multipoles in the range {ell} {approx} 25 -- 975. These are the largest HEMT-based arrays deployed to date. This article describes the design, calibration, performance of, and sources of systematic error for the instrument.

  8. Balances instruments, manufacturers, history

    CERN Document Server

    Robens, Erich; Kiefer, Susanne

    2014-01-01

    The book deals mainly with direct mass determination by means of a conventional balances. It covers the history of the balance from the beginnings in Egypt earlier than 3000 BC to recent developments. All balance types are described with emphasis on scientific balances. Methods of indirect mass determination, which are applied to very light objects like molecules and the basic particles of matter and celestial bodies, are included.  As additional guidance, today’s manufacturers are listed and the profile of important companies is reviewed. Several hundred photographs, reproductions and drawings show instruments and their uses. This book includes commercial weighing instruments for merchandise and raw materials in workshops as well as symbolic weighing in the ancient Egyptian’s ceremony of ‘Weighing of the Heart’, the Greek fate balance, the Roman  Justitia, Juno Moneta and Middle Ages scenes of the Last Judgement with Jesus or St. Michael and of modern balances. The photographs are selected from the...

  9. Instrument Remote Control via the Astronomical Instrument Markup Language

    Science.gov (United States)

    Sall, Ken; Ames, Troy; Warsaw, Craig; Koons, Lisa; Shafer, Richard

    1998-01-01

    The Instrument Remote Control (IRC) project ongoing at NASA's Goddard Space Flight Center's (GSFC) Information Systems Center (ISC) supports NASA's mission by defining an adaptive intranet-based framework that provides robust interactive and distributed control and monitoring of remote instruments. An astronomical IRC architecture that combines the platform-independent processing capabilities of Java with the power of Extensible Markup Language (XML) to express hierarchical data in an equally platform-independent, as well as human readable manner, has been developed. This architecture is implemented using a variety of XML support tools and Application Programming Interfaces (API) written in Java. IRC will enable trusted astronomers from around the world to easily access infrared instruments (e.g., telescopes, cameras, and spectrometers) located in remote, inhospitable environments, such as the South Pole, a high Chilean mountaintop, or an airborne observatory aboard a Boeing 747. Using IRC's frameworks, an astronomer or other scientist can easily define the type of onboard instrument, control the instrument remotely, and return monitoring data all through the intranet. The Astronomical Instrument Markup Language (AIML) is the first implementation of the more general Instrument Markup Language (IML). The key aspects of our approach to instrument description and control applies to many domains, from medical instruments to machine assembly lines. The concepts behind AIML apply equally well to the description and control of instruments in general. IRC enables us to apply our techniques to several instruments, preferably from different observatories.

  10. Back to Basics: Instrument Cleaning.

    Science.gov (United States)

    Spruce, Lisa

    2017-03-01

    Adequately cleaning and processing surgical instruments may be challenging for perioperative team members; however, the cleaning and processing of instruments are critical steps in making instruments safe to use on patients and achieving an appropriately safe OR environment. Instruments that are cleaned properly have had organic debris and soil removed, rendering them ready for sterilization or disinfection. This Back to Basics article covers the basic steps and considerations for cleaning and processing instruments before sterilization. Copyright © 2017 AORN, Inc. Published by Elsevier Inc. All rights reserved.

  11. Embedded instrumentation architecture

    Science.gov (United States)

    Boyd, Gerald M.; Farrow, Jeffrey

    2015-09-29

    The various technologies presented herein relate to generating copies of an incoming signal, wherein each copy of the signal can undergo different processing to facilitate control of bandwidth demands during communication of one or more signals relating to the incoming signal. A signal sharing component can be utilized to share copies of the incoming signal between a plurality of circuits/components which can include a first A/D converter, a second A/D converter, and a comparator component. The first A/D converter can operate at a low sampling rate and accordingly generates, and continuously transmits, a signal having a low bandwidth requirement. The second A/D converter can operate at a high sampling rate and hence generates a signal having a high bandwidth requirement. Transmission of a signal from the second A/D converter can be controlled by a signaling event (e.g., a signal pulse) being determined to have occurred by the comparator component.

  12. Reconfigurable laser ranging instrument

    Science.gov (United States)

    Schneiter, John

    1994-03-01

    This paper describes the design and operation of a fast, flexible, non-contact, eye-safe laser ranging instrument useful in a variety of industrial metrology situations, such as in-process machining control and part inspection. The system has variable computer-controlled standoff and depth of field, and can obtain 3-D images of surfaces within a range of from 1.5 ft to almost 10 ft from the final optical element. The minimum depth of field is about 3.5 in. at 1.5 ft and about 26 in. at the far range. The largest depth of field for which useful data are available is about 41 in. Resolution, with appropriate averaging, is about one part in 4000 of the depth of field, which implies a best case resolution for this prototype of 0.00075 in. System flexibility is achieved by computer controlled relative positioning of optical components.

  13. Portable musical instrument amplifier

    Energy Technology Data Exchange (ETDEWEB)

    Christian, David E. (Danbury, CT)

    1990-07-24

    The present invention relates to a musical instrument amplifier which is particularly useful for electric guitars. The amplifier has a rigid body for housing both the electronic system for amplifying and processing signals from the guitar and the system's power supply. An input plug connected to and projecting from the body is electrically coupled to the signal amplifying and processing system. When the plug is inserted into an output jack for an electric guitar, the body is rigidly carried by the guitar, and the guitar is operatively connected to the electrical amplifying and signal processing system without use of a loose interconnection cable. The amplifier is provided with an output jack, into which headphones are plugged to receive amplified signals from the guitar. By eliminating the conventional interconnection cable, the amplifier of the present invention can be used by musicians with increased flexibility and greater freedom of movement.

  14. The MICE PID Instrumentation

    CERN Document Server

    Bonesini, M

    2008-01-01

    The international Muon Ionization Cooling Experiment (MICE) will carry out a systematic investigation of ionization cooling of a muon beam. As the emittance measurement will be done on a particle-by-particle basis, sophisticated beam instrumentation is needed to measure particle coordinates and timing vs RF. A PID system based on three time-of-flight stations, two Aerogel Cerenkov detectors and a KLOE-like calorimeter has been constructed in order to keep beam contamination ($e, \\pi$) well below 1%. The MICE time-of-flight system will measure timing with a resolution better than 70 ps per plane, in a harsh environment due to high particle rates, fringe magnetic fields and electron backgrounds from RF dark current.

  15. Instrumented Architectural Simulation System

    Science.gov (United States)

    Delagi, B. A.; Saraiya, N.; Nishimura, S.; Byrd, G.

    1987-01-01

    Simulation of systems at an architectural level can offer an effective way to study critical design choices if (1) the performance of the simulator is adequate to examine designs executing significant code bodies, not just toy problems or small application fragements, (2) the details of the simulation include the critical details of the design, (3) the view of the design presented by the simulator instrumentation leads to useful insights on the problems with the design, and (4) there is enough flexibility in the simulation system so that the asking of unplanned questions is not suppressed by the weight of the mechanics involved in making changes either in the design or its measurement. A simulation system with these goals is described together with the approach to its implementation. Its application to the study of a particular class of multiprocessor hardware system architectures is illustrated.

  16. Instrumented Pipeline Initiative

    Energy Technology Data Exchange (ETDEWEB)

    Thomas Piro; Michael Ream

    2010-07-31

    This report summarizes technical progress achieved during the cooperative agreement between Concurrent Technologies Corporation (CTC) and U.S. Department of Energy to address the need for a for low-cost monitoring and inspection sensor system as identified in the Department of Energy (DOE) National Gas Infrastructure Research & Development (R&D) Delivery Reliability Program Roadmap.. The Instrumented Pipeline Initiative (IPI) achieved the objective by researching technologies for the monitoring of pipeline delivery integrity, through a ubiquitous network of sensors and controllers to detect and diagnose incipient defects, leaks, and failures. This report is organized by tasks as detailed in the Statement of Project Objectives (SOPO). The sections all state the objective and approach before detailing results of work.

  17. Ideology as instrument.

    Science.gov (United States)

    Glassman, Michael; Karno, Donna

    2007-12-01

    Comments on the article by J. T. Jost, which argued that the end-of-ideology claims that emerged in the aftermath of World War II were both incorrect and detrimental to the field of political psychology. M. Glassman and D. Karno make three critical points. First, Jost objectified ideology as a grand strategy implemented at the individual level, rather than as an instrument used for a specific purpose in activity. In doing so, he set ideology up as an "object" that guides human behavior rather than as a rational part of human experience. Second, they take issue with the idea that, because somebody acts in a manner that can be categorized as ideological, there actually is such a thing as ideology separate from that event and/or political experience and that psychologists ought to understand the meaning of ideology in order to understand future human activities as outside observers. Third, Jost seems to see this objective ideology as a unidirectional, causal mechanism for activity, a mechanism that assumes individuals act according to ideology, which eclipses the possibility that immediate ideological positions are the residue of purposeful activity. Glassman and Karno suggest that it may be better to take a pluralistic view of ideology in human action. Where ideology does exist, it is as a purposeful instrument--part of a logically based action to meet some ends-in-view--a mixture of immediate goals tied to secondary belief systems (which have been integrated to serve the material purposes of the purveyors of these ideologies). So if we are to understand ideology, we can only understand it through its use in human activity. (Copyright) 2007 APA.

  18. Aprendizaje instrumental en anfibios

    Directory of Open Access Journals (Sweden)

    Rubén N. Muzio

    1999-01-01

    Full Text Available Este trabajo presenta una revisión de los estudios realizados acerca de los mecanismos de aprendizaje en anfibios. Se conoce muy poco acerca de los procesos de aprendizaje en anfibios, y aún menos respecto de las relaciones cerebro-aprendizaje. Recientemente hemos comenzado el estudio sistemático del aprendizaje instrumental en el sapo Bufo arenarum dentro de un marco comparativo. Se observaron diversos fenómenos de aprendizaje comunes a una amplia variedad de vertebrados, tales como la adquisición bajo condiciones de entrenamiento masivo y espaciado, la extinción, la recuperación espontánea, el efecto subsiguiente al refuerzo, y el efecto en al adquisición de la magnitud del reforzamiento. Además, comenzamos el análisis de los efectos sobre el aprendizaje de las lesiones del pallium medial (estructura postulada como homóloga al hipocampo de los mamíferos. La lesión del paIlium medial no tuvo efectos sobre el desempeño ni sobre la tasa de captación de agua durante la adquisición. Pero retardó significativamente la extinción de la respuesta instrumental en un corredor recto. Estos datos sugieren que el palli um medial de los sapos juega un papel en la inhibición de respuestas previamente aprendidas. Los resultados de nuestros estudios en el sapo Bufo arenarum aportan datos origi na1es a la limitada información disponible sobre aprendizaje en anfibios.

  19. Development of an RDECOM Workforce Motivational Survey Instrument

    Science.gov (United States)

    2016-09-01

    compensation and workplace environment structure to motivate the target generational workforce demographic to improve productivity. The deliverables from this...factors. We developed a closed-loop survey instrument and analysis methodology to identify distinct generational workforce motivational factors. Nine...United States Army Research Development and Engineering Command (RDECOM) supervisory engineers, General Schedule (GS) 14 and 15, reviewed the survey

  20. Eco-Label, New Generation Instrument of Environmental Protection

    Directory of Open Access Journals (Sweden)

    Ilinca Elena Alexandra

    2010-06-01

    Full Text Available The overall objective of Community policy on the environment and business is to contribute to sustainable development. The EU eco-label scheme (as laid down in the new Regulation (EC No1980/2000 is now part of a wider approach on Integrated Product Policy (IPP within the new Action Programme. The Commission has published a Green Paper on IPP that will be a key innovative element of future environmental policy and sustainable consumption and production. Strategically, the European ecolabel Scheme is, and will be, in line with the principles, goals and priorities of the 6th action Programme "Our Future, Our Choice". Following the Rio Summit in 1992, preparations by the EU on the overall objectives of sustainable development are underway as the year 2002 will be the year of RIO+10. 2002 will also see the 10th anniversary of the Flower label. The European eco-label is based on the vision of greeningnon-food products all over Europe in a joint and common approach of all European stakeholders brought together in the European Union Eco-labelling Board (EUEB.

  1. Local Economic Development. New generation of actors, policies and instruments

    OpenAIRE

    Helmsing, A.H.J.

    2001-01-01

    This is a summary report prepared for the UNCDF symposium on Decentralized Local Governance in Africa. The author explains how conditions for local economic development has changed, by distinguishing two sets of forces of change. The first refers to fundamental changes in development policy, while the second in the context of local development refers to what Dicken (1998) called the new 'geo-economy'.

  2. Antibiofouling for Ocean Instruments and Floats Using Microchlorine Generation Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Long term ocean measurements are severely impacted by algae growth. In this proposed work algae will be inhibited by localized, intermitent microgeneration of...

  3. Incidence of instrument separation using LightSpeed rotary instruments.

    Science.gov (United States)

    Knowles, Kenneth I; Hammond, Nathan B; Biggs, Stephen G; Ibarrola, Jose L

    2006-01-01

    The use of nickel-titanium rotary instrument systems has gained popularity over the past 10 years. One of these instrument systems is the LightSpeed (LightSpeed Technology, Inc, San Antonio, TX). One drawback for all nickel-titanium rotary instruments is the incidence of instrument separation. The purpose of this study was to evaluate the incidence of nonretrievable instrument separation using the LightSpeed system in a clinical setting. A total of 3543 canals were treated over a 24 month period and during that time, 46 LightSpeed instruments were separated and found to be nonretrievable, resulting in a separation rate of 1.30%. This rate was lower than previous reported studies.

  4. Tool – Material, Metaphor – Metonymy, Instrument(ness)

    DEFF Research Database (Denmark)

    Bertelsen, Olav Wedege; Breinbjerg, Morten; Pold, Søren

    2008-01-01

    This paper, presents in an abbreviated form the argument presented in an earlier paper[1], and tries to relate it to the theme, "retro in the interface". We introduce the concept instrumentness as a quality of human-computer interfaces. Instrumentness points to the way musical instruments are con...... pointing to alternative values, differing from traditional usability, which are also relevant in creative work outside art and music composition.......This paper, presents in an abbreviated form the argument presented in an earlier paper[1], and tries to relate it to the theme, "retro in the interface". We introduce the concept instrumentness as a quality of human-computer interfaces. Instrumentness points to the way musical instruments...... are controlled and conceptualized through values such as virtuosity and palyability, which are important for computer-mediated creative work supporting development in use beyond what is initially designed for. The papet performs a conceptual investigation into qualities in software interfaces that support...

  5. Instrumentation for CTA site characterization

    CERN Document Server

    Fruck, Christian; Ernenwein, Jean-Pierre; Mandát, Dušan; Schweizer, Thomas; Häfner, Dennis; Bulik, Tomasz; Cieslar, Marek; Costantini, Heide; Dominik, Michal; Ebr, Jan; Garczarczyk, Markus; Lorentz, Eckart; Pareschi, Giovanni; Pech, Miroslav; Puerto-Giménez, Irene; Teshima, Masahiro

    2015-01-01

    Many atmospheric and climatic criteria have to be taken into account for the selection of a suitable site for the next generation of imaging air-shower Cherenkov telescopes, the "Cherenkov Telescope Array" CTA. Such data are not available with sufficient precision or the comparability to allow for a comprehensive characterization of the proposed sites to be made. Identical cross-calibrated instruments have been developed which allow for precise comparison between sites, the cross-validation of existing data, and the ground-validation of satellite data. The site characterization work package of the CTA consortium opted to construct and deploy 9 copies of an autonomous multi-purpose weather sensor, incorporating an infrared cloud sensor a newly developed sensor for measuring the light of the night sky, and an All-Sky-Camera, the whole referred to as Autonomous Tool for Measuring Observatory Site COnditions PrEcisely (ATMOSCOPE). We present here the hardware that was combined into the ATMOSCOPE and characterize ...

  6. A brief overview of state-of-the-art electronics in physical oceanographic instrumentation

    Digital Repository Service at National Institute of Oceanography (India)

    Charyulu, R.J.K.

    . The advances in sensor technology, extensive utilization of micro-processors, VLSI and embedded systems resulted in powerful instrumentation. The physical oceanographic & meteorological instrumentation has seen phenomenal growth from the classical... then satellite transmitted to shore earth stations. The advances of materials technology and nano-technology will further compact the sizes of future generation oceanographic instrumentation. Remote sensing satellites and communication satellites...

  7. An Enactive Approach to the Preservation of Musical Instruments Reconstructing Russolo's Intonarumori

    DEFF Research Database (Denmark)

    Serafin, Stefania; De Goetzen, Amalia

    2009-01-01

    In the early twentieth century, the Italian Futurist Luigi Russolo made a set of instruments called Intonarumori. In each, sound was generated inside a box with a horn, by means such as a wheel scraping on a string, controlled by a crank and one or more levers. The original instruments were all...... instruments whereby their original enactive properties are recreated....

  8. Ex-core instrumentation; Instrumentation hors coeur des reacteurs

    Energy Technology Data Exchange (ETDEWEB)

    Burel, J.P. [Schneider Electric S.A., 92 - Boulogne-Billancourt (France)

    1999-01-01

    The safety and the control of the reactor need to master the nuclear power from the core radiation measurement. According to the reactor dimensions and conception, the nuclear parameters monitoring is realized through two instrumentation systems: the ex-core instrumentation system which use detector placed outside of the core and the in-core instrumentation system. This paper deals with the ex-core systems based on neutronic measurements and details the detectors choice, the treatment circuits, data processing, realizations in France and also example of the Wwr reactor instrumentation. (A.L.B.)

  9. Pancreatitis Quality of Life Instrument: Development of a new instrument

    Directory of Open Access Journals (Sweden)

    Wahid Wassef

    2014-02-01

    Full Text Available Objectives: The goal of this project was to develop the first disease-specific instrument for the evaluation of quality of life in chronic pancreatitis. Methods: Focus groups and interview sessions were conducted, with chronic pancreatitis patients, to identify items felt to impact quality of life which were subsequently formatted into a paper-and-pencil instrument. This instrument was used to conduct an online survey by an expert panel of pancreatologists to evaluate its content validity. Finally, the modified instrument was presented to patients during precognitive testing interviews to evaluate its clarity and appropriateness. Results: In total, 10 patients were enrolled in the focus groups and interview sessions where they identified 50 items. Once redundant items were removed, the 40 remaining items were made into a paper-and-pencil instrument referred to as the Pancreatitis Quality of Life Instrument. Through the processes of content validation and precognitive testing, the number of items in the instrument was reduced to 24. Conclusions: This marks the development of the first disease-specific instrument to evaluate quality of life in chronic pancreatitis. It includes unique features not found in generic instruments (economic factors, stigma, and spiritual factors. Although this marks a giant step forward, psychometric evaluation is still needed prior to its clinical use.

  10. Exoplanetary Science: Instrumentation, Observations, and Expectations

    Science.gov (United States)

    McElwain, Michael

    2011-01-01

    More than 700 exoplanets have been discovered and studied using indirect techniques, leading our field into the exciting new era of comparative exoplanetology. However, the direct detection of exoplanetary systems still remains at the sensitivity limits of both ground- and space-based observatories. The development of new technologies for adaptive optics systems and high contrast instruments continues to increase the ability to directly study exoplanets. The scientific impact of these developments has promising prospects for both short and long timescales. In my talk, I will discuss recent highlights from the SEEDS survey and the current instrumentation in use at the Subaru telescope. SEEDS is a high contrast imaging strategic observing program with 120 nights of time allocated at the NAOJ's flagship optical and infrared telescope. I will also describe new instrumentation I designed to improve the SEEDS capabilities and efficiency. Finally, I will briefly discuss the conceptual design of a transiting planet camera to fly as a potential second generation instrument on-board NASA's SOFIA observatory.

  11. The XGS instrument on-board THESEUS

    Science.gov (United States)

    Fuschino, F.; Campana, R.; Labanti, C.; Marisaldi, M.; Amati, L.; Fiorini, M.; Uslenghi, M.; Baldazzi, G.; Evangelista, Y.; Elmi, I.; Feroci, M.; Frontera, F.; Rachevski, A.; Rignanese, L. P.; Vacchi, A.; Zampa, G.; Zampa, N.; Rashevskaya, I.; Bellutti, P.; Piemonte, C.

    2016-10-01

    Consolidated techniques used for space-borne X-ray and gamma-ray instruments are based on the use of scintillators coupled to Silicon photo-detectors. This technology associated with modern very low noise read-out electronics allows the design of innovative architectures able to reduce drastically the system complexity and power consumption, also with a moderate-to-high number of channels. These detector architectures can be exploited in the design of space instrumentation for gamma-spectroscopy with the benefit of possible smart background rejection strategies. We describe a detector prototype with 3D imaging capabilities to be employed in future gamma-ray and particle space missions in the 0.002-100 MeV energy range. The instrument is based on a stack of scintillating bars read out by Silicon Drift Detectors (SDDs) at both ends. The spatial segmentation and the crystal double-side readout allow a 3D position reconstruction with ∼3 mm accuracy within the full active volume, using a 2D readout along the two external faces of the detector. Furthermore, one of the side of SDDs can be used simultaneously to detect X-rays in the 2-30 keV energy range. The characteristics of this instrument make it suitable in next generation gamma-ray and particle space missions for Earth or outer space observations, and it will be briefly illustrated.

  12. Surgical Instrument Decontamination Unit

    Science.gov (United States)

    1989-02-15

    against rhinovirus tested both in suspension and on carriers (Mentel; 1973). Hydrogen peroxide in r2atively high concentrations (10 to 25%) is also...ultrasonic cavitation does not rely solely upon a chemical reaction between the hydroxyl radical and bacterial cell structures or components, although...from textiles without damaging the textile structure . It is used as a gas generator for foam products and very large quantities are used annually for

  13. Industrial instrumentation principles and design

    CERN Document Server

    Padmanabhan, Tattamangalam R

    2000-01-01

    Pneumatic, hydraulic and allied instrumentation schemes have given way to electronic schemes in recent years thanks to the rapid strides in electronics and allied areas. Principles, design and applications of such state-of-the-art instrumentation schemes form the subject matter of this book. Through representative examples, the basic building blocks of instrumentation schemes are identified and each of these building blocks discussed in terms of its design and interface characteristics. The common generic schemes synthesized with such building blocks are dealt with subsequently. This forms the scope of Part I. The focus in Part II is on application. Displacement and allied instrumentation, force and allied instrumentation and process instrumentation in terms of temperature, flow, pressure level and other common process variables are dealt with separately and exhaustively. Despite the diversity in the sensor principles and characteristics and the variety in the applications and their environments, it is possib...

  14. Instruments to assess integrated care

    DEFF Research Database (Denmark)

    Lyngsø, Anne Marie; Godtfredsen, Nina Skavlan; Høst, Dorte

    2014-01-01

    abstracts were independently reviewed by two investigators. RESULTS: We identified 23 measurement instruments and, within these, eight organisational elements were found. No measurement instrument covered all organisational elements, but almost all studies include well-defined structural and process aspects......INTRODUCTION: Although several measurement instruments have been developed to measure the level of integrated health care delivery, no standardised, validated instrument exists covering all aspects of integrated care. The purpose of this review is to identify the instruments concerning how...... to measure the level of integration across health-care sectors and to assess and evaluate the organisational elements within the instruments identified. METHODS: An extensive, systematic literature review in PubMed, CINAHL, PsycINFO, Cochrane Library, Web of Science for the years 1980-2011. Selected...

  15. The Clementine instrument complement

    Science.gov (United States)

    Lucey, Paul G.

    1993-01-01

    The recent successes of the Galileo solid-state imaging (SSI) experiment at the Moon and Gaspra show the utility of multispectral imaging of planetary objects. 'Clementine' is the planetary community's 'code name' for the SDIO (Space Defense Initiative Organization), mission to the Moon and the asteroid Geographos. This mission is designed as a long term stressing test on sensors and space systems developed for SDIO. In the course of this test Clementine will obtain science data using a varied and powerful array of remote sensing instruments which were developed by or for Lawrence Livermore National Laboratory in Livermore, California. Clementine carries five cameras, one for navigation and four for science experiments. In addition, a laser ranger is included which will serve as a laser altimeter. The Clementine cameras cover a wider range of spatial resolutions and wavelength range than did Galileo and are almost ideally suited to mapping of mafic rock types as are present on the Moon and expected at Geographos. Calibration of the cameras will occur at the sensor calibration laboratory at LLNL. In flight calibrations, using standard stars and other standards should improve the stated accuracies. Signal-to-noise ratios (SNRs) include the following noise sources: shot noise, calibration error, digitization noise, readout noise, and frame transfer noise (where applicable). The achieved SNRs are a balance between detector saturation and acceptable image smear. The 'worst' case uses the longest possible integration times.

  16. Impact Disdrometers Instrument Handbook

    Energy Technology Data Exchange (ETDEWEB)

    Bartholomew, Mary Jane [Brookhaven National Lab. (BNL), Upton, NY (United States)

    2016-03-01

    To improve the quantitative description of precipitation processes in climate models, the U.S. Department of Energy’s Atmospheric Radiation Measurement (ARM) Climate Research Facility has been collecting observations of the drop size spectra of rain events since early in 2006. Impact disdrometers were the initial choice due to their reliability, ease of maintenance, and relatively low cost. Each of the two units deployed was accompanied by a nearby tipping bucket. In 2010, the tipping buckets were replaced by weighing buckets rain gauges. Five video disdrometers were subsequently purchased and are described in ARM’s VDIS Handbook.1 As of April 2011, three of the weighing bucket instruments were deployed, one was to travel with the second ARM Mobile Facility, and the fifth was a spare. Two of the video disdrometers were deployed, a third was to be deployed later in the spring of 2011, one was to travel with the second ARM Mobile Facility, and the last was a spare. Detailed descriptions of impact disdrometers and their datastreams are provided in this document.

  17. Halo vest instrumentation

    Science.gov (United States)

    Huston, Dryver R.; Krag, Martin

    1996-05-01

    The halo vest is a head and neck immobilization system that is often used on patients that are recovering from cervical trauma or surgery. The halo vest system consists of a rigid halo that is firmly attached to the skull, an upright support structure for stabilization and immobilization, and a torso-enveloping vest. The main purpose of this study was to measure the forces that are carried by the halo-vest structure as the subject undergoes various activities of daily living and external loading for different vest designs. A tethered strain gage load cell based instrumentation system was used to take these load measurements on ten different subjects. Three different halo-vest systems were evaluated. The primary difference between the vests was the amount of torso coverage and the use of shoulder straps. The loads were measured, analyzed and used to compare the vests and to create a model of halo-vest-neck mechanics. Future applications of this technology to standalone data logging, pin-load measuring and biofeedback applications are discussed.

  18. Measurement, instrumentation, and sensors handbook

    CERN Document Server

    Eren, Halit

    2014-01-01

    The Second Edition of the bestselling Measurement, Instrumentation, and Sensors Handbook brings together all aspects of the design and implementation of measurement, instrumentation, and sensors. Reflecting the current state of the art, it describes the use of instruments and techniques for performing practical measurements in engineering, physics, chemistry, and the life sciences and discusses processing systems, automatic data acquisition, reduction and analysis, operation characteristics, accuracy, errors, calibrations, and the incorporation of standards for control purposes. Organized acco

  19. Experimenting with string musical instruments

    Science.gov (United States)

    LoPresto, Michael C.

    2012-03-01

    What follows are several investigations involving string musical instruments developed for and used in a Science of Sound & Light course. The experiments make use of a guitar, orchestral string instruments and data collection and graphing software. They are designed to provide students with concrete examples of how mathematical formulae, when used in physics, represent reality that can actually be observed, in this case, the operation of string musical instruments.

  20. Logical Varieties of Instrumental Reasons

    OpenAIRE

    Spielthenner, Georg

    2012-01-01

    Instrumental reasons play a central role in our practical deliberations because we apply the distinction between reasonable and unreasonable not only to beliefs, but to actions also. The question of what one has an instrumental reason to do is an important substantive question that is relevant to the general theory of practical reasoning and to ethics, too. It will be my object in the present study to show that we have different kinds of instrumental reasons, which depend solely on their logi...

  1. Next-Generation Sequencing Platforms

    Science.gov (United States)

    Mardis, Elaine R.

    2013-06-01

    Automated DNA sequencing instruments embody an elegant interplay among chemistry, engineering, software, and molecular biology and have built upon Sanger's founding discovery of dideoxynucleotide sequencing to perform once-unfathomable tasks. Combined with innovative physical mapping approaches that helped to establish long-range relationships between cloned stretches of genomic DNA, fluorescent DNA sequencers produced reference genome sequences for model organisms and for the reference human genome. New types of sequencing instruments that permit amazing acceleration of data-collection rates for DNA sequencing have been developed. The ability to generate genome-scale data sets is now transforming the nature of biological inquiry. Here, I provide an historical perspective of the field, focusing on the fundamental developments that predated the advent of next-generation sequencing instruments and providing information about how these instruments work, their application to biological research, and the newest types of sequencers that can extract data from single DNA molecules.

  2. CMOS Electrochemical Instrumentation for Biosensor Microsystems: A Review.

    Science.gov (United States)

    Li, Haitao; Liu, Xiaowen; Li, Lin; Mu, Xiaoyi; Genov, Roman; Mason, Andrew J

    2016-12-31

    Modern biosensors play a critical role in healthcare and have a quickly growing commercial market. Compared to traditional optical-based sensing, electrochemical biosensors are attractive due to superior performance in response time, cost, complexity and potential for miniaturization. To address the shortcomings of traditional benchtop electrochemical instruments, in recent years, many complementary metal oxide semiconductor (CMOS) instrumentation circuits have been reported for electrochemical biosensors. This paper provides a review and analysis of CMOS electrochemical instrumentation circuits. First, important concepts in electrochemical sensing are presented from an instrumentation point of view. Then, electrochemical instrumentation circuits are organized into functional classes, and reported CMOS circuits are reviewed and analyzed to illuminate design options and performance tradeoffs. Finally, recent trends and challenges toward on-CMOS sensor integration that could enable highly miniaturized electrochemical biosensor microsystems are discussed. The information in the paper can guide next generation electrochemical sensor design.

  3. CMOS Electrochemical Instrumentation for Biosensor Microsystems: A Review

    Science.gov (United States)

    Li, Haitao; Liu, Xiaowen; Li, Lin; Mu, Xiaoyi; Genov, Roman; Mason, Andrew J.

    2016-01-01

    Modern biosensors play a critical role in healthcare and have a quickly growing commercial market. Compared to traditional optical-based sensing, electrochemical biosensors are attractive due to superior performance in response time, cost, complexity and potential for miniaturization. To address the shortcomings of traditional benchtop electrochemical instruments, in recent years, many complementary metal oxide semiconductor (CMOS) instrumentation circuits have been reported for electrochemical biosensors. This paper provides a review and analysis of CMOS electrochemical instrumentation circuits. First, important concepts in electrochemical sensing are presented from an instrumentation point of view. Then, electrochemical instrumentation circuits are organized into functional classes, and reported CMOS circuits are reviewed and analyzed to illuminate design options and performance tradeoffs. Finally, recent trends and challenges toward on-CMOS sensor integration that could enable highly miniaturized electrochemical biosensor microsystems are discussed. The information in the paper can guide next generation electrochemical sensor design. PMID:28042860

  4. CMOS Electrochemical Instrumentation for Biosensor Microsystems: A Review

    Directory of Open Access Journals (Sweden)

    Haitao Li

    2016-12-01

    Full Text Available Modern biosensors play a critical role in healthcare and have a quickly growing commercial market. Compared to traditional optical-based sensing, electrochemical biosensors are attractive due to superior performance in response time, cost, complexity and potential for miniaturization. To address the shortcomings of traditional benchtop electrochemical instruments, in recent years, many complementary metal oxide semiconductor (CMOS instrumentation circuits have been reported for electrochemical biosensors. This paper provides a review and analysis of CMOS electrochemical instrumentation circuits. First, important concepts in electrochemical sensing are presented from an instrumentation point of view. Then, electrochemical instrumentation circuits are organized into functional classes, and reported CMOS circuits are reviewed and analyzed to illuminate design options and performance tradeoffs. Finally, recent trends and challenges toward on-CMOS sensor integration that could enable highly miniaturized electrochemical biosensor microsystems are discussed. The information in the paper can guide next generation electrochemical sensor design.

  5. Multipotenciostat System Based on Virtual Instrumentation

    Directory of Open Access Journals (Sweden)

    Arrieta-Almario Álvaro Angel

    2014-07-01

    Full Text Available To carry out this project an electronic multichannel system of electrochemical measurement or multipotenciostat was developed. It is based on the cyclic voltammetry measurement technique, controlled by a computer that monitors, by means of an electronic circuit, both the voltage generated from the Pc and supplied to an electrolytic cell, and the current that flows through the electrodes of it. To design the application software and the user interface, Virtual Instrumentation was used. On the other hand, to perform the communication between the multipotenciostat circuit and the designed software, the National Instruments NI9263 and NI9203 acquisition modules were used. The system was tested on a substance with a known REDOX property, as well as to discriminate and classify some samples of coffee.

  6. Instrumental and Analytic Methods for Bolometric Polarimetry

    CERN Document Server

    Jones, W C; Crill, B P; Contaldi, C R; Kisner, T S; Lange, A E; MacTavish, C J; Netterfield, C B; Ruhl, J E

    2006-01-01

    We discuss instrumental and analytic methods that have been developed for the first generation of bolometric cosmic microwave background (CMB) polarimeters. The design, characterization, and analysis of data obtained using Polarization Sensitive Bolometers (PSBs) are described in detail. This is followed by a brief study of the effect of various polarization modulation techniques on the recovery of sky polarization from scanning polarimeter data. Having been successfully implemented on the sub-orbital Boomerang experiment, PSBs are currently operational in two terrestrial CMB polarization experiments (QUaD and the Robinson Telescope). We investigate two approaches to the analysis of data from these experiments, using realistic simulations of time ordered data to illustrate the impact of instrumental effects on the fidelity of the recovered polarization signal. We find that the analysis of difference time streams takes full advantage of the high degree of common mode rejection afforded by the PSB design. In ad...

  7. Design of Onboard Instrument Based on Virtual Instrument Technology

    Institute of Scientific and Technical Information of China (English)

    TANG Baoping; ZHONG Yuanchang; QIU Jianwei

    2006-01-01

    After analyzing and comparing the traditional automobile instrument, the onboard instrument based on virtual instrument technology is designed in this paper. The PC/104 computer was employed as the core processing unit of the onboard instrument, and the several intelligent data acquisition nodes are set and connected by the CAN bus, through which the nodes can communicate with the core processing unit. The information of the vehicle's working condition can be displayed synthetically by adopting virtual instrument technology. When the working condition goes beyond its limit, the system can emit an alarm, record and storage the abnormal condition automatically, and suggest how to deal with the abnormity urgently. The development background and design idea of onboard information system were elaborated in the paper. The software, the hardware architecture and the principle of onboard information system were introduced in detail.

  8. Development of a surface scanning soil analysis instrument.

    Science.gov (United States)

    Falahat, S; Köble, T; Schumann, O; Waring, C; Watt, G

    2012-07-01

    ANSTO is developing a nuclear field instrument for measurement of soil composition; particularly carbon. The instrument utilises the neutron activation approach with clear advantages over existing soil sampling and laboratory analysis. A field portable compact pulsed neutron generator and γ-ray detector are used for PGNAA and INS techniques simultaneously. Many elements can be quantified from a homogenised soil volume equivalent to the top soil layers. Results from first test experiments and current developments are reported.

  9. Improving Pressure Instrument Control of the Catalytic Regenerator to Enhance the Generating Capacity of Energy Recovery Unit%改善催化再生器压力仪表控制质量提高能量回收机组发电量

    Institute of Scientific and Technical Information of China (English)

    段国旺; 张洪峰; 毕秋阁; 王永祥

    2012-01-01

    在催化裂化装置再生器压力分程控制中,烟机入口蝶阀和双动滑阀是参与控制的重要执行机构,本文通过调整蝶阀和双动滑阀动作的线性度、受控精度、灵敏度,提高了能量回收机组(烟机-主风机-电动机/发电机)仪表的控制质量,达到了回收再生烟气中携带的大部分能量,降低了机组功率消耗,提高了机组回收效能.%In the split control of the pressure in the regenerator of catalytic cracking unit,flue gas turbine inlet butterfly valve and double acting spool valve are two important execution machines directly involved in the control.In this paper,by adjusting linearity,control accuracy and sensitivity of the butterfly valve and double acting spool valve,the control effect of instruments in the energy recovery unit (flue gas turbine-fan-motor/generator) was improved to recycle most energy in flue gas,reduce unit power consumption and improve recycling performance.

  10. Endoscopic Instruments and Electrosurgical Unit for Colonoscopic Polypectomy.

    Science.gov (United States)

    Park, Hong Jun

    2016-07-01

    Colorectal polypectomy is an effective method for prevention of colorectal cancer. Many endoscopic instruments have been used for colorectal polypectomy, such as snares, forceps, endoscopic clips, a Coagrasper, retrieval net, injector, and electrosurgery generator unit (ESU). Understanding the characteristics of endoscopic instruments and their proper use according to morphology and size of the colorectal polyp will enable endoscopists to perform effective polypectomy. I reviewed the characteristics of endoscopic instruments for colorectal polypectomy and their appropriate use, as well as the basic principles and settings of the ESU.

  11. Formación instrumental

    Directory of Open Access Journals (Sweden)

    Darío Zerrate

    2008-09-01

    Full Text Available Es el nombre dado al proyecto de investigación que un Grupo de docentes del Énfasis de Pedagogía Instrumental del Departamento de Educación Musical de la Facultad de BELLAS ARTES, propone para reflexionar sobre la Didáctica Instrumental

  12. Cryogenic Caging for Science Instrumentation

    Science.gov (United States)

    Penanen, Konstantin; Chui, Talso C.

    2011-01-01

    A method has been developed for caging science instrumentation to protect from pyro-shock and EDL (entry, descent, and landing) acceleration damage. Caging can be achieved by immersing the instrument (or its critical parts) in a liquid and solidifying the liquid by cooling. After the launch shock and/or after the payload has landed, the solid is heated up and evaporated.

  13. Autonomous Bio-Optical Instruments

    Science.gov (United States)

    2000-09-30

    Autonomous Bio -Optical Instruments Russ E. Davis Scripps Institution of Oceanography La Jolla CA 92093-0230 phone: (858) 534-4415 fax: (858) 534... Bio -Optical Instruments 5a. CONTRACT NUMBER 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER 6. AUTHOR(S) 5d. PROJECT NUMBER 5e. TASK NUMBER 5f. WORK

  14. Instruments in science and technology

    NARCIS (Netherlands)

    Boon, Mieke; Olsen, Jan Kyrre Berg; Pedersen, Stig Andur; Hendricks, Vincent F.

    2009-01-01

    Modern science and technology are interwoven into a complex that is sometimes called 'techno-science': the progress of science is dependent on the sophistication of instrumentation, whereas the progress of ‘high-tech’ instruments and apparatus is dependent on scientific research. Yet, how scientific

  15. A Database Management Assessment Instrument

    Science.gov (United States)

    Landry, Jeffrey P.; Pardue, J. Harold; Daigle, Roy; Longenecker, Herbert E., Jr.

    2013-01-01

    This paper describes an instrument designed for assessing learning outcomes in data management. In addition to assessment of student learning and ABET outcomes, we have also found the instrument to be effective for determining database placement of incoming information systems (IS) graduate students. Each of these three uses is discussed in this…

  16. Experimenting with String Musical Instruments

    Science.gov (United States)

    LoPresto, Michael C.

    2012-01-01

    What follows are several investigations involving string musical instruments developed for and used in a "Science of Sound & Light" course. The experiments make use of a guitar, orchestral string instruments and data collection and graphing software. They are designed to provide students with concrete examples of how mathematical formulae, when…

  17. Kodaly Strategies for Instrumental Teachers.

    Science.gov (United States)

    Howard, Priscella M.

    1996-01-01

    Advocates using the singing voice and the study of folk music in instrumental instruction. Recommends instrumental teachers confer with voice teachers to coordinate ideas and terminology. Includes several excerpts of scores and musical exercises, as well as a list of selected resources. (MJP)

  18. Generating Units

    Data.gov (United States)

    Department of Homeland Security — Generating Units are any combination of physically connected generators, reactors, boilers, combustion turbines, and other prime movers operated together to produce...

  19. Current and Nascent SETI Instruments

    CERN Document Server

    Siemion, Andrew P V; Chen, Henry; Cordes, Jim; Filiba, Terry; Foster, Griffin; Fries, Adam; Howard, Andrew; von Korff, Josh; Korpela, Eric; Lebofsky, Matt; McMahon, Peter L; Parsons, Aaron; Spitler, Laura; Wagner, Mark; Werthimer, Dan

    2011-01-01

    Here we describe our ongoing efforts to develop high-performance and sensitive instrumentation for use in the search for extra-terrestrial intelligence (SETI). These efforts include our recently deployed Search for Extraterrestrial Emissions from Nearby Developed Intelligent Populations Spectrometer (SERENDIP V.v) and two instruments currently under development; the Heterogeneous Radio SETI Spectrometer (HRSS) for SETI observations in the radio spectrum and the Optical SETI Fast Photometer (OSFP) for SETI observations in the optical band. We will discuss the basic SERENDIP V.v instrument design and initial analysis methodology, along with instrument architectures and observation strategies for OSFP and HRSS. In addition, we will demonstrate how these instruments may be built using low-cost, modular components and programmed and operated by students using common languages, e.g. ANSI C.

  20. Instrument Remote Control Application Framework

    Science.gov (United States)

    Ames, Troy; Hostetter, Carl F.

    2006-01-01

    The Instrument Remote Control (IRC) architecture is a flexible, platform-independent application framework that is well suited for the control and monitoring of remote devices and sensors. IRC enables significant savings in development costs by utilizing extensible Markup Language (XML) descriptions to configure the framework for a specific application. The Instrument Markup Language (IML) is used to describe the commands used by an instrument, the data streams produced, the rules for formatting commands and parsing the data, and the method of communication. Often no custom code is needed to communicate with a new instrument or device. An IRC instance can advertise and publish a description about a device or subscribe to another device's description on a network. This simple capability of dynamically publishing and subscribing to interfaces enables a very flexible, self-adapting architecture for monitoring and control of complex instruments in diverse environments.

  1. Instrumental variables and Mendelian randomization with invalid instruments

    Science.gov (United States)

    Kang, Hyunseung

    Instrumental variables (IV) methods have been widely used to determine the causal effect of a treatment, exposure, policy, or an intervention on an outcome of interest. The IV method relies on having a valid instrument, a variable that is (A1) associated with the exposure, (A2) has no direct effect on the outcome, and (A3) is unrelated to the unmeasured confounders associated with the exposure and the outcome. However, in practice, finding a valid instrument, especially those that satisfy (A2) and (A3), can be challenging. For example, in Mendelian randomization studies where genetic markers are used as instruments, complete knowledge about instruments' validity is equivalent to complete knowledge about the involved genes' functions. The dissertation explores the theory, methods, and application of IV methods when invalid instruments are present. First, when we have multiple candidate instruments, we establish a theoretical bound whereby causal effects are only identified as long as less than 50% of instruments are invalid, without knowing which of the instruments are invalid. We also propose a fast penalized method, called sisVIVE, to estimate the causal effect. We find that sisVIVE outperforms traditional IV methods when invalid instruments are present both in simulation studies as well as in real data analysis. Second, we propose a robust confidence interval under the multiple invalid IV setting. This work is an extension of our work on sisVIVE. However, unlike sisVIVE which is robust to violations of (A2) and (A3), our confidence interval procedure provides honest coverage even if all three assumptions, (A1)-(A3), are violated. Third, we study the single IV setting where the one IV we have may actually be invalid. We propose a nonparametric IV estimation method based on full matching, a technique popular in causal inference for observational data, that leverages observed covariates to make the instrument more valid. We propose an estimator along with

  2. European XFEL: Soft X-Ray instrumentation

    Energy Technology Data Exchange (ETDEWEB)

    Molodtsov, S. L., E-mail: serguei.molodtsov@xfel.eu [European XFEL GmbH (Germany)

    2011-12-15

    The currently constructed European X-Ray Free Electron Laser (XFEL) will generate new knowledge in almost all the technical and scientific disciplines that are shaping our daily life-including nanotechnology, medicine, pharmaceutics, chemistry, materials science, power engineering and electronics. On 8 January 2009, civil engineering work (tunnels, shafts, halls) has been started at all three construction sites. In this presentation status and parameters of the European XFEL facility and instrumentation as well as planned research applications particularly in the range of soft X-rays are reviewed.

  3. Generational diversity.

    Science.gov (United States)

    Kramer, Linda W

    2010-01-01

    Generational diversity has proven challenges for nurse leaders, and generational values may influence ideas about work and career planning. This article discusses generational gaps, influencing factors and support, and the various generational groups present in today's workplace as well as the consequences of need addressing these issues. The article ends with a discussion of possible solutions.

  4. Intensity Frontier Instrumentation

    Energy Technology Data Exchange (ETDEWEB)

    Kettell S.; Rameika, R.; Tshirhart, B.

    2013-09-24

    The fundamental origin of flavor in the Standard Model (SM) remains a mystery. Despite the roughly eighty years since Rabi asked “Who ordered that?” upon learning of the discovery of the muon, we have not understood the reason that there are three generations or, more recently, why the quark and neutrino mixing matrices and masses are so different. The solution to the flavor problem would give profound insights into physics beyond the Standard Model (BSM) and tell us about the couplings and the mass scale at which the next level of insight can be found. The SM fails to explain all observed phenomena: new interactions and yet unseen particles must exist. They may manifest themselves by causing SM reactions to differ from often very precise predictions. The Intensity Frontier (1) explores these fundamental questions by searching for new physics in extremely rare processes or those forbidden in the SM. This often requires massive and/or extremely finely tuned detectors.

  5. The modern trends in space electromagnetic instrumentation

    Science.gov (United States)

    Korepanov, V. E.

    The future trends of the experimental plasma physics development in outer space demand more and more exact and sophisticated scientific instrumentation. Moreover, the situation is complicated by constant reduction of financial support of scientific research, even in leading countries. This resulted in the development of mini; micro and nanosatellites with low price and short preparation time. Consequently, it provoked the creation of new generation of scientific instruments with reduced weight and power consumption but increased level of metrological parameters. The recent state of the development of electromagnetic (EM) sensors for microsatellites is reported. For flux-gate magnetometers (FGM) the reduction of weight as well as power consumption was achieved not only due to the use of new electronic components but also because of the new operation mode development. The scientific and technological study allowed to decrease FGM noise and now the typical noise figure is about 10 picotesla rms at 1 Hz and the record one is below 1 picotesla. The super-light version of search-coil magnetometers (SCM) was created as the result of intensive research. These new SCMs can have about six decades of operational frequency band with upper limit ˜ 1 MHz and noise level of few femtotesla with total weight about 75 grams, including electronics. A new instrument.- wave probe (WP) - which combines three independent sensors in one body - SCM, split Langmuir probe and electric potential sensor - was created. The developed theory confirms that WP can directly measure the wave vector components in space plasmas.

  6. An embeddable control system for astronomical instrumentation

    Science.gov (United States)

    Cirami, Roberto; Comari, Maurizio; Corte, Claudio; Golob, Damjan; Di Marcantonio, Paolo; Plesko, Mark; Pucillo, Mauro; Santin, Paolo; Sekoranja, Matej; Vuerli, Claudio

    2004-09-01

    Large experimental facilities, like telescopes and focal plane instrumentation in the astronomical domain, are becoming more and more complex and expensive, as well as control systems for managing such instruments. The general trend, as can be learned by realizations carried out in the most recent years, clearly drives to most cost-effective solutions: widespread, stable standards in the software field, COTS (commercial off-the-shelf) components and industry standards in the hardware field. Therefore a new generation of control system products needs to be developed, in order to help the scientific community to minimize the cost and efforts required for maintenance and control of their facilities. In the spirit of the aforementioned requirements and to provide a low-cost software and hardware environment we present a working prototype of a control system, based on RTAI Linux and on ACS (Advanced Control System) framework ported to an embedded platform. The hardware has been chosen among COTS components: a PC/104+ platform equipped with a PMAC2A motion controller card and a commercial StrongARM single board controller. In this way we achieved a very powerful, inexpensive and robust real-time control system which can be used as a general purpose building block in the design of new instruments and could also be proposed as a standard in the field.

  7. Digitization of optical lever instruments

    Directory of Open Access Journals (Sweden)

    G. Romeo

    2000-06-01

    Full Text Available Some classical old-fashioned instruments (such as the Wood-Anderson seismometers, as well as some modern instruments (like the all-quartz made Verbaandert-Melchior tiltmeters, conventionally require an impractical recording system obtained by a photographic drum recorder in a darkroom. Simple electronic equipment (made by readily available, low cost electronics may help in using such kind of instruments allowing a useful digital recording. This will reduce the time-hour in data acquisition and storage (and the manual error, and will increase the accuracy. The theory of operations and some results obtained using the described equipment are shown.

  8. Evaluating the Relational Coordination instrument

    DEFF Research Database (Denmark)

    Edwards, Kasper; Lundstrøm, Sanne Lykke

    2014-01-01

    and surgical performance. This has prompted the attention of both practitioners and politicians some of who perceive relational coordination as a means to attain better performance. The relational coordination instrument has been validated as a measure of teamwork from the following perspectives: internal...... consistency, interrater agreement and reliability, structural validity, content validity. However as relational coordination is being used as a diagnostics tool it is important to examine further if the instrument can measure changes. Indeed we need to know how precise and sensitive the instrument is when...

  9. EIT based on virtual instrument

    Directory of Open Access Journals (Sweden)

    Ma Jun

    2013-01-01

    Full Text Available Design of a electrical impedance tomography system based on virtual instrument, the author firstly introduced the virtual instrument into the electrical impedance imaging from the perspective of hardware and software. The system use DAQ of NI to simplify the hardware structure and improve the stability. Software of system combines the advantages of LABVIEW and MATLAB, and verify some algorithms. Using NI virtual instrument, the system has strong expansion and do good basis for enhancing the performance of electrical impedance imaging system.

  10. A myofeedback instrument for clinical use.

    Science.gov (United States)

    McCarthy, C F; De Luca, C J

    1984-07-01

    As a result of a collaborative effort by engineers, physical therapists, and patients, a myofeedback device called Myochirp was designed and constructed. This device was field-tested in six busy medical centers to determine its acceptance and usefulness to clinicians in the daily activities of their environments. As a result of this field evaluation, a second-generation device was constructed incorporating the suggested improvements. The second-generation Myochirp was accepted by physical therapists as a compact, portable, and lightweight device that was convenient and easy to use. The salient feature of the device which rendered it so useful in clinical environments was the dry electrode used to detect the electromyographic signals. Its usefulness as a myofeedback instrument was determined by the variety of its applications to treatment needs and by its ability to obtain immediate and quantifiable data that could be documented.

  11. [Spectral analysis of sounds produced by musical instruments and other sounding bodies for hearing screening of children].

    Science.gov (United States)

    Ptok, M; Sesterhenn, G; Ptok, A; Arold, R

    1993-01-01

    Some time ago audiological screening in infants was mostly performed using musical instruments or equivalents. The use of acoustic evoked potentials and oto-acoustic emissions changed the strategies of hearing assessment in newborns and infants, however, musical instruments are still in use. An adequate interpretation of screening results obtained with musical instruments necessitates a profound knowledge of frequencies and intensities derived from these instruments. In this study spectral analyses of sounds from these instruments were performed. The results may be of value for those using musical instruments as a tool for audiological screening. In addition, the results show that with some instruments intensities able to cause inner ear damage can be generated.

  12. The Airborne Research Instrumentation Testing Opportunity (ARISTO)

    Science.gov (United States)

    Wolff, C.; Romashkin, P.; Lussier, L.; Baeuerle, B.; Stith, J. L.

    2016-12-01

    In 2015 the National Science Foundation (NSF) began a program to sponsor an annual flight campaign on one of its research aircraft (the C-130 and GV) operated by the National Center for Atmospheric Research (NCAR). The aircraft are managed by the Research Aviation Facility (RAF), which is part of the Earth Observing Laboratory (EOL) and responsible for planning and executing the campaigns. The purpose of this program, known as the Airborne Research Instrumentation Testing Opportunity or ARISTO, is to provide regular flight test opportunities for newly developed or highly modified instruments as part of their development effort. The NSF community has expressed a strong desire for regularly scheduled flight-testing programs to be able to test instrumentation, data systems, inlets, and software. ARISTO allows this testing in a low-pressure environment where any issues or problems will not affect the scientific goals of a large-scale field campaign. For this reason it is also a good experience for students who may be learning about the operation of an instrument or have not had previous exposure to a field project. They are also able to contribute to flight planning exercises and gain experience in acting as an instrument scientist during the program. A goal of the program is to incorporate students into the project operations to prepare the next generation of airborne researchers. ARISTO is conducted at the Research Aviation Facility at Rocky Mountain Metropolitan Airport in Broomfield, Colorado. The flight campaign consists of 20 flight hours, spread over three weeks. Flights are planned to allow the ARISTO participants to successfully test their instruments based on requirements they described in the initial application. Due to the limited hours most flights are focused in and around Colorado, though some have gone as far as Oklahoma and the Pacific Northwest to find the right conditions to meet testing requirements. Two ARISTO campaigns were successfully completed

  13. Instrument detects bacterial life forms

    Science.gov (United States)

    Plakas, C.

    1971-01-01

    Instrument assays enzymatic bioluminescent reaction that occurs when adenosine triphosphate /ATP/ combines with lucifrase and luciferin. Module assembly minimizes need for hardware associated with reaction fluid and waste transfer. System is applicable in marine biology and aerospace and medical fields.

  14. Technical Training seminar: Texas Instruments

    CERN Multimedia

    2006-01-01

    Monday 6 November TECHNICAL TRAINING SEMINAR 14:00 to 17:30 - Training Centre Auditorium (bldg. 593) Texas Instruments Technical Seminar Michael Scholtholt, Field Application Engineer / TEXAS INSTRUMENTS (US, D, CH) POWER - A short approach to Texas Instruments power products Voltage mode vs. current mode control Differentiating DC/DC converters by analyzing control and compensation schemes: line / load regulation, transient response, BOM, board space, ease-of-use Introduction to the SWIFT software FPGA + CPLD power solutions WIRELESS / CHIPCON Decision criteria when choosing a RF platform Introduction to Texas Instruments wireless products: standardized platforms proprietary platforms ( 2.4 GHz / sub 1 GHz) development tools Antenna design: example for 2.4 GHz questions, discussion Industrial partners: Robert Medioni, François Caloz / Spoerle Electronic, CH-1440 Montagny (VD), Switzerland Phone: +41 24 447 0137, email: RMedioni@spoerle.com, http://www.spoerle.com Language: English. Free s...

  15. Islamic Astronomical Instruments and Observatories

    Science.gov (United States)

    Heidarzadeh, Tofigh

    This chapter is a brief survey of astronomical instruments being used and developed in Islamic territories from the eighth to the fifteenth centuries as well as a concise account of major observatories and observational programs in this period.

  16. Compact Formaldehyde Fluorescence Instrument Element

    Data.gov (United States)

    National Aeronautics and Space Administration — The successful completion of this IRAD will deliver a fully functional instrument at TRL 6.  The key characteristics that we will demonstrate are simplicity,...

  17. Virtual Sensor Test Instrumentation Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Mobitrum has started the development of virtual sensor test instrumentation in Phase I for characterization and measurement of ground testing of propulsion systems....

  18. Intelligent instrumentation principles and applications

    CERN Document Server

    Bhuyan, Manabendra

    2011-01-01

    With the advent of microprocessors and digital-processing technologies as catalyst, classical sensors capable of simple signal conditioning operations have evolved rapidly to take on higher and more specialized functions including validation, compensation, and classification. This new category of sensor expands the scope of incorporating intelligence into instrumentation systems, yet with such rapid changes, there has developed no universal standard for design, definition, or requirement with which to unify intelligent instrumentation. Explaining the underlying design methodologies of intelligent instrumentation, Intelligent Instrumentation: Principles and Applications provides a comprehensive and authoritative resource on the scientific foundations from which to coordinate and advance the field. Employing a textbook-like language, this book translates methodologies to more than 80 numerical examples, and provides applications in 14 case studies for a complete and working understanding of the material. Beginn...

  19. The introduction to GNOS instrument for FY-3 satellite

    Science.gov (United States)

    Du, Qifei

    2016-07-01

    Global Navigation Satellite System (GNSS) Radio occultation (RO) has become a major atmospheric and ionospheric remote sensing technique and been widely used for numerical weather prediction and global climate monitoring applications. The first GNSS Occultation Sounder (GNOS) developed and manufactured by National Space Science Center (NSSC), Chinese Academy of Science is a RO payload, which has been onboard Fengyun-3 C (FY-3C) satellite and been launched on September 23, 2013. FY-3 series satellites are the Chinese second generation polar-orbiting meteorological satellites with sun-synchronous orbits. During RO events, the GNOS instruments measure the phase delay caused by the Earth's atmospheric and ionospheric refraction between the GNSS satellites and FY-3 satellites, as the relative position between the GNSS satellites and the FY-3 satellites varying, vertical profiles of RO observations (i.e. phase and amplitude) will be obtained, which can be used to derived the atmospheric and ionospheric physical properties such as press, temperature, humidity and ionospheric electron density. In my presentation, we present the characteristics of GNOS instruments for FY-3 series satellites and the result by the instrument in orbit. Firstly, we present the characteristics of GNOS instrument for FY-3C satellite and its precision of atmosphere occultation data. Additionally, we introduce the characteristics of GNOS instrument for FY-3D satellite which will be launched in 2016. Finally, we show the next generation GNOS instrument and its characteristics for the following FY-3 satellites.

  20. Luminescence techniques: Instrumentation and methods

    DEFF Research Database (Denmark)

    Bøtter-Jensen, L.

    1997-01-01

    This paper describes techniques, instruments and methods used in luminescence dating and environmental dosimetry in many laboratories around the world. These techniques are based on two phenomena - thermally stimulated luminescence and optically stimulated luminescence. The most commonly used...... luminescence stimulation and detection techniques are reviewed and information is given on recent developments in instrument design and on the stale of the art in luminescence measurements and analysis. (C) 1998 Elsevier Science Ltd. All rights reserved....

  1. The MEPHISTO scientific space instrument

    Science.gov (United States)

    Cambon, G.; Cadet, G.; Favier, J. J.

    1987-02-01

    A furnace to study solidification on Earth and in orbit was developed. Design and performances in Bridgman-Stockbarger directional solidification are given in terms of thermal gradient achievables, thermal gradient stability, back-melting mastering, and quenching capabilities. In-situ measurements in real time of fundamental parameters for the solidification process control, associated with a possible interactivity between the principal investigator on ground and the instrument in orbit, are among the main features of the space instrument.

  2. Notes on instrumentation and control

    CERN Document Server

    Roy, G J

    2013-01-01

    Notes on Instrumentation and Control presents topics on pressure (i.e., U-tube manometers and elastic type gauges), temperature (i.e. glass thermometer, bi-metallic strip thermometer, filled system thermometer, vapor pressure thermometer), level, and flow measuring devices. The book describes other miscellaneous instruments, signal transmitting devices, supply and control systems, and monitoring systems. The theory of automatic control and semi-conductor devices are also considered. Marine engineers will find the book useful.

  3. Accounting Issues On Financial Instruments

    OpenAIRE

    Shiba, Kenji

    1995-01-01

    Financial Instruments should be measured at the present value by using the current effective yield as the discount rate by reference to the current market interest rate and the risk premium. The fair value or the current market price are surrogates of the present value. The present value determined by using the historical effective yield as the discount rate is allowed under limited circumstances. However, the historical cost is not allowed as a measurement basis of financial instruments. Thi...

  4. Sulfur Dioxide Analyzer Instrument Handbook

    Energy Technology Data Exchange (ETDEWEB)

    Springston, Stephen R [Brookhaven National Lab. (BNL), Upton, NY (United States)

    2016-05-01

    The Sulfur Dioxide Analyzer measures sulfur dioxide based on absorbance of UV light at one wavelength by SO2 molecules which then decay to a lower energy state by emitting UV light at a longer wavelength. Specifically, SO2 + hυ1 →SO2 *→SO2 + hυ2 The emitted light is proportional to the concentration of SO2 in the optical cell. External communication with the analyzer is available through an Ethernet port configured through the instrument network of the AOS systems. The Model 43i-TLE is part of the i-series of Thermo Scientific instruments. The i-series instruments are designed to interface with external computers through the proprietary Thermo Scientific iPort Software. However, this software is somewhat cumbersome and inflexible. Brookhaven National Laboratory (BNL) has written an interface program in National Instruments LabView that both controls the Model 43i-TLE Analyzer AND queries the unit for all measurement and housekeeping data. The LabView vi (the software program written by BNL) ingests all raw data from the instrument and outputs raw data files in a uniform data format similar to other instruments in the AOS and described more fully in Section 6.0 below.

  5. CIWS-FW: a Customizable InstrumentWorkstation Software Framework for instrument-independent data handling

    CERN Document Server

    Conforti, Vito; Bulgarelli, Andrea; Gianotti, Fulvio; Franceschi, Enrico; Nicastro, Luciano; Zoli, Andrea; Dadina, Mauro; Smart, Ricky; Morbidelli, Roberto; Frailis, Marco; Sartor, Stefano; Zacchei, Andrea; Lodi, Marcello; Cirami, Roberto; Pasian, Fabio

    2014-01-01

    The CIWS-FW is aimed at providing a common and standard solution for the storage, processing and quick look at the data acquired from scientific instruments for astrophysics. The target system is the instrument workstation either in the context of the Electrical Ground Support Equipment for space-borne experiments, or in the context of the data acquisition system for instrumentation. The CIWS-FW core includes software developed by team members for previous experiments and provides new components and tools that improve the software reusability, configurability and extensibility attributes. The CIWS-FW mainly consists of two packages: the data processing system and the data access system. The former provides the software components and libraries to support the data acquisition, transformation, display and storage in near real time of either a data packet stream and/or a sequence of data files generated by the instrument. The latter is a meta-data and data management system, providing a reusable solution for the...

  6. A near-infrared SETI experiment: instrument overview

    CERN Document Server

    Wright, Shelley A; Treffers, Richard R; Maire, Jerome; Marcy, Geoffrey W; Stone, Remington P S; Drake, Frank; Meyer, Elliot; Dorval, Patrick; Siemion, Andrew

    2014-01-01

    We are designing and constructing a new SETI (Search for Extraterrestrial Intelligence) instrument to search for direct evidence of interstellar communications via pulsed laser signals at near-infrared wavelengths. The new instrument design builds upon our past optical SETI experiences, and is the first step toward a new, more versatile and sophisticated generation of very fast optical and near-infrared pulse search devices. We present our instrumental design by giving an overview of the opto-mechanical design, detector selection and characterization, signal processing, and integration procedure. This project makes use of near-infrared (950-1650 nm) discrete amplification Avalanche Photodiodes (APD) that have greater than 1 GHz bandwidths with low noise characteristics and moderate gain (~10^4). We have investigated the use of single versus multiple detectors in our instrument (see Maire et al., this conference), and have optimized the system to have both high sensitivity and low false coincidence rates. Our ...

  7. Prospects for improved instrumentation on future solar space missions

    Science.gov (United States)

    Lemaire, P.

    1993-06-01

    The status of space based instrumentation at the time of the Soho launch is summarized, the areas where improvements are foreseeable are examined, and an overview of the gains that can be achieved is presented. Special attention is paid to identifying intrinsic limitations related to classical mountings in the UV and EUV range. Some mountings are discussed, with their limitations, in the context of missions already proposed. The present capabilities of solar physics instrumentation in space are on the 1 arcsec angular resolution domain, with a resolving power near 30,000, and the ability to fit spectral line profiles and to establish line of sight velocities down to 1 km/s. Few rocket instruments have yet crossed the 1 arcsec angular resolution threshold. The goal of the next generation of solar instrumentation in space is to achieve 0.1 arcsec angular resolution whilst retaining the same spectral resolution and improving the temporal resolution.

  8. Instant Generation

    Science.gov (United States)

    Loveland, Elaina

    2017-01-01

    Generation Z students (born between 1995-2010) have replaced millennials on college campuses. Generation Z students are entrepreneurial, desire practical skills with their education, and are concerned about the cost of college. This article presents what need to be known about this new generation of students.

  9. SPHERE: A Planet Finder Instrument for the VLT

    NARCIS (Netherlands)

    Beuzit, J.L.; Feldt, M.; Dohlen, K.; Mouillet, D.; Puget, P.; Antichi, J.; Baudoz, P.; Boccaletti, A.; Carbillet, M.; Charton, J.; Claudi, R.; Fusco, T.; Gratton, R.; Henning, T.; Hubin, N.; Joos, F.; Kasper, M.; Langlois, M.; Moutou, C.; Pragt, J.; Rabou, P.; Saisse, M.; Schmid, H.M.; Turatto, M.; Udry, S.; Vakili, F.; Waters, R.; Wildi, F.

    2007-01-01

    Direct detection and spectral characterization of extra-solar planets is one of the most exciting but also one of the most challenging areas in modern astronomy. For its second generation instrumentation on the VLT, ESO has supported two phase A studies for a so-called Planet Finder dedicated instru

  10. An Instrument for the Systematic Study of Advertising Creative Appeals.

    Science.gov (United States)

    Secrist, Mark

    Although the generation of creative appeals is the heart and soul of advertising, there has been little methodology developed for the classification and study of the appeals themselves. The paper recommends the use of an instrument which provides a technique that will enable the advertising researcher to develop descriptive studies of ad appeals.…

  11. The estimation method of GPS instrumental biases

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    A model of estimating the global positioning system (GPS) instrumental biases and the methods to calculate the relative instrumental biases of satellite and receiver are presented. The calculated results of GPS instrumental biases, the relative instrumental biases of satellite and receiver, and total electron content (TEC) are also shown. Finally, the stability of GPS instrumental biases as well as that of satellite and receiver instrumental biases are evaluated, indicating that they are very stable during a period of two months and a half.

  12. VLT Instruments Pipeline System Overview

    Science.gov (United States)

    Jung, Y.; Ballester, P.; Banse, K.; Hummel, W.; Izzo, C.; McKay, D. J.; Kiesgen, M.; Lundin, L. K.; Modigliani, A.; Palsa, R. M.; Sabet, C.

    2004-07-01

    Since the beginning of the VLT operations in 1998, substantial effort has been put in the development of automatic data reduction tools for the VLT instruments. A VLT instrument pipeline is a complex system that has to be able to identify and classify each produced FITS file, optionally retrieve calibration files from a database, use an image processing software to reduce the data, compute and log quality control parameters, produce FITS images or tables with the correct headers, optionally display them in the control room and send them to the archive. Each instrument has its own dedicated pipeline, based on a common infrastructure and installed with the VLT Data Flow System (DFS). With the increase in the number and the complexity of supported instruments and in the rate of produced data, these pipelines are becoming vital for both the VLT operations and the users, and request more and more resources for development and maintenance. This paper describes the different pipeline tasks with some real examples. It also explains how the development process has been improved to both decrease its cost and increase the pipelines quality using the lessons learned from the first instruments pipelines development.

  13. Calibration of shaft alignment instruments

    Science.gov (United States)

    Hemming, Bjorn

    1998-09-01

    Correct shaft alignment is vital for most rotating machines. Several shaft alignment instruments, ranging form dial indicator based to laser based, are commercially available. At VTT Manufacturing Technology a device for calibration of shaft alignment instruments was developed during 1997. A feature of the developed device is the similarity to the typical use of shaft alignment instruments i.e. the rotation of two shafts during the calibration. The benefit of the rotation is that all errors of the shaft alignment instrument, for example the deformations of the suspension bars, are included. However, the rotation increases significantly the uncertainty of calibration because of errors in the suspension of the shafts in the developed device for calibration of shaft alignment instruments. Without rotation the uncertainty of calibration is 0.001 mm for the parallel offset scale and 0,003 mm/m for the angular scale. With rotation the uncertainty of calibration is 0.002 mm for the scale and 0.004 mm/m for the angular scale.

  14. Solar Energy Research Center Instrumentation Facility

    Energy Technology Data Exchange (ETDEWEB)

    Meyer, Thomas, J.; Papanikolas, John, P.

    2011-11-11

    SOLAR ENERGY RESEARCH CENTER INSTRUMENTATION FACILITY The mission of the Solar Energy Research Center (UNC SERC) at the University of North Carolina at Chapel Hill (UNC-CH) is to establish a world leading effort in solar fuels research and to develop the materials and methods needed to fabricate the next generation of solar energy devices. We are addressing the fundamental issues that will drive new strategies for solar energy conversion and the engineering challenges that must be met in order to convert discoveries made in the laboratory into commercially available devices. The development of a photoelectrosynthesis cell (PEC) for solar fuels production faces daunting requirements: (1) Absorb a large fraction of sunlight; (2) Carry out artificial photosynthesis which involves multiple complex reaction steps; (3) Avoid competitive and deleterious side and reverse reactions; (4) Perform 13 million catalytic cycles per year with minimal degradation; (5) Use non-toxic materials; (6) Cost-effectiveness. PEC efficiency is directly determined by the kinetics of each reaction step. The UNC SERC is addressing this challenge by taking a broad interdisciplinary approach in a highly collaborative setting, drawing on expertise across a broad range of disciplines in chemistry, physics and materials science. By taking a systematic approach toward a fundamental understanding of the mechanism of each step, we will be able to gain unique insight and optimize PEC design. Access to cutting-edge spectroscopic tools is critical to this research effort. We have built professionally-staffed facilities equipped with the state-of the-art instrumentation funded by this award. The combination of staff, facilities, and instrumentation specifically tailored for solar fuels research establishes the UNC Solar Energy Research Center Instrumentation Facility as a unique, world-class capability. This congressionally directed project funded the development of two user facilities: TASK 1: SOLAR

  15. Composite Rolled Magnetometer and Instrument Boom Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Magnetometers are the most common instrument flown on NASA science missions and interference from onboard electronics requires that these instruments be deployed...

  16. Introduction to instrumentation and measurements

    CERN Document Server

    Northrop, Robert B

    2014-01-01

    Weighing in on the growth of innovative technologies, the adoption of new standards, and the lack of educational development as it relates to current and emerging applications, the third edition of Introduction to Instrumentation and Measurements uses the authors' 40 years of teaching experience to expound on the theory, science, and art of modern instrumentation and measurements (I&M). What's New in This Edition: This edition includes material on modern integrated circuit (IC) and photonic sensors, micro-electro-mechanical (MEM) and nano-electro-mechanical (NEM) sensors, chemical and radiation sensors, signal conditioning, noise, data interfaces, and basic digital signal processing (DSP), and upgrades every chapter with the latest advancements. It contains new material on the designs of micro-electro-mechanical (MEMS) sensors, adds two new chapters on wireless instrumentation and microsensors, and incorporates extensive biomedical examples and problems. Containing 13 chapters, this third edition: Describ...

  17. [Portable instrument for arteriosclerosis assessment].

    Science.gov (United States)

    Cao, Shuai; Chen, Xiang

    2014-01-01

    A portable instrument for arteriosclerosis assessment containing sensor module, acquisition board and embedded module was developed for home care in this paper. The sensor module consists of one ECG module and three pulse wave extraction modules, synchronously acquiring human ECG and pulse wave signal of carotid, radial, and dorsal, respectively. The acquisition board converts the sensor module's analog output signals into digital signals and transmits them to the embedded module. The embedded module realizes the functions including signal display, storage and the calculation and output of pulse wave velocity. The structure of the proposed portable instrument is simple, easy to use, and easy to expand. Small size, low cost, and low power consumption are also the advantages of this device. Experimental results demonstrated that the proposed portable instrument for arteriosclerosis assessment has high accuracy, good repeatability and can assess the degree of atherosclerosis appropriately.

  18. RHEED streaks and instrument response

    Energy Technology Data Exchange (ETDEWEB)

    Van Hove, J.M.; Pukite, P.; Cohen, P.I.; Lent, C.S.

    1983-04-01

    Reflection high-energy electron diffraction (RHEED) is so sensitive to surface morphology that it is difficult to separate the roles of instrument response and surface imperfection in the diffraction. To address this difficulty we have used MBE grown GaAs(001) as a test surface to study the angular dimensions of the diffracted beams. This is important if RHEED is to be useful as a quantitive probe of surface structure for in situ studies of crystal growth. The limitations placed by instrumental uncertainties on the maximum resolvable distance are estimated. Measurements of the angular length of the RHEED steaks versus angle of incidence are presented which show the changes expected from a combination of a uniformly broadened reciprocal lattice rod and an instrument limit due to angular uncertainties. Resolvable distances are obtained with RHEED that are much larger than those typically obtained with low-energy electron diffraction.

  19. Generation and analysis of chemical compound libraries

    Energy Technology Data Exchange (ETDEWEB)

    Gregoire, John M.; Jin, Jian; Kan, Kevin S.; Marcin, Martin R.; Mitrovic, Slobodan; Newhouse, Paul F.; Suram, Santosh K.; Xiang, Chengxiang; Zhou, Lan

    2017-10-03

    Various samples are generated on a substrate. The samples each includes or consists of one or more analytes. In some instances, the samples are generated through the use of gels or through vapor deposition techniques. The samples are used in an instrument for screening large numbers of analytes by locating the samples between a working electrode and a counter electrode assembly. The instrument also includes one or more light sources for illuminating each of the samples. The instrument is configured to measure the photocurrent formed through a sample as a result of the illumination of the sample.

  20. Instrumentation, interdisciplinarity and innovation; Instrumentation interdisciplinarite et innovation

    Energy Technology Data Exchange (ETDEWEB)

    Placko, D. [Ecole Nationale Superieure de Cachan, 94 (France); Santander, E.

    1999-07-01

    This document provides the papers presented at C2I'98, the interdisciplinary colloquium in instrumentation held November 18-19, 1998 in Cachan, France. 10 papers are interesting for the ETDE database and are analyzed separately. (O.M.)

  1. Violencia instrumental y sentimientos morales = Instrumental aggression and moral feelings

    OpenAIRE

    Velasco Gómez, Mª José

    2011-01-01

    El objetivo de esta investigación es estudiar la relación entre la agresión instrumental y la existencia de sentimientos morales de los adolescentes en el primer ciclo de Educación Secundaria Obligatoria (E.S.O.). El análisis de la violencia desde un

  2. Wind Generators

    Science.gov (United States)

    1989-01-01

    When Enerpro, Inc. president, Frank J. Bourbeau, attempted to file a patent on a system for synchronizing a wind generator to the electric utility grid, he discovered Marshall Space Flight Center's Frank Nola's power factor controller. Bourbeau advanced the technology and received a NASA license and a patent for his Auto Synchronous Controller (ASC). The ASC reduces generator "inrush current," which occurs when large generators are abruptly brought on line. It controls voltage so the generator is smoothly connected to the utility grid when it reaches its synchronous speed, protecting the components from inrush current damage. Generator efficiency is also increased in light winds by applying lower than rated voltage. Wind energy is utilized to drive turbines to generate electricity for utility companies.

  3. The COMPTEL instrumental line background

    OpenAIRE

    Weidenspointner, G.; Varendorff, M.; Oberlack, U.; Morris, D.; Plueschke, S.; Diehl, R.; Kappadath, S. C.; McConnell, M; Ryan, J.; Schoenfelder, V.; Steinle, H.

    2000-01-01

    The instrumental line background of the Compton telescope COMPTEL onboard the Compton Gamma-Ray Observatory is due to the activation and/or decay of many isotopes. The major components of this background can be attributed to eight individual isotopes, namely 2D, 22Na, 24Na, 28Al, 40K, 52Mn, 57Ni, and 208Tl. The identification of instrumental lines with specific isotopes is based on the line energies as well as on the variation of the event rate with time, cosmic-ray intensity, and deposited r...

  4. An introduction to biomedical instrumentation

    CERN Document Server

    Dewhurst, D J

    1976-01-01

    An Introduction to Biomedical Instrumentation presents a course of study and applications covering the basic principles of medical and biological instrumentation, as well as the typical features of its design and construction. The book aims to aid not only the cognitive domain of the readers, but also their psychomotor domain as well. Aside from the seminar topics provided, which are divided into 27 chapters, the book complements these topics with practical applications of the discussions. Figures and mathematical formulas are also given. Major topics discussed include the construction, handli

  5. Instrumentation for tropospheric aerosol characterization

    Energy Technology Data Exchange (ETDEWEB)

    Shi, Z.; Young, S.E.; Becker, C.H.; Coggiola, M.J. [SRI International, Menlo Park, CA (United States); Wollnik, H. [Giessen Univ. (Germany)

    1997-12-31

    A new instrument has been developed that determines the abundance, size distribution, and chemical composition of tropospheric and lower stratospheric aerosols with diameters down to 0.2 {mu}m. In addition to aerosol characterization, the instrument also monitors the chemical composition of the ambient gas. More than 25.000 aerosol particle mass spectra were recorded during the NASA-sponsored Subsonic Aircraft: Contrail and Cloud Effects Special Study (SUCCESS) field program using NASA`s DC-8 research aircraft. (author) 7 refs.

  6. Rainfall generation

    Science.gov (United States)

    Sharma, Ashish; Mehrotra, Raj

    This chapter presents an overview of methods for stochastic generation of rainfall at annual to subdaily time scales, at single- to multiple-point locations, and in a changing climatic regime. Stochastic rainfall generators are used to provide inputs for risk assessment of natural or engineering systems that can undergo failure under sustained (high or low) extremes. As a result, generation of rainfall has evolved to provide options that adequately represent such conditions, leading to sequences that exhibit low-frequency variability of a nature similar to the observed rainfall. The chapter consists of three key sections: the first two outlining approaches for rainfall generation using endogenous predictor variables and the third highlighting approaches for generation using exogenous predictors often simulated to represent future climatic conditions. The first section presents approaches for generation of annual and seasonal rainfall and daily rainfall, both at single-point locations and multiple sites, with an emphasis on alternatives that ensure appropriate representation of low-frequency variability in the generated rainfall sequences. The second section highlights advancements in the subdaily rainfall generation procedures including commonly used approaches for daily to subdaily rainfall generation. The final section (generation using exogenous predictors) presents a range of alternatives for stochastic downscaling of rainfall for climate change impact assessments of natural and engineering systems. We conclude the chapter by outlining some of the key challenges that remain to be addressed, especially in generation under climate change conditions, with an emphasis on the importance of incorporating uncertainty present in both measurements and models, in the rainfall sequences that are generated.

  7. Effect of Instrumentation Length and Instrumentation Systems: Hand Versus Rotary Files on Apical Crack Formation – An In vitro Study

    Science.gov (United States)

    Mahesh, MC; Bhandary, Shreetha

    2017-01-01

    Introduction Stresses generated during root canal instrumentation have been reported to cause apical cracks. The smaller, less pronounced defects like cracks can later propagate into vertical root fracture, when the tooth is subjected to repeated stresses from endodontic or restorative procedures. Aim This study evaluated occurrence of apical cracks with stainless steel hand files, rotary NiTi RaCe and K3 files at two different instrumentation lengths. Materials and Methods In the present in vitro study, 60 mandibular premolars were mounted in resin blocks with simulated periodontal ligament. Apical 3 mm of the root surfaces were exposed and stained using India ink. Preoperative images of root apices were obtained at 100x using stereomicroscope. The teeth were divided into six groups of 10 each. First two groups were instrumented with stainless steel files, next two groups with rotary NiTi RaCe files and the last two groups with rotary NiTi K3 files. The instrumentation was carried out till the apical foramen (Working Length-WL) and 1 mm short of the apical foramen (WL-1) with each file system. After root canal instrumentation, postoperative images of root apices were obtained. Preoperative and postoperative images were compared and the occurrence of cracks was recorded. Descriptive statistical analysis and Chi-square tests were used to analyze the results. Results Apical root cracks were seen in 30%, 35% and 20% of teeth instrumented with K-files, RaCe files and K3 files respectively. There was no statistical significance among three instrumentation systems in the formation of apical cracks (p=0.563). Apical cracks were seen in 40% and 20% of teeth instrumented with K-files; 60% and 10% of teeth with RaCe files and 40% and 0% of teeth with K3 files at WL and WL-1 respectively. For groups instrumented with hand files there was no statistical significance in number of cracks at WL and WL-1 (p=0.628). But for teeth instrumented with RaCe files and K3 files

  8. Vacuum facility for calibration of space instrumentation in cleanroom

    Science.gov (United States)

    Pelizzo, M. G.; Zuppella, P.; Polito, V.; Corso, A. J.; Zuccon, S.; Nicolosi, P.

    2012-09-01

    Calibration of optical systems is a fundamental step in the development of a space instrumentation. We have built a new cleanroom environment, divided in different areas characterized by a different level of contamination control. A vacuum chamber (a tube of 80 cm diameter, and 2 m length), able to accommodate optical components as well as whole instruments, is interfaced with a ISO6 area, allowing the handling of the instrumentation in a clean environment. The vacuum system is dimensioned to reach 10-7 mbar pressure in the chamber. Inside, a two axis platform allows the rotation of the instrument with respect to the incident collimating beam, in order to test the response of the instrument to light coming from different points of the field of view. A monochromator coupled with different sources provides radiation in the 40-350 nm spectral range, while a parabolic mirror is used as a collimator. As source, different spectral lamps can be used to generate emission lines, while a Xe lamp can be used to have continuum spectrum. An high brilliant hollow cathode lamp has been fabricated by the group to generate extreme ultraviolet radiation. Different calibrated detectors and other completing optical components are available.

  9. Instrumentation

    CERN Document Server

    Engelfried, J

    2006-01-01

    In this course, given at the school in 3 parts of 75 minutes each, we will discuss the physics of particle detection, the basic designs and working principles of detectors, and, as an example with more details, some detectors for particle identification.

  10. Instrumentation of dynamic gas pulse loading system

    Energy Technology Data Exchange (ETDEWEB)

    Mohaupt, H.

    1992-04-14

    The overall goal of this work is to further develop and field test a system of stimulating oil and gas wells, which increases the effective radius of the well bore so that more oil can flow into it, by recording pressure during the gas generation phase in real time so that fractures can be induced more predictably in the producing formation. Task 1: Complete the laboratory studies currently underway with the prototype model of the instrumentation currently being studied. Task 2: Perform field tests of the model in the Taft/Bakersfield area, utilizing operations closest to the engineers working on the project, and optimize the unit for various conditions encountered there. Task 3: Perform field test of the model in DGPL jobs which are scheduled in the mid-continent area, and optimize the unit for downhole conditions encountered there. Task 4: Analyze and summarize the results achieved during the complete test series, documenting the steps for usage of downhole instrumentation in the field, and compile data specifying use of the technology by others. Task 5: Prepare final report for DOE, and include also a report on the field tests completed. Describe and estimate the probability of the technology being commercialized and in what time span. The project has made substantial technical progress, though we are running about a month behind schedule. Expenditures are in line with the schedule. Increased widespread interest in the use of DGPL stimulation has kept us very busy. The computer modeling and test instrumentation developed under this program is already being applied to commercial operations.

  11. Instruments for Methane Gas Detection

    Directory of Open Access Journals (Sweden)

    Mr. Sibu Thomas

    2014-05-01

    Full Text Available This paper gives the explanation of different instruments for detecting methane gas in detail. This paper discusses their working principles. Methane gas detection is essentially required in the areas like in coal mines, power plant, Waste Water Treatment, Boiler Rooms etc. This paper also discusses their roles in various applications.

  12. Loyaliteitsprogramma's: zinvol CRM-instrument?

    NARCIS (Netherlands)

    Leenheer, J.

    2006-01-01

    Loyalty programs have been widely adopted by companies and their customers. A loyalty program is a relational marketing instrument that aims to enhance customer loyalty. However, skepticism exists about the implementation and effectiveness of loyalty programs. This paper studies for whom, when and h

  13. Literature Review of Multicultural Instrumentation

    Science.gov (United States)

    Sarraj, Huda; Carter, Stacy; Burley, Hansel

    2015-01-01

    Demographic changes at the national level emphasize a critical need for multicultural education to be included as part of undergraduate education. This critical review of the literature examines 10 multicultural instruments that are suitable for use in K-12 or higher education institutions. This is a novel literature review in that it is the first…

  14. Alternative instruments for the CAP?

    NARCIS (Netherlands)

    Silvis, H.J.; Rijswick, van C.W.J.; Bont, de C.J.A.M.

    2001-01-01

    With parallel negotiations taking place on enlargement of the EU and a new WTO agreement, EU's Common Agricultural Policy is facing further reforms. This report addresses the issue of whether any alternatives can be found for the instruments of this policy, and looks at decoupled payments, a net inc

  15. Market-based Economic Instruments

    DEFF Research Database (Denmark)

    Klemmensen, Børge

    2007-01-01

    Grundkategorien her er markedet som den optimale allokeringsmekanisme for de belastninger, som de økonomiske instrumenter / miljøskatterne påfører. Det mest omfattende og spektakulære eksempel på markedet som allokatorer af skatter er EU's børs for forureningstilladelser, dvs reelt CO-2 beskatnin...

  16. Loyaliteitsprogramma's: zinvol CRM-instrument?

    NARCIS (Netherlands)

    Leenheer, J.

    2006-01-01

    Loyalty programs have been widely adopted by companies and their customers. A loyalty program is a relational marketing instrument that aims to enhance customer loyalty. However, skepticism exists about the implementation and effectiveness of loyalty programs. This paper studies for whom, when and

  17. Presentation of a new instrument

    DEFF Research Database (Denmark)

    Russell, M B; Rasmussen, B K; Brennum, J

    1992-01-01

    A new instrument, the Diagnostic Headache Diary, based on the operational diagnostic criteria of the International Headache Society (IHS), was tested in 61 migraine patients from a headache research clinic using the clinical diagnosis (IHS criteria) for comparison. All patients kept the diary for...

  18. Vacuum enhanced cutaneous biopsy instrument

    Science.gov (United States)

    Collins, Joseph

    2000-01-01

    A syringe-like disposable cutaneous biopsy instrument equipped with a tubular blade at its lower end, and designed so that a vacuum is created during use, said vacuum serving to retain undeformed a plug of tissue cut from a patient's skin.

  19. Instrumentation System Diagnoses a Thermocouple

    Science.gov (United States)

    Perotti, Jose; Santiago, Josephine; Mata, Carlos; Vokrot, Peter; Zavala, Carlos; Burns, Bradley

    2008-01-01

    An improved self-validating thermocouple (SVT) instrumentation system not only acquires readings from a thermocouple but is also capable of detecting deterioration and a variety of discrete faults in the thermocouple and its lead wires. Prime examples of detectable discrete faults and deterioration include open- and short-circuit conditions and debonding of the thermocouple junction from the object, the temperature of which one seeks to measure. Debonding is the most common cause of errors in thermocouple measurements, but most prior SVT instrumentation systems have not been capable of detecting debonding. The improved SVT instrumentation system includes power circuitry, a cold-junction compensator, signal-conditioning circuitry, pulse-width-modulation (PWM) thermocouple-excitation circuitry, an analog-to-digital converter (ADC), a digital data processor, and a universal serial bus (USB) interface. The system can operate in any of the following three modes: temperature measurement, thermocouple validation, and bonding/debonding detection. The software running in the processor includes components that implement statistical algorithms to evaluate the state of the thermocouple and the instrumentation system. When the power is first turned on, the user can elect to start a diagnosis/ monitoring sequence, in which the PWM is used to estimate the characteristic times corresponding to the correct configuration. The user also has the option of using previous diagnostic values, which are stored in an electrically erasable, programmable read-only memory so that they are available every time the power is turned on.

  20. Safety instrumented systems in vogelvlucht

    NARCIS (Netherlands)

    Logtenberg, M.T.; Bliek, E. van den

    2003-01-01

    In deze uitgave worden in vogelvlucht de achtergrond van "safety instrumented systems" (SIS) gegeven door in te gaan op: de historie van de procesbeveiliging; de positie en rol van een SIS in de procesbeveiliging; de principes en uitvoeringvormen van SIS; de eisen die aan dergelijke systemen gesteld

  1. Instrument sterilization in orthodontic offices.

    Science.gov (United States)

    Matlack, R E

    1979-07-01

    1. Three different quaternary ammonium compound solutions remained bactericidal against specific vegetative bacteria in three orthodontic offices over a ten day working period. However, no spore formers or viruses were tested. 2. Bacterial contaminants were cultured on pliers and scalers at the chair at least once in each of three orthodontic offices sampled twice a day for ten working days. 3. Sampled chairside instruments wiped with an alcohol sponge only, between patients, were contaminated an excessive 32.5% of the time, too frequently to be seriously considered for routine disinfection of pliers. 4. Chairside instruments, sampled regardless of other means of disinfection or sterilization used, were contaminated from 3.5 to 15% of the time. Therefore, storage and handling of orthodontic instruments must be evaluated and upgraded to prevent recontamination of previously sterilized instruments. 5. Staff personnel need courses in sterilization and disinfection procedures to prevent cross contamination from patient to patient and to protect themselves. These courses should be related specifically to orthodontic practice procedures.

  2. Psychology Needs Realism, Not Instrumentalism

    Science.gov (United States)

    Haig, Brian D.

    2005-01-01

    In this article, the author presents his comments on "Realism, Instrumentalism, and Scientific Symbiosis: Psychological Theory as a Search for Truth and the Discovery of Solutions" by John T. Cacioppo, Gun R. Semin and Gary G. Berntson. In the original article, the authors recommended the combined use of the philosophies of scientific realism and…

  3. Experimenting with Brass Musical Instruments.

    Science.gov (United States)

    LoPresto, Michael C.

    2003-01-01

    Describes experiments to address the properties of brass musical instruments that can be used to demonstrate sound in any level physics course. The experiments demonstrate in a quantitative fashion the effects of the mouthpiece and bell on the frequencies of sound waves and thus the musical pitches produced. (Author/NB)

  4. GIPP: Geophysical Instrument Pool Potsdam

    Directory of Open Access Journals (Sweden)

    Christian Haberland

    2016-04-01

    Full Text Available The Geophysical Instrument Pool Potsdam (GIPP consists of field instruments, sensors and equipment for temporary seismological studies (both controlled source and earthquake seismology as well as for magnetotelluric (electromagnetic experiments. These instruments are mainly mobile digital recorders, broadband seis­mometers and short period sensors, and they are used to reveal the subsurface structure and to investigate earth­quakes. Sensors for magnetotellurics include induction coil and fluxgate magnetometers and non-polarizing silver / silver-chloride electrodes. It is operated by the Helmholtz Centre Potsdam GFZ German Research Centre for Geosciences. The instru­ment facility is open to all academic applicants, both national and international. Instrument applications are evalu­ated and ranked by an external steering board. Currently, for seismological applications >850 geophysical recorders, >170 broadband seis­mo­meters and >1300 short period geophones are available (among others. Available for magnetotelluric experiments are > 50 real-time data-loggers, >150 induction coils, and >500 electrodes. User guidelines and data policy are in force and data archives are provided (standard exchange formats.

  5. An Instrument to Measure Anomia.

    Science.gov (United States)

    Moore, Allen B.

    1980-01-01

    Four hundred and eighty-six disadvantaged adults from North Carolina were the subjects in a study that factor-analyzed three instruments designed to measure anomia, yielding a 12-item unidimensional scale. (The refined combination scale is presented as of potential usefulness for research on the effects of educational intervention on anomia.) (LRA)

  6. Personal Computer Monitors Instrumentation Bus

    Science.gov (United States)

    Conroy, Bruce L.

    1994-01-01

    IBM-compatible personal computer used instead of logic analyzer or other special instrument to monitor IEEE-488 interface data bus that interconnects various pieces of laboratory equipment. Needed is short program for computer, commercial general-purpose interface bus circuit card, and adapter cable to link card to bus. Software available in Ada or Quick Basic language.

  7. Instruments to assess integrated care

    DEFF Research Database (Denmark)

    Lyngsø, Anne Marie; Godtfredsen, Nina Skavlan; Høst, Dorte;

    2014-01-01

    to measure the level of integration across health-care sectors and to assess and evaluate the organisational elements within the instruments identified. METHODS: An extensive, systematic literature review in PubMed, CINAHL, PsycINFO, Cochrane Library, Web of Science for the years 1980-2011. Selected...

  8. High-Resolution Instrumentation Radar.

    Science.gov (United States)

    1986-09-30

    30 September 1986 Los Angeles Air Force Station 13. NUMBER OF PAGES Los Angeles, Calif. 90009-2960 36 74. MONITORING AGENCY NAME & ADDRESS(If...TREE PLMUT ",-20 -CUTLIASS DumpER SED AN... TREE TRUNK, -0 - MERC BUMPER f - 40 H!-I -50 iI Fig. 7. High-Resolution Instrumentation Radar View of

  9. Instruments on large optical telescopes -- A case study

    CERN Document Server

    Kulkarni, S R

    2016-01-01

    In the distant past, telescopes were known, first and foremost, for the sizes of their apertures. Advances in technology (not merely those related to astronomical detectors) are now enabling astronomers to build extremely powerful instruments to the extent that instruments have now achieved importance comparable or even exceeding the usual importance accorded to the apertures of the telescopes. However, the cost of successive generations of instruments has risen at a rate far above that of the rate of inflation. Here, given the vast sums of money now being expended on optical telescopes and their instrumentation, I argue that astronomers must undertake "cost-benefit" analysis for future planning. I use the scientific output of the first two decades of the W. M. Keck Observatory as a laboratory for this purpose. I find, in the absence of upgrades, that the time to reach peak paper production for an instrument is about six years. The prime lifetime of instruments (sans upgrades), as measured by citations return...

  10. Position-Finding Instrument Built Around a Magnetometer

    Science.gov (United States)

    Ketchum, Eleanor

    2004-01-01

    A coarse-positioning instrument is built around a three-axis magnetometer. The magnetometer is of a type that is made of inexpensive hardware and is suitable for use aboard spacecraft orbiting no more than 1,000 km above the surface of the Earth. A data processor programmed with suitable software and equipped with a central processing unit, random-access memory, programmable read-only memory, and interface circuitry for communication with external equipment are added to the basic magnetometer to convert it into a coarse-positioning instrument. Although the instrument was conceived for use aboard spacecraft, it could be useful for navigation on Earth under some circumstances. A major feature of the proposed instrument is an ability to generate a coarse estimate of its position in real time (that is, without start-up delay). Algorithms needed to solve the position equations have been developed. These include algorithms to work around gaps in measurement data that arise from a singularity near the minimum in the magnetic field of the Earth. Some work has been done to develop a prototype of this instrument incorporating a standard three-axis flux-gate magnetometer and a Pentium P-5 (or equivalent) processor with a clock frequency of 120 MHz. Alternatively, the processor could be of the 486 class. A computer model of the instrument has been completed and tested.

  11. Generative Semantics

    Science.gov (United States)

    Bagha, Karim Nazari

    2011-01-01

    Generative semantics is (or perhaps was) a research program within linguistics, initiated by the work of George Lakoff, John R. Ross, Paul Postal and later McCawley. The approach developed out of transformational generative grammar in the mid 1960s, but stood largely in opposition to work by Noam Chomsky and his students. The nature and genesis of…

  12. Second harmonic generation imaging

    CERN Document Server

    2013-01-01

    Second-harmonic generation (SHG) microscopy has shown great promise for imaging live cells and tissues, with applications in basic science, medical research, and tissue engineering. Second Harmonic Generation Imaging offers a complete guide to this optical modality, from basic principles, instrumentation, methods, and image analysis to biomedical applications. The book features contributions by experts in second-harmonic imaging, including many pioneering researchers in the field. Written for researchers at all levels, it takes an in-depth look at the current state of the art and possibilities of SHG microscopy. Organized into three sections, the book: Provides an introduction to the physics of the process, step-by-step instructions on how to build an SHG microscope, and comparisons with related imaging techniques Gives an overview of the capabilities of SHG microscopy for imaging tissues and cells—including cell membranes, muscle, collagen in tissues, and microtubules in live cells—by summarizing experi...

  13. UAVSAR Instrument: Current Operations and Planned Upgrades

    Science.gov (United States)

    Lou, Yunling; Hensley, Scott; Chao, Roger; Chapin, Elaine; Heavy, Brandon; Jones, Cathleen; Miller, Timothy; Naftel, Chris; Fratello, David

    2011-01-01

    The Uninhabited Aerial Vehicle Synthetic Aperture Radar (UAVSAR) instrument is a pod-based Lband polarimetric synthetic aperture radar (SAR), specifically designed to acquire airborne repeat track SAR data for differential interferometric measurements. This instrument is currently installed on the NASA Gulfstream- III (G-III) aircraft with precision real-time Global Positioning System (GPS) and a sensor-controlled flight management system for precision repeat-pass data acquisitions. UAVSAR has conducted engineering and preliminary science data flights since October 2007 on the G-III. We are porting the radar to the Global Hawk Unmanned Airborne Vehicle (UAV) to enable long duration/long range data campaigns. We plan to install two radar pods (each with its own active array antenna) under the wings of the Global Hawk to enable the generation of precision topographic maps and single pass polarimetric-interferometry (SPI) providing vertical structure of ice and vegetation. Global Hawk's range of 8000 nm will enable regional surveys with far fewer sorties as well as measurements of remote locations without the need for long and complicated deployments. We are also developing P-band polarimetry and Ka-band single-pass interferometry capabilities on UAVSAR by replacing the radar antenna and front-end electronics to operate at these

  14. Inter-calibration and validation of observations from SAPHIR and ATMS instruments

    Science.gov (United States)

    Moradi, I.; Ferraro, R. R.

    2015-12-01

    We present the results of evaluating observations from microwave instruments aboard the Suomi National Polar-orbiting Partnership (NPP, ATMS instrument) and Megha-Tropiques (SAPHIR instrument) satellites. The study includes inter-comparison and inter-calibration of observations of similar channels from the two instruments, evaluation of the satellite data using high-quality radiosonde data from Atmospheric Radiation Measurement Program and GPS Radio Occultaion Observations from COSMIC mission, as well as geolocation error correction. The results of this study are valuable for generating climate data records from these instruments as well as for extending current climate data records from similar instruments such as AMSU-B and MHS to the ATMS and SAPHIR instruments. Reference: Moradi et al., Intercalibration and Validation of Observations From ATMS and SAPHIR Microwave Sounders. IEEE Transactions on Geoscience and Remote Sensing. 01/2015; DOI: 10.1109/TGRS.2015.2427165

  15. Concert Band Instrumentation: Realities and Remedies.

    Science.gov (United States)

    Rogers, George L.

    1991-01-01

    Suggests ways to solve problems resulting from imbalanced instrumentation in school concert bands. Identifies sources of imbalance. Encourages band directors to plan for correct instrumentation, to match students' characteristics and abilities to instruments, and to recruit students to play needed instruments. Discusses the benefits of balanced…

  16. The EH101 Electronic Instrument Systems

    Directory of Open Access Journals (Sweden)

    Kieth N. Atkin

    1990-04-01

    Full Text Available This paper describes the background to the introduction of an electronic instrument system on the Anglo-Italian EH101 helicopter. The demanded flexibility to accommodate the display needs of several roles leading logically to the adoption of full colour multi-purpose display surfaces and the drive to achieve maximum commonality between military and civil variants is discussed. The configurations arrived at for both variants are described together with the operating philosophy and display formats developed during an ongoing simulator program. The paper also deals with a detailed description of the hardware implementation of the EIS including the fully integrated systems architecture and details of the symbol generators (SGs, display units (DUs and display mode selectors (DMSs. Emphasis is placed on the robust integrity characteristics and reversionary switching philosophy of the system."

  17. Star Formation & Stellar Evolution: Future Surveys & Instrumentation

    CERN Document Server

    Evans, C J

    2015-01-01

    The next generation of multi-object spectrographs (MOS) will deliver comprehensive surveys of the Galaxy, Magellanic Clouds and nearby dwarfs. These will provide us with the vast samples, spanning the full extent of the Hertzsprung-Russell diagram, that are needed to explore the chemistry, history and dynamics of their host systems. Further ahead, the Extremely Large Telescopes (ELTs) will have sufficient sensitivity and angular resolution to extend stellar spectroscopy well beyond the Local Group, opening-up studies of the chemical evolution of galaxies across a broad range of galaxy types and environments. In this contribution I briefly reflect on current and future studies of stellar populations, and introduce plans for the MOSAIC instrument for the European ELT.

  18. Astrophotonics: a new era for astronomical instruments

    CERN Document Server

    Bland-Hawthorn, J

    2009-01-01

    Astrophotonics lies at the interface of astronomy and photonics. This burgeoning field -- now formally recognized by the optics community -- has emerged over the past decade in response to the increasing demands of astronomical instrumentation. Early successes include: (i) planar waveguides to combine signals from widely spaced telescopes in stellar interferometry; (ii) frequency combs for ultra-high precision spectroscopy to detect planets around nearby stars; (iii) ultra-broadband fibre Bragg gratings to suppress unwanted background; (iv) photonic lanterns that allow single-mode behaviour within a multimode fibre; (v) planar waveguides to miniaturize astronomical spectrographs; (vi) large mode area fibres to generate artificial stars in the upper atmosphere for adaptive optics correction; (vii) liquid crystal polymers in optical vortex coronographs and adaptive optics systems. Astrophotonics, a field that has already created new photonic capabilities, is now extending its reach down to the Rayleigh scatteri...

  19. Astrophotonics: a new era for astronomical instruments.

    Science.gov (United States)

    Bland-Hawthorn, Joss; Kern, Pierre

    2009-02-02

    Astrophotonics lies at the interface of astronomy and photonics. This burgeoning field has emerged over the past decade in response to the increasing demands of astronomical instrumentation. Early successes include: (i) planar waveguides to combine signals from widely spaced telescopes in stellar interferometry; (ii) frequency combs for ultra-high precision spectroscopy to detect planets around nearby stars; (iii) ultra-broadband fibre Bragg gratings to suppress unwanted background; (iv) photonic lanterns that allow single-mode behaviour within a multimode fibre; (v) planar waveguides to miniaturize astronomical spectrographs; (vi) large mode area fibres to generate artificial stars in the upper atmosphere for adaptive optics correction; (vii) liquid crystal polymers in optical vortex coronographs and adaptive optics systems. Astrophotonics, a field that has already created new photonic capabilities, is now extending its reach down to the Rayleigh scattering limit at ultraviolet wavelengths, and out to mid infrared wavelengths beyond 2500 nm.

  20. Instrumentation for the detection and characterization of exoplanets.

    Science.gov (United States)

    Pepe, Francesco; Ehrenreich, David; Meyer, Michael R

    2014-09-18

    In no other field of astrophysics has the impact of new instrumentation been as substantial as in the domain of exoplanets. Before 1995 our knowledge of exoplanets was mainly based on philosophical and theoretical considerations. The years that followed have been marked, instead, by surprising discoveries made possible by high-precision instruments. Over the past decade, the availability of new techniques has moved the focus of research from the detection to the characterization of exoplanets. Next-generation facilities will produce even more complementary data that will lead to a comprehensive view of exoplanet characteristics and, by comparison with theoretical models, to a better understanding of planet formation.

  1. Resent Progress in Research on Calibration Instrument for Radioactive Aerosol Monitor

    Institute of Scientific and Technical Information of China (English)

    CHEN; Xi-lin; CHEN; Yong-yong; WU; Chang-ping; XING; Yu; MENG; Jun; YANG; Qiao-ling

    2013-01-01

    Radioactive aerosol monitors are widely used in monitoring the radioactivity concentration of the artificial nuclides in gaseous effluents from the nuclear facilities.An on-developing calibration instrument for radioactive aerosol monitors consists of an α and β aerosol generating unit,aerosol transferring unit,measurement unit of radioactivity concentration of aerosol for instruments calibrated and the waste gas

  2. The Choice of Innovation Policy Instruments

    DEFF Research Database (Denmark)

    Borrás, Susana; Edquist, Charles

    The purpose of this article is to discuss the different types of instruments of innovation policy, to examine how governments and public agencies in different countries and different times have used these instruments differently, to explore the political nature of instrument choice and design (and....... These mixes are often called “policy mix”. The problem-oriented nature of the design of instrument mixes is what makes innovation policy instruments ‘systemic’....

  3. ACRF Instrumentation Status and Information April 2009

    Energy Technology Data Exchange (ETDEWEB)

    Voyles, JW

    2009-05-07

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following five sections: (1) new instrumentation in the process of being acquired and deployed, (2) field campaigns, (3) existing instrumentation and progress on improvements or upgrades, (4) proposed future instrumentation, and (5) Small Business Innovation Research instrument development.

  4. ACRF Instrumentation Status and Information May 2009

    Energy Technology Data Exchange (ETDEWEB)

    JW Voyles

    2009-05-01

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following five sections: (1) new instrumentation in the process of being acquired and deployed, (2) field campaigns, (3) existing instrumentation and progress on improvements or upgrades, (4) proposed future instrumentation, and (5) Small Business Innovation Research instrument development.

  5. ACRF Instrumentation Status and Information July 2009

    Energy Technology Data Exchange (ETDEWEB)

    JW Voyles

    2009-08-13

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following five sections: (1) new instrumentation in the process of being acquired and deployed, (2) field campaigns, (3) existing instrumentation and progress on improvements or upgrades, (4) proposed future instrumentation, and (5) Small Business Innovation Research instrument development.

  6. ACRF Instrumentation Status and Information - June 2009

    Energy Technology Data Exchange (ETDEWEB)

    JW Voyles

    2009-06-01

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following five sections: (1) new instrumentation in the process of being acquired and deployed, (2) field campaigns, (3) existing instrumentation and progress on improvements or upgrades, (4) proposed future instrumentation, and (5) Small Business Innovation Research instrument development.

  7. ACRF Instrumentation Status and Information September 2009

    Energy Technology Data Exchange (ETDEWEB)

    JW Voyles

    2009-10-01

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following five sections: (1) new instrumentation in the process of being acquired and deployed, (2) field campaigns, (3) existing instrumentation and progress on improvements or upgrades, (4) proposed future instrumentation, and (5) Small Business Innovation Research instrument development.

  8. ACRF Instrumentation Status and Information August 2009

    Energy Technology Data Exchange (ETDEWEB)

    JW Voyles

    2009-09-09

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following five sections: (1) new instrumentation in the process of being acquired and deployed, (2) field campaigns, (3) existing instrumentation and progress on improvements or upgrades, (4) proposed future instrumentation, and (5) Small Business Innovation Research instrument development.

  9. Report Generator

    OpenAIRE

    2016-01-01

    Download data from HP Quality Center using of OTA Client. Implementation must be scalable to all projects under test. That is, it will be possible to generate automatically test reports at least for 2010, Modulaser and Gen2 (FW or SW). Report Generator is a software implemented in VBA that allows get data from HP Quality Center for export it (either tables, charts or text) to a document in Word format. Report Generator es un Software implementado en VBA que permite extraer datos de HP Q...

  10. Software Security Requirements Gathering Instrument

    Directory of Open Access Journals (Sweden)

    Smriti Jain

    2011-08-01

    Full Text Available Security breaches are largely caused by the vulnerable software. Since individuals and organizations mostly depend on softwares, it is important to produce in secured manner. The first step towards producing secured software is through gathering security requirements. This paper describes Software Security Requirements Gathering Instrument (SSRGI that helps gather security requirements from the various stakeholders. This will guide the developers to gather security requirements along with the functional requirements and further incorporate security during other phases of software development. We subsequently present case studies that describe the integration of the SSRGI instrument with Software Requirements Specification (SRS document as specified in standard IEEE 830-1998. Proposed SSRGI will support the software developers in gathering security requirements in detail during requirements gathering phase.

  11. Surface Meteorological Instrumentation for BOBMEX

    Indian Academy of Sciences (India)

    G S Bhat; S Ameenulla

    2000-06-01

    Although India has a long experience in ship-borne experiments and oceanographic instrumentation, the atmospheric component has not received much attention in the past. In this paper, the basis of the atmospheric instrumentation system assembled for use on board ORV Sagar Kanya for the BOBMEX- Pilot experiment is described along with some representative results. Wherever possible, Woods Hole's IMET recommendations for meteorological sensors for applications in the marine environment have been followed to keep our measurements in par with international standards. The sensors were tested during the BOBMEX-Pilot experiment and all sensors worked well. Velocity, humidity and temperature data have been successfully collected using fast sensors. It is shown that the component due to the ship's pitching motion can be removed from the measured vertical velocity by making use of an accelerometer. This makes it possible to calculate the surface fluxes by direct methods.

  12. Instrument safety in explosive atmospheres.

    Science.gov (United States)

    Bossert, J A

    1975-01-01

    The current "Energy Crisis" has dramatically increased our potential need for coal, the worlds most abundant fossil fuel. This will probably lead to a greater use of automation and instrumentation in the coal mining industry. The presence of methane in coal mines and in the coal itself plus the presence of coal dust, both of which can form an explosive atmosphere in air, means that the possibility of a gas or coal dust ignition must be considered when designing, purchasing and installing new equipment in this industry. In addition, many metallurgical processes involve the use of potentially explosive substances against which similar safety precautions must be taken. This paper outlines the various methods of protection currently in use and proposed for electrical instruments in explosive atmospheres, with particular emphasis on the work of the International Electrotechnical Commission.

  13. Untertageexploration – Instrumente und Methodenentwicklung

    OpenAIRE

    Rüdiger Giese; Jochem Kück

    2014-01-01

    Borehole measurements or downhole logging is a powerful method to in-situ gain quasi-continuous profiles of physical, chemical and structural rock parameters with high depth accuracy. It is widely used in both academic research and commercial exploration for oil and gas, mining industry, geothermal and water engineering. The GFZ section Scientific Drilling facilitates logging in two ways, first through service and applying a set of downhole instruments and second through developing n...

  14. Measuring instruments of corporate reputation

    OpenAIRE

    Damir Grgić

    2008-01-01

    The subject of this paper is focused on the instruments for the measurement of corporate reputation. Recent research of the elements which influence the success of a company shows a growing interest in intangible values. Corporate reputation itself has been identified as one of the key intangible assets which create the company’s added value. Understanding of the importance of corporate reputation has been determined as a significant component of the company’s competitiveness, that is, of its...

  15. Virtual instrumentation: Introduction of virtual

    OpenAIRE

    Ödlund, Erika

    2007-01-01

    The Large Hadron Collider (LHC) is the next large particle accelerator developed at CERN, constructed to enable studies of particles. The acceleration of the particles is carried out using magnets operating at about 1.9 K, a temperature achieved by regulating flow of superfluid helium. For economical reasons, control of the helium flow is based on feedback of virtual flow meter (VFT) estimates instead of real instrumentation. The main purpose of this work is to develop a virtual flow meter wi...

  16. High resolution tomographic instrument development

    Energy Technology Data Exchange (ETDEWEB)

    1992-08-01

    Our recent work has concentrated on the development of high-resolution PET instrumentation reflecting in part the growing importance of PET in nuclear medicine imaging. We have developed a number of positron imaging instruments and have the distinction that every instrument has been placed in operation and has had an extensive history of application for basic research and clinical study. The present program is a logical continuation of these earlier successes. PCR-I, a single ring positron tomograph was the first demonstration of analog coding using BGO. It employed 4 mm detectors and is currently being used for a wide range of biological studies. These are of immense importance in guiding the direction for future instruments. In particular, PCR-II, a volume sensitive positron tomograph with 3 mm spatial resolution has benefited greatly from the studies using PCR-I. PCR-II is currently in the final stages of assembly and testing and will shortly be placed in operation for imaging phantoms, animals and ultimately humans. Perhaps the most important finding resulting from our previous study is that resolution and sensitivity must be carefully balanced to achieve a practical high resolution system. PCR-II has been designed to have the detection characteristics required to achieve 3 mm resolution in human brain under practical imaging situations. The development of algorithms by the group headed by Dr. Chesler is based on a long history of prior study including his joint work with Drs. Pelc and Reiderer and Stearns. This body of expertise will be applied to the processing of data from PCR-II when it becomes operational.

  17. High resolution tomographic instrument development

    Energy Technology Data Exchange (ETDEWEB)

    1992-01-01

    Our recent work has concentrated on the development of high-resolution PET instrumentation reflecting in part the growing importance of PET in nuclear medicine imaging. We have developed a number of positron imaging instruments and have the distinction that every instrument has been placed in operation and has had an extensive history of application for basic research and clinical study. The present program is a logical continuation of these earlier successes. PCR-I, a single ring positron tomograph was the first demonstration of analog coding using BGO. It employed 4 mm detectors and is currently being used for a wide range of biological studies. These are of immense importance in guiding the direction for future instruments. In particular, PCR-II, a volume sensitive positron tomograph with 3 mm spatial resolution has benefited greatly from the studies using PCR-I. PCR-II is currently in the final stages of assembly and testing and will shortly be placed in operation for imaging phantoms, animals and ultimately humans. Perhaps the most important finding resulting from our previous study is that resolution and sensitivity must be carefully balanced to achieve a practical high resolution system. PCR-II has been designed to have the detection characteristics required to achieve 3 mm resolution in human brain under practical imaging situations. The development of algorithms by the group headed by Dr. Chesler is based on a long history of prior study including his joint work with Drs. Pelc and Reiderer and Stearns. This body of expertise will be applied to the processing of data from PCR-II when it becomes operational.

  18. Software Security Requirements Gathering Instrument

    OpenAIRE

    2011-01-01

    Security breaches are largely caused by the vulnerable software. Since individuals and organizations mostly depend on softwares, it is important to produce in secured manner. The first step towards producing secured software is through gathering security requirements. This paper describes Software Security Requirements Gathering Instrument (SSRGI) that helps gather security requirements from the various stakeholders. This will guide the developers to gather security requirements along with th...

  19. Personality, Intelligence And Music Instrument

    OpenAIRE

    Mihajlovski, Zoran

    2013-01-01

    An empirical study examining differences in personality traits and general intellectual ability of academic musicians was conducted on Macedonian sample of musicians, consisted of four different groups of instrumentalists, taken from four instrumental sections, respectively: a) piano (55); strings: violin, viola, cello, double bass (103); woodwind: flute, oboe, clarinet, bassoon (72); brass: trumpet, trombone, French horn, saxophone (58). Sample includes three age-based groups of musicians: m...

  20. Intelligent sensing, instrumentation and measurements

    CERN Document Server

    Mukhopadhyay, Subhas Chandra

    2013-01-01

      “Intelligent Sensing, Instrumentation and Measurements” addresses issues towards the development of sensor nodes for wireless Sensor Networks. The fundamentals of sensors, interfacing, power supplies, configuration of sensor node, and GUI development are covered. The book will be useful for engineers and researchers in the field ,especially for higher undergraduate and postgraduate students as well as practitioners working on the development of Wireless Sensor Networks or Smart Sensors.

  1. Nuclear instrumentation cable end seal

    Science.gov (United States)

    Cannon, Collins P.; Brown, Donald P.

    1979-01-01

    An improved coaxial end seal for hermetically sealed nuclear instrumentation cable exhibiting an improved breakdown pulse noise characteristic under high voltage, high temperature conditions. A tubular insulator body has metallized interior and exterior surface portions which are braze sealed to a center conductor and an outer conductive sheath. The end surface of the insulator body which is directed toward the coaxial cable to which it is sealed has a recessed surface portion within which the braze seal material terminates.

  2. Instruments de mesure en acoustique

    DEFF Research Database (Denmark)

    Tarnov, Viggo; Jacobsen, Finn

    2008-01-01

    La mesure en acoustique fait appel à des instruments qui mesurent, d'une part la pression, d'autre part l'intensité du signal. Ce dossier présentera, notamment, deux appareils spécialisés : les sonomètres et les microphones. Il abordera l'ensemble des informations majeures à connaître sur les...

  3. SMAP Instrument Mechanical System Engineering

    Science.gov (United States)

    Slimko, Eric; French, Richard; Riggs, Benjamin

    2013-01-01

    The Soil Moisture Active Passive (SMAP) mission, scheduled for launch by the end of 2014, is being developed to measure the soil moisture and soil freeze/thaw state on a global scale over a three-year period. The accuracy, resolution, and global coverage of SMAP measurements are invaluable across many science and applications disciplines including hydrology, climate, carbon cycle, and the meteorological, environment, and ecology applications communities. The SMAP observatory is composed of a despun bus and a spinning instrument platform that includes both a deployable 6 meter aperture low structural frequency Astromesh reflector and a spin control system. The instrument section has engendered challenging mechanical system issues associated with the antenna deployment, flexible antenna pointing in the context of a multitude of disturbances, spun section mass properties, spin control system development, and overall integration with the flight system on both mechanical and control system levels. Moreover, the multitude of organizations involved, including two major vendors providing the spin subsystem and reflector boom assembly plus the flight system mechanical and guidance, navigation, and control teams, has led to several unique system engineering challenges. Capturing the key physics associated with the function of the flight system has been challenging due to the many different domains that are applicable. Key interfaces and operational concepts have led to complex negotiations because of the large number of organizations that integrate with the instrument mechanical system. Additionally, the verification and validation concerns associated with the mechanical system have had required far-reaching involvement from both the flight system and other subsystems. The SMAP instrument mechanical systems engineering issues and their solutions are described in this paper.

  4. Instrumentation of the fast detector

    CERN Document Server

    Barczyk, A.; Malgeri, L.; Casella, C.; Pohl, M.; Deiters, K.; Dick, P.; Berdugo, J.; Casaus, J.; Mana, C.; Marin, J.; Martinez, G.; Sanchez, E.; Willmott, C.

    2008-01-01

    The Fiber Active Scintillator Target (FAST) is an imaging particle detector intended for high precision muon lifetime measurement. This measurement will lead to a determination of the Fermi coupling constant (GF) with an uncertainty of 1 ppm, one order of magnitude better than the current world average. This contribution presents a description of the detector instrumentation and the first results, which have validated the design of the system.

  5. SMAP Instrument Mechanical System Engineering

    Science.gov (United States)

    Slimko, Eric; French, Richard; Riggs, Benjamin

    2013-01-01

    The Soil Moisture Active Passive (SMAP) mission, scheduled for launch by the end of 2014, is being developed to measure the soil moisture and soil freeze/thaw state on a global scale over a three-year period. The accuracy, resolution, and global coverage of SMAP measurements are invaluable across many science and applications disciplines including hydrology, climate, carbon cycle, and the meteorological, environment, and ecology applications communities. The SMAP observatory is composed of a despun bus and a spinning instrument platform that includes both a deployable 6 meter aperture low structural frequency Astromesh reflector and a spin control system. The instrument section has engendered challenging mechanical system issues associated with the antenna deployment, flexible antenna pointing in the context of a multitude of disturbances, spun section mass properties, spin control system development, and overall integration with the flight system on both mechanical and control system levels. Moreover, the multitude of organizations involved, including two major vendors providing the spin subsystem and reflector boom assembly plus the flight system mechanical and guidance, navigation, and control teams, has led to several unique system engineering challenges. Capturing the key physics associated with the function of the flight system has been challenging due to the many different domains that are applicable. Key interfaces and operational concepts have led to complex negotiations because of the large number of organizations that integrate with the instrument mechanical system. Additionally, the verification and validation concerns associated with the mechanical system have had required far-reaching involvement from both the flight system and other subsystems. The SMAP instrument mechanical systems engineering issues and their solutions are described in this paper.

  6. The Instruments of Transport Policy

    Directory of Open Access Journals (Sweden)

    Gordana Štefančić

    2006-09-01

    Full Text Available The work proposes the transport policy instruments, suchas the infrastructure measures, management measures and informationprovision measures as the means that could reduceor eliminate transport problems. All these measures have beenfollowed through the provisions for passenger cars, provisionsfor public transport, provisions for cyclists and pedestrians andprovisions regarding transport. A range of solutions is given toreduce congestion, improve accessibility and improve the trafficconditions for those who depend on public transport along withthe improvement of environmental conditions.

  7. When Good Instruments Go Bad

    OpenAIRE

    Emek Basker

    2007-01-01

    This note examines the instrumental variables method used by Neumark, Zhang, and Ciccarella (2005) to analyze Wal-Mart's effect on retail labor markets, and exposes major flaws in that methodology. Neumark, Zhang, and Ciccarella use an interaction between distance from Wal-Mart's headquarters and time effects to predict Wal-Mart's presence in a county, and find that each Wal-Mart store destroys, on average, approximately 200 retail jobs. These findings are in stark contrast to Basker (2005) w...

  8. Measuring instruments of corporate reputation

    Directory of Open Access Journals (Sweden)

    Damir Grgić

    2008-12-01

    Full Text Available The subject of this paper is focused on the instruments for the measurement of corporate reputation. Recent research of the elements which influence the success of a company shows a growing interest in intangible values. Corporate reputation itself has been identified as one of the key intangible assets which create the company’s added value. Understanding of the importance of corporate reputation has been determined as a significant component of the company’s competitiveness, that is, of its competitive edge. Reputation is a normal part of our life and an integral part of our society. Our interest in the honesty and integrity of others is firmly established in all cultures and nowadays the focus of this interest is switching increasingly on companies. Corporate reputation can be acquired by means of strong, well-developed strategies, which are crucial for the opinion of stakeholders regarding future stability and competitive sustainability of the company. On the other hand, it should be emphasized that in order to manage it, corporate reputation has to be measured first. However, although the concept of corporate reputation is universally accepted and its significance has been recognized especially in the last two decades, the process of its measurement is still at an early stage and there is no universally accepted instrument for its measurement. Therefore, the author of this paper gives an overview of the instruments used for the measurement of corporate reputation which have gained a foothold through former practical usage.

  9. The APEX-SZ Instrument

    CERN Document Server

    Schwan, Daniel; Basu, Kaustuv; Bender, Amy N; Bertoldi, Frank; Cho, Hsaio-Mei; Chon, Guyong; Clarke, John; Dobbs, Matt; Ferrusca, Daniel; Gusten, Rolfe; Halverson, Nils W; Holzapfel, William L; Horellou, Cathy; Johansson, Daniel; Johnson, Bradley R; Kennedy, James; Kermish, Zigmund; Kneissl, Ruediger; Lanting, Trevor; Lee, Adrian T; Lueker, Martin; Mehl, Jared; Menten, Karl M; Muders, Dirk; Pacaud, Florian; Plagge, Thomas; Reichardt, Christian L; Richards, Paul L; Schaaf, Rienhold; Schilke, Peter; Sommer, Martin W; Spieler, Helmuth; Tucker, Carole; Weiss, Axel; Westbrook, Benjamin; Zahn, Oliver

    2010-01-01

    The APEX-SZ instrument is a millimeter-wave cryogenic receiver designed to observe galaxy clusters via the Sunyaev-Zel'dovich effect from the 12 m APEX telescope on the Atacama plateau in Chile. The receiver contains a focal plane of 280 superconducting transition-edge sensor (TES) bolometers instrumented with a frequency-domain multiplexed readout system. The bolometers are cooled to 280 mK via a three-stage helium sorption refrigerator and a mechanical pulse-tube cooler. Three warm mirrors, two 4 K lenses, and a horn array couple the TES bolometers to the telescope. APEX-SZ observes in a single frequency band at 150 GHz with 1' angular resolution and a 22' field-of-view, all well suited for cluster mapping. The APEX-SZ receiver has played a key role in the introduction of several new technologies including TES bolometers, the frequency-domain multiplexed readout, and the use of a pulse-tube cooler with bolometers. As a result of these new technologies, the instrument has a higher instantaneous sensitivity a...

  10. TECHNICAL TRAINING SEMINAR: National Instruments

    CERN Multimedia

    Monique Duval

    2004-01-01

    From 9:30 to 12:00 and from 13:00 to 16:00 hrs - Council Chamber, Salle B, Salle des Pas Perdus National Instruments (NI) on Tour 2004 Claudia Jüngel, Evrem Yarkin, Joel Clerc, Hervé Baour / NATIONAL INSTRUMENTS The special event NI on Tour 2004, run in Germany, Austria and Switzerland, will be at CERN on March 30. Technical seminars and free introductory courses will be offered all day long in the Council Chamber, Salle B, and Salle des Pas Perdus (buildings 61 and 503). Data acquisition systems on PCs, industrial measurement and control techniques, advanced LabVIEW software and PXI instrumentation, and system components for tests and automation will be presented. Walk-in courses will address DIAdem, LabVIEW and data acquisition. Language: English and French Free seminars and courses, no registration Organisers: Rolf Stampfli / IT-CO / 78102 & 160367 / Rolf.Stampfli@cern.ch Davide Vitè / HR-PMD-ATT / 75141 Davide.Vite@cern.ch For more information and the complete event programme, please visit the...

  11. PING: A new approach for nuclear fuel cycle instrumentation

    Energy Technology Data Exchange (ETDEWEB)

    Normand, S.; Kondrasov, V.; Corre, G. [CEA, LIST, Laboratoire Capteur et Architectures Electroniques, F-91191 Gif Sur Yvette (France); Passard, C. [CEA, DEN, Cadarache, Nuclear Measurement Laboratory, F-13108 St Paul-lez-Durance (France)

    2009-07-01

    We introduce here a new concept of nuclear instrumentation system. We have developed a new and flexible system for nuclear measurement called PING. PING stands for New Generation Instrument Platform. This new measurement system could be able to do measurements in active neutron condition, especially time stamping, as well as photon gamma spectrometry. This development is done in order to optimize Nuclear Process Control systems. In fact numbers of used instrumentations are specific and most of them are no longer supplied by any firm. Then the main idea that conducts this project development is to concentrate all hardware requirements inside one device. Only the software embedded inside the FPGA is considered as the real measurement part of the device. Any hardware upgrading should not modify measurement performances. Thus which is durable is the software. (authors)

  12. Microwave generator

    Science.gov (United States)

    Kwan, T.J.T.; Snell, C.M.

    1987-03-31

    A microwave generator is provided for generating microwaves substantially from virtual cathode oscillation. Electrons are emitted from a cathode and accelerated to an anode which is spaced apart from the cathode. The anode has an annular slit there through effective to form the virtual cathode. The anode is at least one range thickness relative to electrons reflecting from the virtual cathode. A magnet is provided to produce an optimum magnetic field having the field strength effective to form an annular beam from the emitted electrons in substantial alignment with the annular anode slit. The magnetic field, however, does permit the reflected electrons to axially diverge from the annular beam. The reflected electrons are absorbed by the anode in returning to the real cathode, such that substantially no reflexing electrons occur. The resulting microwaves are produced with a single dominant mode and are substantially monochromatic relative to conventional virtual cathode microwave generators. 6 figs.

  13. The Undergraduate Student Instrumentation Projects at the University of Houston

    Science.gov (United States)

    Bering, E. A., III; Talbot, R. W.; Glennie, C. L.; Rodrigues, D.; Jinghong, C.; Alozie, M.; Behrend, C. C.; Bias, C.; Ehteshami, A.; Fenton, A.; Greer, M.; Gunawan, B.; Harrison, W.; Jordan, J.; Lalata, M. C.; Lehnen, J. N.; Martinez, A.; Mathur, S.; Medillin, M.; Nguyen, T.; Nguyen, T. V.; Nowling, M.; Perez, D.; Pham, M.; Pina, M.; Porat, I.; Prince, J.; Thomas, G. C.; Velasquez, B.; Victor, L.

    2016-12-01

    The Undergraduate Student Instrumentation Project (USIP) is a NASA program to engage undergraduate students in rigorous scientific research, for the purposes of innovation and developing the next generation of professionals for an array of fields. The program is student led and executed from initial ideation to research to the design and deployment of scientific payloads. The University of Houston has been selected twice to participate in the USIP programs. The first program (USIP_UH I) ran from 2013 to 2016. USIP_UH II started in January of this year, with funding starting at the end of May. USIP_UH I (USIP_UH II) at the University of Houston was (is) composed of eight (seven) research teams developing six (seven), distinct, balloon-based scientific instruments. These instruments will contribute to a broad range of geophysical sciences from Very Low Frequency recording and Total Electron Content to exobiology and ozone profiling. USIP_UH I had 12 successful launches with 9 recoveries from Fairbanks, AK in March 2015 and 4 piggyback flights with BARREL 3 from Esrange, Kiruna, Sweden in August, 2015. Additional flights with BARREL 4 will take place in August 2016. The great opportunity of this program is capitalizing on the proliferation of electronics miniaturization to create new generations of scientific instruments that are smaller and lighter than ever before. This situation allows experiments to be done more cheaply which ultimately allows many more experiments to be done.

  14. Solar Generator

    Science.gov (United States)

    1985-01-01

    The Vanguard I dish-Stirling module program, initiated in 1982, produced the Vanguard I module, a commercial prototype erected by the Advanco Corporation. The module, which automatically tracks the sun, combines JPL mirrored concentrator technology, an advanced Stirling Solar II engine/generator, a low cost microprocessor-controlled parabolic dish. Vanguard I has a 28% sunlight to electricity conversion efficiency. If tests continue to prove the system effective, Advanco will construct a generating plant to sell electricity to local utilities. An agreement has also been signed with McDonnell Douglas to manufacture a similar module.

  15. The Dark Energy Spectroscopic Instrument (DESI) instrument mechanism control systems

    Science.gov (United States)

    Coker, Carl T.; Pappalardo, Daniel; Pogge, Richard; Martini, Paul; Derwent, Mark; O'Brien, Thomas P.; Honscheid, Klaus

    2016-08-01

    The Dark Energy Spectroscopic Instrument (DESI) is under construction to measure the expansion history of the Universe using the Baryon Acoustic Oscillation technique. The spectra of 40 million galaxies over 14,000 sq deg will be measured during the life of the experiment. A new prime focus corrector for the KPNO Mayall telescope will deliver light to 5,000 fiber optic positioners. The fibers in turn feed ten broad-band spectrographs. We present the design details of the instrument mechanism control systems for the spectrographs. Each spectrograph has a stand-alone mechanism control box that operates the unit's four remotely-operated mechanisms (two shutters and two Hartmannn doors), and provides a suite of temperature and humidity sensors. Each control box is highly modular, and is operated by a dedicated on-board Linux computer to provide all of the control and monitoring functions. We describe our solution for integrating a number of network-connected devices within each unit spectrograph, and describe the basic software architecture.

  16. The Chemistry of Flammable Gas Generation

    Energy Technology Data Exchange (ETDEWEB)

    ZACH, J.J.

    2000-10-30

    The document collects information from field instrumentation, laboratory tests, and analytical models to provide a single source of information on the chemistry of flammable gas generation at the Hanford Site. It considers the 3 mechanisms of formation: radiolysis, chemical reactions, and thermal generation. An assessment of the current models for gas generation is then performed. The results are that the various phenomena are reasonably understood and modeled compared to field data.

  17. Solar Energy Research Center Instrumentation Facility

    Energy Technology Data Exchange (ETDEWEB)

    Meyer, Thomas, J.; Papanikolas, John, P.

    2011-11-11

    SOLAR ENERGY RESEARCH CENTER INSTRUMENTATION FACILITY The mission of the Solar Energy Research Center (UNC SERC) at the University of North Carolina at Chapel Hill (UNC-CH) is to establish a world leading effort in solar fuels research and to develop the materials and methods needed to fabricate the next generation of solar energy devices. We are addressing the fundamental issues that will drive new strategies for solar energy conversion and the engineering challenges that must be met in order to convert discoveries made in the laboratory into commercially available devices. The development of a photoelectrosynthesis cell (PEC) for solar fuels production faces daunting requirements: (1) Absorb a large fraction of sunlight; (2) Carry out artificial photosynthesis which involves multiple complex reaction steps; (3) Avoid competitive and deleterious side and reverse reactions; (4) Perform 13 million catalytic cycles per year with minimal degradation; (5) Use non-toxic materials; (6) Cost-effectiveness. PEC efficiency is directly determined by the kinetics of each reaction step. The UNC SERC is addressing this challenge by taking a broad interdisciplinary approach in a highly collaborative setting, drawing on expertise across a broad range of disciplines in chemistry, physics and materials science. By taking a systematic approach toward a fundamental understanding of the mechanism of each step, we will be able to gain unique insight and optimize PEC design. Access to cutting-edge spectroscopic tools is critical to this research effort. We have built professionally-staffed facilities equipped with the state-of the-art instrumentation funded by this award. The combination of staff, facilities, and instrumentation specifically tailored for solar fuels research establishes the UNC Solar Energy Research Center Instrumentation Facility as a unique, world-class capability. This congressionally directed project funded the development of two user facilities: TASK 1: SOLAR

  18. In Situ Instrumentation for Sub-Surface Planetary Geochemistry

    Science.gov (United States)

    Bodnarik, J.; Evans, L.; Floyd, S.; Lim, L.; McClanahan, T.; Namkung, M.; Parsons, A.; Schweitzer, J.; Starr, R.; Trombka, J.

    2010-01-01

    Novel instrumentation is under development at NASA's Goddard Space Flight Center, building upon earth-based techniques for hostile environments, to infer geochemical processes important to formation and evolution of solid bodies in our Solar System. A prototype instrument, the Pulsed Neutron Generator Gamma Ray and Neutron Detectors (PNG-GRAND), has a 14 MeV pulsed neutron generator coupled with gamma ray and neutron detectors to measure quantitative elemental concentrations and bulk densities of a number of major, minor and trace elements at or below the surfaces with approximately a meter-sized spatial resolution down to depths of about 50 cm without the need to drill. PNG-GRAND's in situ a meter-scale measurements and adaptability to a variety of extreme space environments will complement orbital kilometer-scale and in-situ millimeter scale elemental and mineralogical measurements to provide a more complete picture of the geochemistry of planets, moons, asteroids and comets.

  19. Condensation Particle Counter Instrument Handbook

    Energy Technology Data Exchange (ETDEWEB)

    Kuang, C. [Brookhaven National Lab. (BNL), Upton, NY (United States)

    2016-02-01

    The Model 3772 CPC is a compact, rugged, and full-featured instrument that detects airborne particles down to 10 nm in diameter, at an aerosol flow rate of 1.0 lpm, over a concentration range from 0 to 1x104 #/cc. This CPC is ideally suited for applications without high concentration measurements, such as basic aerosol research, filter and air-cleaner testing, particle counter calibrations, environmental monitoring, mobile aerosol studies, particle shedding and component testing, and atmospheric and climate studies.

  20. Magnetospheric multiprobes: Investigations and instrumentation

    Science.gov (United States)

    Burch, J. L.; Chappell, C. R.; Fields, S. A.; Falthammar, C. G.; Winningham, J. D.; Hanson, W. B.; Heelis, R. A.; Heikkila, W. J.; Sugira, M.; Farthing, W. H.

    1980-01-01

    The multiprobe scientific objectives are to: (1) determine the spatial structure of plasma phenomena such as the aurora, convection reversals, and ion troughs; (2) separate spatial and temporal variations in these phenomena; (3) determine field aligned current densities; (4) perform multiple point analysis of particle beams, wave fields, and plasma clouds that are injected into the ionosphere and magnetosphere by Spacelab active experiment facilities. Trade studies described include: instrument accommodations, power, attitude determination, electric field antennas, storage and ejection, thermal control, tracking communications, command and data management, payload and mission specialist support, functional objectives, and orbital analysis.

  1. Solwind instrument destroyed in test

    Science.gov (United States)

    The U.S. Air Force's destruction of one of its own satellites last month ended what had been the longest continuous stream of data from an instrument observing the sun's corona. Satellite P78-1 served as the target in a test of antisatellite (ASAT) weaponry on September 13, 1985. The satellite carried Solwind, a white light coronagraph that observed the solar corona at distances of 3-10 solar radii, according to Robert M. MacQueen, director of the High Altitude Observatory at the National Center for Atmospheric Research (NCAR) in Boulder, Colo.

  2. Qin Music on Antique Instruments

    OpenAIRE

    Goormaghtigh, Georges

    2011-01-01

    Rares sont les occasions d’entendre le son du qin, l’antique cithare chinoise, montée de cordes de soie. La quasi totalité des enregistrements disponibles sur le marché en Chine continentale, à Taiwan ou même en Occident sont en effet marqués par le timbre sui generis des cordes en acier filées de nylon qui, depuis quelque trente ans, ont presque totalement remplacé, même sur des instruments très anciens, la soie millénaire. Conçu pour servir d’illustration sonore à une remarquable exposition...

  3. Tevatron instrumentation: boosting collider performance

    Energy Technology Data Exchange (ETDEWEB)

    Shiltsev, Vladimir; Jansson, Andreas; Moore, Ronald; /Fermilab

    2006-05-01

    The Tevatron in Collider Run II (2001-present) is operating with six times more bunches, many times higher beam intensities and luminosities than in Run I (1992-1995). Beam diagnostics were crucial for the machine start-up and the never-ending luminosity upgrade campaign. We present the overall picture of the Tevatron diagnostics development for Run II, outline machine needs for new instrumentation, present several notable examples that led to Tevatron performance improvements, and discuss the lessons for the next big machines--LHC and ILC.

  4. Financial instrument pricing using C++

    CERN Document Server

    Duffy, Daniel J

    2004-01-01

    One of the best languages for the development of financial engineering and instrument pricing applications is C++. This book has several features that allow developers to write robust, flexible and extensible software systems. The book is an ANSI/ISO standard, fully object-oriented and interfaces with many third-party applications. It has support for templates and generic programming, massive reusability using templates (?write once?) and support for legacy C applications. In this book, author Daniel J. Duffy brings C++ to the next level by applying it to the design and implementation of class

  5. Martian Generation

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Independent, Internet savvy and with their own Martian language, China’s post-90s generation is rewriting the rules of behavior september 14 was the 18th birth-day of Zhang Zhaoyu from Sichuan Province. He is a new student at Peking University,

  6. Generative Contexts

    Science.gov (United States)

    Lyles, Dan Allen

    Educational research has identified how science, technology, engineering, and mathematics (STEM) practice and education have underperforming metrics in racial and gender diversity, despite decades of intervention. These disparities are part of the construction of a culture of science that is alienating to these populations. Recent studies in a social science framework described as "Generative Justice" have suggested that the context of social and scientific practice might be modified to bring about more just and equitable relations among the disenfranchised by circulating the value they and their non-human allies create back to them in unalienated forms. What is not known are the underlying principles of social and material space that makes a system more or less generative. I employ an autoethnographic method at four sites: a high school science class; a farm committed to "Black and Brown liberation"; a summer program geared towards youth environmental mapping; and a summer workshop for Harlem middle school students. My findings suggest that by identifying instances where material affinity, participatory voice, and creative solidarity are mutually reinforcing, it is possible to create educational contexts that generate unalienated value, and circulate it back to the producers themselves. This cycle of generation may help explain how to create systems of justice that strengthen and grow themselves through successive iterations. The problem of lack of diversity in STEM may be addressed not merely by recruiting the best and the brightest from underrepresented populations, but by changing the context of STEM education to provide tools for its own systematic restructuring.

  7. Synchronous generators

    CERN Document Server

    Boldea, Ion

    2005-01-01

    This work begins with an introduction to energy resources and the main electric energy conversion solutions, along with efficiency and environmental merits and demerits. The classification and principles of various electric generator topologies are covered alongside their power ratings and main applications including constant-speed synchronous gene

  8. Radiatively Generated $\

    CERN Document Server

    Joshipura, A S; Joshipura, Anjan S.; Rindani, Saurabh D.

    2003-01-01

    We study the consequences of assuming that the mass scale $\\Delta_{odot}$ corresponding to the solar neutrino oscillations and mixing angle $U_{e3}$ corresponding to the electron neutrino oscillation at CHOOZ are radiatively generated through the standard electroweak gauge interactions. All the leptonic mass matrices having zero $\\Delta_{odot}$ and $U_{e3}$ at a high scale lead to a unique low energy value for the $\\Delta_{odot}$ which is determined by the (known) size of the radiative corrections, solar and the atmospheric mixing angle and the Majorana mass of the neutrino observed in neutrinoless double beta decay. This prediction leads to the following consequences: ($i$) The MSSM radiative corrections generate only the dark side of the solar neutrino solutions. ($ii$) The inverted mass hierarchy ($m,-m,0$) at the high scale fails in generating the LMA solution but it can lead to the LOW or vacuum solutions. ($iii$) The $\\Delta_{odot}$ generated in models with maximal solar mixing at a high scale is zero t...

  9. Application of Virtual Instrument in Electronic Education

    Directory of Open Access Journals (Sweden)

    Zhongbao Ji

    2013-09-01

    Full Text Available Virtual instrumentation is defined as the combination of measurement and control hardware and application software with industry-standard computer technology to create user-defined instrumentation systems. Since the birth of virtual instrument (VI, it enters rapidly into the industrial production field, and Research and Development (RD field. It can improve production quality, shorten development time, and increase production efficiency. So it is wildly used in companies. In order to improve the ability of students’ using new technology and equipment, and save daily funds, we try to use virtual instrument instead of traditional instruments for analysis and design circuits. The paper adopts the software-LabVIEW and many hardware modules of NI (National Instrument to study of virtual instrument applied in electronic education of vocational college. The research result of this work can provide a theoretical and practical foundation for vocational education of virtual instrument in the future.

  10. Dizi—A Traditional Chinese Wind Instrument

    Institute of Scientific and Technical Information of China (English)

    1994-01-01

    RETIRED worker Zhang Guizhen knows a lot about dizi, a traditional Chinese wind instrument, because she worked in the Beijing Traditional Instrument Factory for 20 years and her only task was to make dizi.

  11. Flexible Developing System for Modern Instrument Manufacturing

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    The modern instrument manufacturing has many features, such as high technologies, multiple varieties and small quantities. Aiming at those features, an instrumentation flexible developing system (IFDS) is presented. It constitutes a kind of opening, compatible, extensible and upgradeable flexible developing system, and it will offer a kind of technology equipment for the research and development of new modern instrument products. Its flexible mechanism is able to be suited for different and special requirements of many instrument systems, and its system integrated mechanism is able to adapt to common technological features of most instrument systems. It is IFDS that makes it easy to accomplish a quick system integration of instrument products. IFDS solves key technological problems related to modern instruments development, develops multiple systems for modern instrument development and accomplishes rapid development of series of new products.

  12. Using Model-Based Reasoning for Autonomous Instrument Operation

    Science.gov (United States)

    Johnson, Mike; Rilee, M.; Truszkowski, W.; Powers, Edward I. (Technical Monitor)

    2000-01-01

    of environmental hazards, frame the problem of constructing autonomous science instruments. we are developing a model of the Low Energy Neutral Atom instrument (LENA) that is currently flying on board the Imager for Magnetosphere-to-Aurora Global Exploration (IMAGE) spacecraft. LENA is a particle detector that uses high voltage electrostatic optics and time-of-flight mass spectrometry to image neutral atom emissions from the denser regions of the Earth's magnetosphere. As with most spacecraft borne science instruments, phenomena in addition to neutral atoms are detected by LENA. Solar radiation and energetic particles from Earth's radiation belts are of particular concern because they may help generate currents that may compromise LENA's long term performance. An explicit model of the instrument response has been constructed and is currently in use on board IMAGE to dynamically adapt LENA to the presence or absence of energetic background radiations. The components of LENA are common in space science instrumentation, and lessons learned by modelling this system may be applied to other instruments. This work demonstrates that a model-based approach can be used to enhance science instrument effectiveness. Our future work involves the extension of these methods to cover more aspects of LENA operation and the generalization to other space science instrumentation.

  13. Considerations regarding law as an instrument of communication

    OpenAIRE

    Claudiu Ramon BUTCULESCU

    2014-01-01

    This paper tackles the possibility of envisioning law as an instrument of communication, using systemic and informational models. The effects of legal communication have a profound influence on the evolution of the system of law and also on national legal cultures. The means through which law is communicated, as well as the analysis of the information that is transmitted, along with the legal noise generated by the poor understanding of legal norms, are briefly discussed in the paper. In this...

  14. Developing an instrument simulator: experience feedback from the JWST/NIRSpec and VLT/MUSE simulators

    Science.gov (United States)

    Jarno, Aurélien; Piqueras, Laure; Bacon, Roland; Ferruit, Pierre; Legros, Emeline; Pécontal-Rousset, Arlette; Gnata, Xavier; Streicher, Ole; Weilbacher, Peter

    2012-09-01

    The Centre de Recherche Astrophysique de Lyon (CRAL) has recently developed two instrument simulators for spectrographic instruments. They are based on Fourier optics, and model the whole chain of acquisition, taking into account both optical aberrations and diffraction effects, by propagating a wavefront through the instrument, according to the Fourier optics concept. One simulates the NIRSpec instrument, a near-infrared multi-object spectrograph for the future James Webb Space Telescope (JWST). The other one models the Multi Unit Spectroscopic Explorer (MUSE) instrument, a second-generation integral-field spectrograph for the Very Large Telescope (VLT). The two simulators have been developed in different contexts (subcontracted versus developed internally), and for very different instruments (space-based versus ground-based), which strengthen the CRAL experience. This paper describes the lessons learned while developing these simulators: development methods, phasing with the project, points to focus on, getting data, interacting with scientists and users, etc.

  15. Next-Generation Telemetry Workstation

    Science.gov (United States)

    2008-01-01

    A next-generation telemetry workstation has been developed to replace the one currently used to test and control Range Safety systems. Improving upon the performance of the original system, the new telemetry workstation uses dual-channel telemetry boards for better synchronization of the two uplink telemetry streams. The new workstation also includes an Interrange Instrumentation Group/Global Positioning System (IRIG/GPS) time code receiver board for independent, local time stamping of return-link data. The next-generation system will also record and play back return-link data for postlaunch analysis.

  16. Explicit Mapping of Acoustic Regimes For Wind Instruments

    CERN Document Server

    Missoum, Samy; Doc, Jean-Baptiste

    2014-01-01

    This paper proposes a methodology to map the various acoustic regimes of wind instruments. The maps can be generated in a multi-dimensional space consisting of design, control parameters, and initial conditions. The bound- aries of the maps are obtained explicitly in terms of the parameters using a support vector machine (SVM) classifier as well as a dedicated adaptive sam- pling scheme. The approach is demonstrated on a simplified clarinet model for which several maps are generated based on different criteria. Examples of computation of the probability of occurrence of a specific acoustic regime are also provided. In addition, the approach is demonstrated on a design optimization example for optimal intonation.

  17. Are Musical Instrument Gender Associations Changing?

    Science.gov (United States)

    Abeles, Hal

    2009-01-01

    The researcher sought to examine gender associations across three decades to determine if changes in the sex stereotyping of musical instruments has occurred. First, the study examined the paired comparison gender-instrument rankings of 180 college students. The results confirmed a reduction of instrument gender associations reported in the 1990s.…

  18. ICFA Instrumentation Bulletin, Volume 14, Spring 1997

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-07-01

    The publication of the ICFA Instrumentation Bulletin is an activity of the Panel on Future Innovation and Development of ICFA (International Committee for Future Accelerators). The Bulletin reports on research and progress in the field of instrumentation with emphasis on application in the field of high-energy physics. It encourages issues of generic instrumentation.

  19. Development of a Workshop Evaluation Instrument.

    Science.gov (United States)

    Johnson, William L.; Wiens, Scott A.; Johnson, Annabel M.

    This paper details the development and psychometric analysis of an instrument used for workshop evaluation. The instrument was designed to assess the effectiveness of the workshops, the instructors conducting the workshop training, and the training materials. The instrument used a Likert agree/disagree format. A psychometric analysis of scores…

  20. Industrial Instrument Mechanic. Occupational Analyses Series.

    Science.gov (United States)

    Dean, Ann; Zagorac, Mike; Bumbaka, Nick

    This analysis covers tasks performed by an industrial instrument mechanic, an occupational title some provinces and territories of Canada have also identified as industrial instrumentation and instrument mechanic. A guide to analysis discusses development, structure, and validation method; scope of the occupation; trends; and safety. To facilitate…